[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rplU

[Show Plain Result]

#ERROR : Can't open dsspfile "2j01V.bssp"
#ERROR : Can't open dsspfile "1vs6R.bssp"
#ERROR : Can't open dsspfile "1vs9P.bssp"
#ERROR : Can't open dsspfile "2zjrO.bssp"
#ERROR : Can't open dsspfile "3bboT.bssp"

## Summary of PDB Search
:102
    1e-20  48%  2j01V  [x.x.x] 50S RIBOSOMAL PROTEIN L21
    6e-18  40%  1vs6R  [x.x.x] 50S RIBOSOMAL PROTEIN L21
    1e-13  41%  1vs9P  [i.1.1 (1vorS)] 50S RIBOSOMAL PROTEIN L21
    8e-12  40%  2zjrO  [x.x.x] 50S RIBOSOMAL PROTEIN L21
    2e-10  47%  3bboT  [x.x.x] RIBOSOMAL PROTEIN L21
:102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
2j01V           MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELP-VLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKK
1vs6R           MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
1vs9P           MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVEL-KALFVGGEQTVFGED-AGKYTVQAEVVEHGRGKK
2zjrO           ----IQTGGKQYRVSEGDVIRVESLQGEAGDKVEL-KALFVGGEQTVFGED-AGKYTVQAEVVEHGRGKK
3bboT           IFAVVVIGSRQYIVIPGRWIYTQRLKATVNDKIVLNKVLLVGTKSTYIGTPIVTNAAVHAVVEEQLLXXX


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXHQHTKQGHRQPYTKVVIDAINA
2j01V           ILVSKFKAKVQYRRKKGHRQPYTELLIKEI--
1vs6R           VKIVKFRRRKHYRKQQGHRQWFTDVKITGISA
1vs9P           IYIRKYKSGVQYRRRTGHRQNFTAIKI-----
2zjrO           IYIRKYKSGVQYRRRTGHRQNFTAIKI-----
3bboT           XXXXXXXXXXXXXXXXGHRQPITRIKITGI--