[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:cydC

[Show Plain Result]

#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "1us8B.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"

## Summary of PDB Search
:586
    1e-38  32%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    1e-38  32%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-38  32%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    4e-37  35%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    2e-36  38%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    2e-36  37%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-36  37%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    6e-36  36%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-36  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-36  36%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-35  36%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-35  36%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-31  39%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    7e-31  35%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-31  35%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-30  38%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    2e-29  41%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    2e-28  30%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    7e-28  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-26  29%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-26  29%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-25  29%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-24  33%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-24  29%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-24  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-22  36%  2oukB  [x.x.x] PROTEIN ARTP
    1e-22  36%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-21  33%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-21  33%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-21  29%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-21  32%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-21  31%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    4e-21  30%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-21  30%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-21  30%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-21  30%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-21  30%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-20  33%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-20  32%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-20  32%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-19  31%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-19  31%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-19  31%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-18  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  30%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  30%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-18  30%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-18  32%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-18  29%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    3e-18  34%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    3e-18  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-17  29%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-17  29%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-17  28%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-17  32%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-17  30%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-17  30%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-17  30%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-17  30%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-17  32%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-17  30%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-16  30%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-16  30%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-16  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-16  30%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-16  31%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-15  31%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-15  30%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    5e-15  28%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    5e-15  28%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    7e-15  33%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-15  33%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-14  34%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-13  25%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-13  31%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    2e-13  28%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-13  29%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-13  29%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-13  32%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-12  28%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-12  29%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-12  34%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-12  28%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-12  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-11  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-11  29%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-11  30%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-11  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    6e-11  30%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    6e-11  28%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-10  29%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-10  36%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    4e-10  26%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    4e-10  26%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    4e-10  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-09  31%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    2e-09  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-09  28%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-08  30%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-08  34%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    5e-08  34%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-06  34%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-06  34%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-06  34%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    1e-05  38%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    1e-05  38%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    1e-05  38%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    1e-05  38%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    2e-05  34%  1us8B  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    2e-05  41%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-05  41%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-05  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-05  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-05  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-05  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-05  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    9e-05  29%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    9e-05  29%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
