[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99654.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ocyA.bssp"
#ERROR : Can't open dsspfile "2e7sN.bssp"
#ERROR : Can't open dsspfile "2e7sK.bssp"
#ERROR : Can't open dsspfile "2e7sH.bssp"
#ERROR : Can't open dsspfile "2e7sG.bssp"
#ERROR : Can't open dsspfile "2e7sD.bssp"
#ERROR : Can't open dsspfile "2e7sC.bssp"
#ERROR : Can't open dsspfile "2e7sB.bssp"
#ERROR : Can't open dsspfile "2e7sA.bssp"
#ERROR : Can't open dsspfile "2eqbB.bssp"
#ERROR : Can't open dsspfile "2efkA.bssp"
#ERROR : Can't open dsspfile "2efrB.bssp"
#ERROR : Can't open dsspfile "2efrA.bssp"

## Summary of PDB Search
:429
    1e-05  31%  2ocyA  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sN  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sK  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sH  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sG  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sD  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sC  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sB  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    2e-05  28%  2e7sA  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    5e-05  28%  2eqbB  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    1e-04  31%  2efkA  [x.x.x] CDC42-INTERACTING PROTEIN 4
    5e-04  22%  2efrB  [x.x.x] GENERAL CONTROL PROTEIN GCN4 AND TROPOMYOSIN 1
    5e-04  22%  2efrA  [x.x.x] GENERAL CONTROL PROTEIN GCN4 AND TROPOMYOSIN 1
:429

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ocyA           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sA           ----------------------------------------------------------------------
2eqbB           ----------------------------------------------------------------------
2efkA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ocyA           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sA           ----------------------------------------------------------------------
2eqbB           ----------------------------------------------------------------------
2efkA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ocyA           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sA           ----------------------------------------------------------------------
2eqbB           ----------------------------------------------------------------------
2efkA           ----------------------------------------------------------------------
2efrB           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQAKEDLD
2ocyA           ---------------------------------------------------------------QLIESVD
2e7sN           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
2e7sB           ----------------------------------------------------------------------
2e7sA           ----------------------------------------------------------------------
2eqbB           ----------------------------------------------------------------------
2efkA           ------------------------------------------------------------------KQLE
2efrB           ----------------------------------------------------------------------
2efrA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KVQAKLAKDQKNEQKAKENIAKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLD
2ocyA           K-QSHL-EEQLN--KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sN           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sK           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sH           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sG           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sD           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sC           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sB           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2e7sA           --------------KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2eqbB           --------------------------------DYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
2efkA           NSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHA-EESKNEYAAQ------------
2efrB           --EGKSAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSID
2efrA           --EGKSAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSID


                         .         .         .         .         *         .         .:420
query           KANKELIKVQATVQDKQAKLKELQDQFGNYVGDDDELADTKKxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ocyA           KLNKEVEDLTASLFDE------------------------------------------------------
2e7sN           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sK           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sH           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sG           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sD           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sC           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sB           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2e7sA           KLNKEVEDLTASLFDEANNL--------------------------------------------------
2eqbB           KLNKEVEDLTASLFDE------------------------------------------------------
2efkA           ----------------------------------------------------------------------
2efrB           DLEDELYAQKLKYKAISEEMKQLEDKVEELLSKENEVARLKK----------------------------
2efrA           DLEDELYAQKLKYKAISEEMKQLEDKVEELLSKENEVARLKK----------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxx
2ocyA           ---------
2e7sN           ---------
2e7sK           ---------
2e7sH           ---------
2e7sG           ---------
2e7sD           ---------
2e7sC           ---------
2e7sB           ---------
2e7sA           ---------
2eqbB           ---------
2efkA           ---------
2efrB           ---------
2efrA           ---------