[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rluD.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2istA.bssp"
#ERROR : Can't open dsspfile "1v9fA.bssp"
#ERROR : Can't open dsspfile "1xpiB.bssp"
#ERROR : Can't open dsspfile "1xpiA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "1qyuA.bssp"
#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "2i82C.bssp"
#ERROR : Can't open dsspfile "2i82B.bssp"
#ERROR : Can't open dsspfile "2i82A.bssp"

## Summary of PDB Search
:298
    7e-51  45%  2istA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    5e-43  47%  1v9fA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    1e-33  40%  1xpiB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    4e-33  40%  1xpiA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    2e-32  50%  1przA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    2e-32  48%  1qyuA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    1e-29  40%  1v9kA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    2e-19  38%  2i82C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    2e-19  38%  2i82B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    2e-19  38%  2i82A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
2istA           ------------RLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVCDKPKEKVLGGEQVAINAEIERF--
1v9fA           ----------------------------------------------------------------------
1xpiB           ----------------------------------------------------------------------
1xpiA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1qyuA           ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
2i82C           ----------------------------------------------------------------------
2i82B           ----------------------------------------------------------------------
2i82A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EPENIPLXXXXXXXXXXXXNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
2istA           EPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
1v9fA           EPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
1xpiB           -------------------NKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
1xpiA           -------------------NKPSGTAVHGGSGLSFGVIEG-------LRALRARFLE-LVHRLDRDTSGV
1przA           EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTG-
1qyuA           EPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTG-
1v9kA           -------------------NKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
2i82C           -------------------NKPSGLL--SVPGRLEE-------HKDSVTRIQRDYQAESVHRLDA-TSGV
2i82B           -------------------NKPSGLL--SVPGRLEE-------HKDSVTRIQRDYQAESVHRLDA-TSGV
2i82A           -------------------NKPSGLL--SVPGRLEE-------HKDSVTRIQRDYQAESVHRLDA-TSGV


                         +         .         .         .         .         *         .:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
2istA           MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
1v9fA           MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
1xpiB           LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
1xpiA           LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
1przA           LVVAKTVPAQTRLVESLQRREITREYEAVAIGHTA--GGTVDEPISRHPT--KRTHAVHPGKPAVTHYRI
1qyuA           LVVAKTVPAQTRLVESLQRREITREYEAVAIGHTA--GGTVDEPISRHPT-KRTHAVHPMGKPAVTHYRI
1v9kA           LLVAKKRSALRSLHEQLREK-GQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
2i82C           IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
2i82B           IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
2i82A           IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV


                         .         .         .         +         .         .         .:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
2istA           MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
1v9fA           MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
1xpiB           EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
1xpiA           EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
1przA           -EHFRVHTXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGPRPPKGASEAFLHA-TLRLYHP-ISGIEEW
1qyuA           -EHFRVHTXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGPRPPKGASEAFLHA-TLRLYHP-ISGIEEW
1v9kA           EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGE-VRI
2i82C           VEYAADNT-ARVVLKTGRSHQLRVHLA-LGHPILGDRFYASPEARAAPRLLLHAE-LTITHP--------
2i82B           VEYAADNT-ARVVLKTGRSHQLRVHLA-LGHPILGDRFYASPEARAAPRLLLHAE-LTITHP--------
2i82A           VEYAADNT-ARVVLKTGRSHQLRVHLA-LGHPILGDRFYASPEARAAPRLLLHAE-LTITHP--------


                         .         *         .         .         .         .         +:350
query           TAPLPENFKKLLESLDKR
2istA           HAPIPQDMVELIE-----
1v9fA           HAPIPQDMVELIE-----
1xpiB           EAPMDEGLKRCLQKL---
1xpiA           EAPMDEGLKRCLQKL---
1przA           HAPIPQD-----------
1qyuA           HAPIPQD-----------
1v9kA           EAP-DEGLKRCLQKRNAR
2i82C           ------------------
2i82B           ------------------
2i82A           ------------------