:586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxFLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRSATRPENILLVYVPI
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           -------------------FVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAINHALTTDEKVLTIAIGI
1pf4A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VLTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSEDINHIQNL
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           ALF-IFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDF
1pf4A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2hydA           IL--------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGS
3g60A           ---------------------------------------------------FLLIYASYALWYGTSLVIS
3g5uA           ---------------------------------------------------FLLIYASYALWYGTSLVIS
2hydA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3b60A           -----------------------------------KMVSASSISDPIIQLIASLAL-AFVLYAASFPSVM
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGVYTGLANWIAAFVLCLFPVVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKL
3g60A           KEYSIGQVLTVFFSVLIASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNL------EF
3g5uA           KEYSIGQVLTVFFSVLIASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNL------EF
2hydA           -------------------------------------------------------------------IDI
1pf4A           ------------------------------------------------------------------EVDV
2ghiA           ------------------------------------------------------------------NIEF
2ff7A           -----------------------------------------------------------------HDITF
1mt0A           ------------------------------------------------------------------DITF
2ffbA           -----------------------------------------------------------------HDITF
3b5jA           -----------------------------------------------------------------HDITF
2fgkA           ------------------------------------------------------------------DITF
2ffaA           -----------------------------------------------------------------HDITF
1xefA           ------------------------------------------------------------------DITF
2ghiC           ------------------------------------------------------------------NIEF
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiB           ------------------------------------------------------------------NIEF
2ghiD           ------------------------------------------------------------------NIEF
1jj7A           -------------------------------------------------------------------VQF
3b60A           DSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAIL-----DSEQEKDEGKRVATGDLEF
2ixfC           -------------------------------------------------------------------VKF
2ixfA           -------------------------------------------------------------------VKF
2ixeA           -------------------------------------------------------------------VKF
1z2rA           ----------------------------------------------------------------------
2ixfD           -------------------------------------------------------------------VKF
2ixgA           -------------------------------------------------------------------VKF
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2it1B           ------------------------------------------------------------------EIKL
2it1A           ------------------------------------------------------------------EIKL
2ixeD           -------------------------------------------------------------------VKF
3d31A           -------------------------------------------------------------------IEI
3gfoA           -----------------------------------------------------------------YILKV
2pzgA           ------------------------------------------------------------------EVVM
2pzeB           ------------------------------------------------------------------EVVM
2pzeA           ------------------------------------------------------------------EVVM
1l2tB           -------------------------------------------------------------------IKL
1l2tA           -------------------------------------------------------------------IKL
2pzfB           ------------------------------------------------------------------EVVM
1r0zD           -------------------------------------------------------------------IIM
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2pzgB           ------------------------------------------------------------------EVVM
2yz2B           -------------------------------------------------------------------IEV
2yz2A           -------------------------------------------------------------------IEV
2pzfA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
3dhwC           -------------------------------------------------------------------IKL
2cbzA           -------------------------------------------------------------------ITV
2pcjA           ----------------------------------------------------------------------
2bboA           ------------------------------------------------------------------EVVM
2bbtB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xmjA           ------------------------------------------------------------------EVVM
1xmiB           ----------------------------------------------------------------------
1q12A           -------------------------------------------------------------------VQL
3fh6A           -------------------------------------------------------------------VQL
2awoA           -------------------------------------------------------------------VQL
2awnB           -------------------------------------------------------------------VQL
1f3oA           -------------------------------------------------------------------IKL
2bbtA           ------------------------------------------------------------------EVVM
2r6gB           -------------------------------------------------------------------VQL
2r6gA           -------------------------------------------------------------------VQL
2awoC           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2bbsA           ------------------------------------------------------------------EVVM
1g6hA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1oxvA           -------------------------------------------------------------------IIV
1oxsC           -------------------------------------------------------------------IIV
2awnC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1ji0A           -------------------------------------------------------------------LEV
2zu0C           -------------------------------------------------------------------LSI
2d3wA           -------------------------------------------------------------------LSI
1g291           ----------------------------------------------------------------------
2nq2C           -------------------------------------------------------------------LSV
2d3wD           -------------------------------------------------------------------LSI
2d62A           ------------------------------------------------------------------EVKL
2d3wC           -------------------------------------------------------------------LSI
2nq2D           -------------------------------------------------------------------LSV
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wB           -------------------------------------------------------------------LSI
1vplA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1v43A           -------------------------------------------------------------VIKMVEVKL
2pjzA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1oxxK           -------------------------------------------------------------------IIV
2awnA           -------------------------------------------------------------------VQL
2ix3A           -------------------------------------------------------------------VKV
2iwhB           -------------------------------------------------------------------VKV
2ix8A           -------------------------------------------------------------------VKV
2iw3B           -------------------------------------------------------------------VKV
2iw3A           -------------------------------------------------------------------VKV
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------------------VQL
2awnD           -------------------------------------------------------------------VQL
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
3g60A           KNIHFSYPSRKEQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRL
3g5uA           KNIHFSYPSRKEQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRL
2hydA           DHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDLTGSL
1pf4A           KDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKTNL
2ghiA           SDVNFSYKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNVNKYNNSI
2ff7A           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
1mt0A           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
2ffbA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
3b5jA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
2fgkA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
2ffaA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
1xefA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNL
2ghiC           SDVNFSYKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNVNKYNNSI
1mv5D           -HVDFAYDD-SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISENW
1mv5A           -HVDFAYDD-SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISENW
2ghiB           SDVNFSYKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNVNKYNNSI
2ghiD           SDVNFSYHR----TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDIKIGGKNVNKYNNSI
1jj7A           QDVSFAYPNRPDVVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRL
3b60A           RNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTASL
2ixfC           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHL
2ixfA           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHL
2ixeA           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHL
1z2rA           -NVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTASL
2ixfD           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHL
2ixgA           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHL
2oukB           ---------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNLKAKDTNLNKV
2oljA           ---------GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNLKAKDTNLNKV
2it1B           ENIVKKF--GNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD
2it1A           ENIVKKF--GNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD
2ixeD           QDVSFAYPNHPNQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY-DHH
3d31A           ESLSRKWKNFS---LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPE-
3gfoA           EELNYNYSDGTHA-LKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNIDYSRKGIKL
2pzgA           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzeB           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzeA           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1l2tB           KNVTKTYKMGEEIILKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDE
1l2tA           KNVTKTYKMGEEIILKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDE
2pzfB           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1r0zD           ENVTAFWEEGFGEVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9D           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9C           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9B           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9A           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r10A           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zC           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zB           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zA           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xD           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xC           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xB           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xA           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wC           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wB           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wA           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hD           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hC           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hB           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hA           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xfaA           -------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
2pzgB           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2yz2B           VNVSHIFHRGTKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG--ERKKGYEI
2yz2A           VNVSHIFHRGTKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG--ERKKGYEI
2pzfA           ---------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiE           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiC           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiA           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
3dhwC           SNITKVFHQGTRTILNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSEKA
2cbzA           RNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS---------
2pcjA           ------------EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKR
2bboA           ENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2bbtB           -----KQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1b0uA           -DLHKRY--GGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKD
2bbsB           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmjA           ENVTAFWET---PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiB           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1q12A           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
3fh6A           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
2awoA           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
2awnB           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
1f3oA           KNVTKTYKG--EEILKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDLDDDE
2bbtA           ENVTAFWEEGFGEVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2r6gB           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
2r6gA           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
2awoC           -------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
1xmiD           -------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2bbsA           ENVTAFWEEGFGEVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1g6hA           ---------GEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAE
1g9xA           ---------GEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAE
1gajA           ---------GEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAE
1z47B           ------YPGGARSV-RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK
1z47A           ------YPGGARSV-RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK
1oxvA           KNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLI
1oxsC           KNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLI
2awnC           -------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG------------------LG---
2yyzA           ---------GKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKY
2onkA           -----------------LNVDFEMGDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPER
1ji0A           QSLHVYY--GAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDINKPAHVI
2zu0C           KDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSDRA
2d3wA           KDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSDRA
1g291           ---------GEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGGIFVPPKDRDI
2nq2C           ENLGFYYQ-AENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY---------QS
2d3wD           KDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSDRA
2d62A           INIWKRF--GDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIKGVFVPPKERDV
2d3wC           KDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSDRA
2nq2D           ENLGFYYQ-----AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY---------QS
2ihyA           -----------KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG-KPGYSAETV
2d2fA           -------------ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENILELSPDE
2d3wB           KDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSDRA
1vplA           ---------GKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEV
2ihyB           -----------KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG-KPGKVGETV
2d2eA           -------------ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENILELSERA
1v43A           ENLTKRF--GNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKD
2pjzA           --------------LENINLEVN-GEKVIILGPNGSGKTTLLRAISG-LLPYSGNIFINGMEVRK----I
3fvqB           -------------VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNL
3fvqA           -------------VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNL
3bk7A           --------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIK
1sgwA           -----------KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKI
1yqtA           --------------------EIKKGEVIGIVGPNGIGKTTFVKLA-GVEEPTEGKIEWDLTVAYKPQYIK
1oxxK           KNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLI
2awnA           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPA
2ix3A           TNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV--------------
2iwhB           TNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV--------------
2ix8A           TN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV--------------
2iw3B           TN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV--------------
2iw3A           TN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV--------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------------
2awnD           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
3g60A           REIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQK
3g5uA           REIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQK
2hydA           RNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQK
1pf4A           RRHFALVSQNVHLFNDTIANNIAYAAEEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQR
2ghiA           RSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGER
2ff7A           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
1mt0A           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
2ffbA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
3b5jA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
2fgkA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
2ffaA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
1xefA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
2ghiC           RSIIGIVPQDTILFNETIKYNILYGKLDAT-EEVIKATKSAQLYDFIEALPKKWDTIV--GGMKL--GER
1mv5D           RSQIGFVSQDSAIMAGTIRENLTYGLEDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQR
1mv5A           RSQIGFVSQDSAIMAGTIRENLTYGLEDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQR
2ghiB           RSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNK-MKLSGGER
2ghiD           RSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIV------LSGGER
1jj7A           HRQVAAVGQEPQVFGRSLQENIAYGTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQR
3b60A           RNQVALVSQNVHLFNDTVANNIAYATEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXX
2ixfC           HTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQR
2ixfA           HTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQR
2ixeA           HTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQR
1z2rA           RNQVALVSQNVHLFNDTVANNIAYATEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXXX
2ixfD           HTQVAAVGQL--LFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQR
2ixgA           HTQVAAVGQEPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLAVGQR
2oukB           REEVGMVFQRFNLFHMTVLNNITLAPREKAEAKAMELLDKVGLKDKAHAYPDSL-----------SGGQA
2oljA           REEVGMVFQRFNLFHMTVLNNITLAPREKAEAKAMELLDKVGLKDKAHAYPDSL-----------SGGQA
2it1B           RN-VGLVFQNWALYHMTVYKNIAFPLELRKAPR-----EEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQ
2it1A           RN-VGLVFQNWALYHMTVYKNIAFPLELRKAPR-----EEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQ
2ixeD           YLHTQVAAVGPLLFGRSFRENIAYGTRTPTMEEITAVAMESGAHDFISGFPQGYDTEV-----QLSGGQR
3d31A           KHDIAFVYQNYSLFHMNVKKNLEFGMRMKKIKDPKRVLDTA--RDLK------IEHLLDRNPLTLSGGEQ
3gfoA           RESIGIVFQDPQLFSASVYQDVSFGAVNMKLPED-EIRKRVD-----NALKRGIEHLKDKPTHCLSFGQK
2pzgA           --RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
2pzeB           --RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
2pzeA           --RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
1l2tB           LTKIR-RDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLERFANHKPNQLSGGQQ
1l2tA           LTKIR-RDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLERFANHKPNQLSGGQQ
2pzfB           --RISFCSQFSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVLGEGGITLSGGQR
1r0zD           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1xf9D           --RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1xf9C           --RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1xf9B           --RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1xf9A           --RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r10A           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0zC           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0zB           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0zA           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0xD           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0xC           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0xB           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0xA           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0wC           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0wB           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1r0wA           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1q3hD           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1q3hC           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1q3hB           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1q3hA           --RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
1xfaA           --RVSFCSQFSWIMPGTIKENI-IRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQR
2pzgB           --RISFCSQFSWIMPGTIKENIIFGVS----------YDEYRYRSVIKALEEDISKFAEKLGITLSGGQR
2yz2B           RRNIGIAFQYPEVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLD---------FDSFKDRVPFFLSGGEK
2yz2A           RRNIGIAFQYPEVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLD---------FDSFKDRVPFFLSGGEK
2pzfA           --RISFCSQFSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVLGEGGITLSGGQR
1xmiE           --RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
1xmiC           --RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
1xmiA           --RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQR
3dhwC           RRQIGMIFQHFNLLSSTVFGNVALPLEDEVKRRVTELLSLVGLGDKHDSYPSNL-----------SGGQK
2cbzA           ---VAYVPQQAWIQNDSLRENILFGCQ---LEEPYSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQK
2pcjA           NRKLGFVFQFHYLIELTALENLKMGKKKEAKERGEYLLSELGLGDKLSRKPYEL-----------SGGEQ
2bboA           --RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQ
2bbtB           --RISFCSQNSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVL---GITLSGGQR
1b0uA           GQLVADKNQLRLLRTTMVFQHFNLWSHMTVLENVMEAIQVLGLSKRERALKYLAKVGIDERAVHLSGGQQ
2bbsB           --RISFCSQNSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVL--GGITLSGGQR
1xmjA           --RISFCSQFSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVLGEGGITLSEGQQ
1xmiB           --RISFCSQFSWIMPGTIKENIIAGVS----------YDEYRYRSVIKACQ--LEEDISKIVLTLSGGQR
1q12A           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
3fh6A           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
2awoA           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
2awnB           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
1f3oA           LTKIRR-DKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEERRKRALEELEERFANHKPNQLSGGQQ
2bbtA           --RISFCSQNSWIMPGTIKENIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVL--GGITLSGGQR
2r6gB           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
2r6gA           ERGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
2awoC           ERGVGMVALYPHL---SVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
1xmiD           --RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--ITLSGGQR
2bbsA           --RISFCSQNSWIMPGTIKENI-----------IGVSYDEYRYRSVIKALEEDISKFAEKDNITLSGGQR
1g6hA           LYHYGIVRQTPQLKEMTVLENLLIGKEEEMVEKAFKILEFLKLSH-----------LYDRKAGELSGGQM
1g9xA           LYHYGIVRQTPQLKEMTVLENLLIGKEEEMVEKAFKILEFLKLSH-----------LYDRKAGELSGGQM
1gajA           LYHYGIVRQTPQLKEMTVLENLLIGKEEEMVEKAFKILEFLKLSH-----------LYDRKAGELSGGQM
1z47B           RN-VGLVFQNYALFHMTVYDNVSFGLREKRVPKD-EMDARV--RELLRFM--RLESYANRFPHELSGGXX
1z47A           RN-VGLVFQNYALFHMTVYDNVSFGLREKRVPKD-EMDARV--RELLRFM--RLESYANRFPHELSGGXX
1oxvA           DRKIGMVFQTWALYNLTAFENIALTNMKMSKEEI-----RKRVEEVAKIL--DIHHVLNHFPRELSGGQQ
1oxsC           DRKIGMVFQTWALYNLTAFENIALTNMKMSKEEI-----RKRVEEVAKIL--DIHHVLNHFPRELSGGQQ
2awnC           ---VGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPKAL-----------SGGQR
2yyzA           RE-VGMVFQNYALYHMTVFENIAFPLRARRISK-----DEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQ
2onkA           RG-IGFVPQDYALFHLSVYRNIAYG-----LXXXXXXXXXXXXXXMAEKL--GIAHLLDRKPARLSGGER
1ji0A           NRGIALVPEGRRIFELTVYENLGAYNRK----------DKEGIKEWIFSLFPRLKERLKQLGGTLSGGEQ
2zu0C           GEGIFMAFQYPQFFLQTALNAVRSYRGQETLDR-FDFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEK
2d3wA           GEGIFMAFQYPQFFLQTALNAVRSYRGQETLDR-FDFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEK
1g291           ASYALYPHMTVY-DNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPREL-----------SGGQR
2nq2C           IGFVPQFFSSPFAY--SVLDIVLMGRKSHDYQVAMQALDYLNLTHLAKREFTSL-----------SGGQR
2d3wD           GEGIFMAFQYPQFFLQTALNAVRSYRGQETLDR-FDFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEK
2d62A           A-----VFQSYALYPHTVYDNLRKVPKQEIDKRVREVAE-LGLTELLNRKPREL-----------SGGQR
2d3wC           GEGIFMAFQYPQFFLQTALNAVRSYRGQETLDR-FDFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEK
2nq2D           IGFVPQFFSSPFAY--SVLDIVLMGRKSHDYQVAMQALDYLNLTHLAKREFTSL-----------SGGQR
2ihyA           RQHIGFV-------SHSLLEKFQEG------ERVIDVVISGAIDDEIRNEAHQLLKLVGSAKAQLSTGEK
2d2fA           RARKGLFLAFQYVPGVTIANFLRLAGREVGVAEFWKVKKALELLDWDESY---LSRYLNEG---FSGGEK
2d3wB           GEGIFMAFQYPQFFLQTALNAVRSYRGQETLDR-FDFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEK
1vplA           RKLISYLPEEAGAYNMQGIEYLRFGFYASSSSEIEEMVERA-------TEIAGLGEKIKDRVSTYSKGMV
2ihyB           RQHIGFV-------SHSLLEKFQEG--ERVIDVVISAFKSIGIDDEIRNEAHQLLKLVGSAKAQLSTGEK
2d2eA           RKGLFLAFQYPVVPGVTIANFLRLALQA-------KLGREVGVAEFWTKVKKALELLWDESYLSLNEGEK
1v43A           RN-ISMVFQHMTVYENIAFPLKKFPKDEIDKRVRW-AAELLQIEELLNRYPAQL-----------SGGXX
2pjzA           RNYIRYSTNLPYEIGVTV-------NDIVYLYEELKGLDRDLFLEMLKALKLG-EEILRRKLYKLSAGQS
3fvqB           ERRLGYLVQEGVLFHLTVYRNIALGNGKGRTAQERQMLELTGISELAGRYPHEL-----------SGGXX
3fvqA           ERRLGYLVQEGVLFHLTVYRNIALGNGKGRTAQERQMLELTGISELAGRYPHEL-----------SGGXX
3bk7A           AEYEGTVYELLSKIDSSKLNSNFYKTE------------------LLK--PLGIIDLYDRNVEDLSGGEL
1sgwA           PEEIIVISVEDYLKAVASLYGVKVNKNE-----IMDALESVEVLDLKKKLGE------------LSQGTI
1yqtA           ADYEGTVYELLSKIDASKLNSNFYKTE------------------LLK--PLGIIDLYDREVNELSGGEL
1oxxK           DRKIGMVFQTWALYNLTAFENIALTNMKMSKEEI-----RKRVEEVAKIL--DIHHVLNHFPRELSGXXX
2awnA           ERGVGMVFQS---YALEVINQ--------RVNQVAEVL--------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           -----------------------------------------------------------------SGGER
1f2uD           -----------------------------------------------------------------SGGER
1f2uB           -----------------------------------------------------------------SGGER
1f2tB           -----------------------------------------------------------------SGGER
1us8B           -------------------------------------------------------------GERIALGLA
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           --------------------------DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEA
2vf8A           --------------------------DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEA
2vf7C           --------------------------DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEA
2vf7B           --------------------------DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEA
2vf7A           --------------------------DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEA
2r6fB           ----------------------------------------------------GLGYKLGQPATTLSGGEA
2r6fA           ----------------------------------------------------GLGYKLGQPATTLSGGEA


                         *         .         .         .         .         +         .:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTI
3g60A           QRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVI
3g5uA           QRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVI
2hydA           QRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHI
1pf4A           QRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEI
2ghiA           QRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKI
2ff7A           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
1mt0A           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
2ffbA           QRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
3b5jA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
2fgkA           QRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
2ffaA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKI
1xefA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKI
2ghiC           QRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKI
1mv5D           QRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQI
1mv5A           QRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQI
2ghiB           QRIAIARCLLKDPKIVIFDEAT--SDSKTEYLFQKAVEDLRKNRTLIIIAH--RTISSAESIILLNKGKI
2ghiD           QRIAIARCLLKDPKIVIFD------DSKTEY----LFQKAVEDRTLIIIAHRLSTISSAESIILLNKGKI
1jj7A           QAVALARALIRKPCVLILDDATSALDANSQLQVEQLLSPERYSRSVLLITQHLSLVEQADHILFLEGGAI
3b60A           XXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIE-------------
2ixfC           QAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHILFLKEGSV
2ixfA           QAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHILFLKEGSV
2ixeA           QAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHILFLKEGSV
1z2rA           XXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIE-------------
2ixfD           QAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLSPEWASRTVLLITHQLSLAERAHHILFLKEGSV
2ixgA           QAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHILFLKEGSV
2oukB           QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEMTMVVVTHEMGAREVGDRVLFMDGGYI
2oljA           QRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEMTMVVVTHEMGAREVGDRVLFMDGGYI
2it1B           QRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELTTVYVTHDQAEALAMDRIAVIREGEI
2it1A           QRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELTTVYVTHDQAEALAMDRIAVIREGEI
2ixeD           QAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLSPEWASRTVLLITQQLSLAERAHHILFLKEGSV
3d31A           QRVALARALVTNPKILLLDEPLSALDPRTQEEMLSVLHKKNK-LTVLHITHDQTEARIMDRIAVVMDGKL
3gfoA           KRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRV
2pzgA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2pzeB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2pzeA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1l2tB           QRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKEEDGKTVVVVTHDINVARFGERIIYLKDGEV
1l2tA           QRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKEEDGKTVVVVTHDINVARFGERIIYLKDGEV
2pzfB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1r0zD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1xf9D           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1xf9C           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1xf9B           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1xf9A           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r10A           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0zC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0zB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0zA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0xD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0xC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0xB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0xA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0wC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0wB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1r0wA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1q3hD           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1q3hC           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1q3hB           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1q3hA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
1xfaA           ARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFSCVCKLMANKTRILVTSKMEHLRKADKILILHQGSS
2pzgB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2yz2B           RRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKKTLGKTVILISHDIETVNHVDRVVVLEKGKK
2yz2A           RRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKKTLGKTVILISHDIETVNHVDRVVVLEKGKK
2pzfA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1xmiE           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1xmiC           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1xmiA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
3dhwC           QRVAIARALASNPKVLLCDEATSALDPATTRSILELINRRL-GLTILLITHEMDVVKRIDCVAVISNGEL
2cbzA           QRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKI
2pcjA           QRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTIVMVTHERELAELTHRTLEMKDGKV
2bboA           AKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2bbtB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEKTMVVVTHEMGARHVSSHVIFLHQGKI
2bbsB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1xmjA           AKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1xmiB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1q12A           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
3fh6A           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2awoA           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2awnB           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
1f3oA           QRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDKTVVVVTHDINVARFGERIIYLKDGEV
2bbtA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2r6gB           QRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2r6gA           QRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2awoC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
1xmiD           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
2bbsA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFSCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
1g6hA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQI
1g9xA           KLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQI
1gajA           KLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNVLELKAKGITFLIIEHRLDIVNYIDHLYVMFNGQI
1z47B           XXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRE-LRTFVRQVHDETSVFVTHQEEALEVADRVLVLHEGNV
1z47A           XXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRE-LRTFVRQVHDETSVFVTHQEEALEVADRVLVLHEGNV
1oxvA           QRVALARALVKDPSLLLLDEPFSNLD--------------------------------------------
1oxsC           QRVALARALVKDPSLLLLDEPFSNLD--------------------------------------------
2awnC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2yyzA           QRVALARALVKQPKVLLFDEPLSNLDAMIMRAEIKHLQQEL-GITSVYVTHQAEAMTMASRIAVFNQGKL
2onkA           QRVALARALVIQPRLLLLDEPLSAVDLKTKMEELRFVQREF-DVPILHVTHDLEAAMLADEVAVMLNGRI
1ji0A           -QLAIGRALSRPK---LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQLGALKVAHYGYVLETGQI
2zu0C           KRNDILQMAVLEPELCILDESDSGLD-IDALKVVADGVNSLRDRSFIIVTHYQRILDYIDYVHVLYQGRI
2d3wA           KRNDILQMAVLEPELCILDESDSGLD-IDALKVVADGVNSLRDRSFIIVTHYQRILDYIDYVHVLYQGRI
1g291           QRVALGRAIVRKPQVFLMDEPLSNLDAVRMRAELKKLQRQL-GVTTIYVTH--DQVEAMDRIAVMNRGVL
2nq2C           QLILIARAIASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQPNQVVAI-----------
2d3wD           KRNDILQMAVLEPELCILDE-SDGLD-IDALKVVADGVNSLRDRSFIIVTHYQRILDYIDYVHVLYQGRI
2d62A           QRVALGRAIIR-RPKVFLDEPLSNLDARVKRAELKKLQRQL-GVTTIYVTH--DQVEATGDRIAVNKGEL
2d3wC           KRNDILQMAVLEPELCILDES----DDIDALKVVADGVNSLRDRSFIIVTHYQRILDYIDYVHVLYQGRI
2nq2D           QLILIARAIASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQPNQVVAI-----------
2ihyA           QRV-IAR-ALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXPTLAIYVTHFIEEITAFSKILLLKDGQS
2d2fA           KRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMRGPNFLVITHYQRILNYIDKVHVMMDGRV
2d3wB           KRNDILQMAVLEPELCILDEDSLDIDAL---KVVADGVNSLRDRSFIIVTHY------------------
1vplA           RKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQELTILVSSHNMLEVEFLDRIALIHNGTI
2ihyB           QRV-IAR-ALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXPTLAIYVTHFIEEITAFSKILLLKDGQS
2d2eA           KRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMRGPNFLVITHYQRILNYIDKVHVMMDGRV
1v43A           XXXXXXXXXXXEPDVLLMDEPLSNLDAVAMRAEIKKLQQKLK-VTTIYVTH--DQVEAMDRIAVMNRGQL
2pjzA           VLVRTSLALASQPEIVGLDEPFENVD-AARRHVISRYIKEY-GKEGILVTHEL-----------------
3fvqB           XXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRI
3fvqA           XXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRI
3bk7A           QRVAIAATLLRDADIYLLDEPSAYLD-VEQRLAVSRAIRHLNEKTALVVEHDVLMID------YVSDRLI
1sgwA           RRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIIS--------------------
1yqtA           QRVAIAATLLRDADIYLLDEPSAYLD--VEQRLAAIRHLEKNEKTALVVEHDVLIDYVSDRLVF------
1oxxK           XXXXXXXXXXKDPSLLLLDEPFSNLD--------------------------------------------
2awnA           ---AIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHKRL-GRTMIYVTHQVEAMTLADKIVVLDAGRV
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
1f2uD           FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
1f2uB           FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
1f2tB           FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
1us8B           FRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIENGSS
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2vf8B           QRIKLATELRRSGTVYVLDEPTTGLHPALQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIDGGRL
2vf8A           QRIKLATELRRSGTVYVLDEPTTGLHPALQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIDGGRL
2vf7C           QRIKLATELRRSGTVYVLDEPTTGLHPALQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIDGGRL
2vf7B           QRIKLATELRRSGTVYVLDEPTTGLHPALQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIDGGRL
2vf7A           QRIKLATELRRSGTVYVLDEPTTGLHPALQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIDGGRL
2r6fB           QRVKLAAELHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNDTVLVIEHNLDVIKTADYIIDLRGGQI
2r6fA           QRVKLAAELHRRSTLYILDEPTTGLHVDDIARLLDVLHRLVDNDTVLVIEHNLDVIKTADYIIDLRGGQI


                         .         .         .         *         .         .         .:630
query           EMQGSPDYLRKTNERYQKLKAIDEGx
3g60A           VEQGNHDELMREKGIYFKL-------
3g5uA           VEQGNHDELMREKGIYFKL-------
2hydA           VETGTHRELIAKQGAYEHLYSI----
1pf4A           IERG----------------------
2ghiA           VEKGTHKDLLKLNGEYAEMWNMQSG-
2ff7A           VEQG----------------------
1mt0A           VEQG----------------------
2ffbA           VEQG----------------------
3b5jA           VEQG----------------------
2fgkA           VEQG----------------------
2ffaA           VEQG----------------------
1xefA           VEQG----------------------
2ghiC           VEKGTHKDLLKLNGEYAEM-------
1mv5D           TGSGKHNELVATHPLYAK--------
1mv5A           TGSGKHNELVATHPLYAK--------
2ghiB           VEKGTHKDLLKLNGEYAEM-------
2ghiD           VEKGTHKDLLKLNGEYAEM-------
1jj7A           REGGTHQQLMEKKGCY----------
3b60A           --------------------------
2ixfC           CEQGTHLQLMERGGCYRSM-------
2ixfA           CEQGTHLQLMERGGCYRSM-------
2ixeA           CEQGTHLQLMERGGCYRSM-------
1z2rA           --------------------------
2ixfD           CEQGTHLQLMERGGCYRSM-------
2ixgA           CEQGTHLQLMERGGCYRSM-------
2oukB           IEEGKPEDLRPQHER-----------
2oljA           IEEGKPEDLRPQHER-----------
2it1B           LQVGTPD-------------------
2it1A           LQVGTPD-------------------
2ixeD           CEQGTHLQLMERGGCYRSM-------
3d31A           IQVGKPE-------------------
3gfoA           ILQGNPEVIRKVNLRLPRI-------
2pzgA           YFYGNPDFSSK---------------
2pzeB           YFYGT---------------------
2pzeA           YFYGT---------------------
1l2tB           ERE-----------------------
1l2tA           ERE-----------------------
2pzfB           YFYGT---------------------
1r0zD           YFYGT---------------------
1xf9D           YFYGT---------------------
1xf9C           YFYGT---------------------
1xf9B           YFYGT---------------------
1xf9A           YFYGT---------------------
1r10A           YFYGT---------------------
1r0zC           YFYGT---------------------
1r0zB           YFYGT---------------------
1r0zA           YFYGT---------------------
1r0xD           YFYGT---------------------
1r0xC           YFYGT---------------------
1r0xB           YFYGT---------------------
1r0xA           YFYGT---------------------
1r0wC           YFYGT---------------------
1r0wB           YFYGT---------------------
1r0wA           YFYGT---------------------
1q3hD           YFYGT---------------------
1q3hC           YFYGT---------------------
1q3hB           YFYGT---------------------
1q3hA           YFYGT---------------------
1xfaA           YFYGT---------------------
2pzgB           YFYGT---------------------
2yz2B           VFDGTMEFLEKYDPRF----------
2yz2A           VFDGTMEFLEKYDPRF----------
2pzfA           YFYGT---------------------
1xmiE           YFYGT---------------------
1xmiC           YFYGT---------------------
1xmiA           YFYGT---------------------
3dhwC           --------------------------
2cbzA           SEMGS----------YQELLARD---
2pcjA           --------------------------
2bboA           YFYGTFSELQNLQPDFSKLMSFDQ--
2bbtB           YFYGTPDFSSKLMDSFDQFSA-----
1b0uA           EEEGDPE-------------------
2bbsB           YFYGTFSELQNLRDSFDQFSA-----
1xmjA           YFYGTFSELQNLQPDFSKLMSFDQ--
1xmiB           YFYGT---------------------
1q12A           AQVGKP--------------------
3fh6A           AQVGKP--------------------
2awoA           AQVGKP--------------------
2awnB           AQVGKP--------------------
1f3oA           ERE-----------------------
2bbtA           YFYGT---------------------
2r6gB           AQVGKP--------------------
2r6gA           AQVGKP--------------------
2awoC           AQVGKP--------------------
1xmiD           YFYGT---------------------
2bbsA           YFYGTFSELQNLRPDFSKLMSFDQ--
1g6hA           IAEG----------------------
1g9xA           IAEG----------------------
1gajA           IAEG----------------------
1z47B           EQFGTPE-------------------
1z47A           EQFGTPE-------------------
1oxvA           --------------------------
1oxsC           --------------------------
2awnC           AQVGKP--------------------
2yyzA           VQYGTPD-------------------
2onkA           VEKG----------------------
1ji0A           VLEGKASEL-----------------
2zu0C           VKSGDFTLVKQLEEQ-----------
2d3wA           VKSGDFTLVKQLEEQ-----------
1g291           QQVGSPD-------------------
2nq2C           --------------------------
2d3wD           VKSGDFTLVKQLEEQ-----------
2d62A           QQVGTPD-------------------
2d3wC           VKSGDFTLVKQLEEQ-----------
2nq2D           --------------------------
2ihyA           IQQGAEDILTSENSRF----------
2d2fA           VATGGPE-------------------
2d3wB           --------------------------
1vplA           VETGTVEELK---ERY-KAQNIEE--
2ihyB           IQQGAEDILTSENSRF----------
2d2eA           VATGGPE-------------------
1v43A           LQIGSPTYLR----------------
2pjzA           --------------------------
3fvqB           LQTASPHELYRQPADLDAALFIGEG-
3fvqA           LQTASPHELYRQPADLDAALFIGEG-
3bk7A           VFEGEP--------------------
1sgwA           --------------------------
1yqtA           --------------------------
1oxxK           --------------------------
2awnA           AQVGKP--------------------
2ix3A           --------------------------
2iwhB           --------------------------
2ix8A           --------------------------
2iw3B           --------------------------
2iw3A           --------------------------
1ii8B           KVE-----------------------
1f2uD           KVE-----------------------
1f2uB           KVE-----------------------
1f2tB           KVE-----------------------
1us8B           KVE-----------------------
2awoD           --------------------------
2awnD           --------------------------
2vf8B           VAQGTP--------------------
2vf8A           VAQGTP--------------------
2vf7C           VAQGTP--------------------
2vf7B           VAQGTP--------------------
2vf7A           VAQGTP--------------------
2r6fB           VAVGTPEEVAEVKESH----------
2r6fA           VAVGTPEEVAEVKESH----------