[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABD99944.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mxiA.bssp"
#ERROR : Can't open dsspfile "3e5yA.bssp"
#ERROR : Can't open dsspfile "3e5yB.bssp"
#ERROR : Can't open dsspfile "2ha8B.bssp"
#ERROR : Can't open dsspfile "2ha8A.bssp"
#ERROR : Can't open dsspfile "1v2xA.bssp"

## Summary of PDB Search
:170
    2e-29  45%  1mxiA  [c.116.1] HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE HI0766
    5e-29  45%  3e5yA  [x.x.x] TRMH FAMILY RNA METHYLTRANSFERASE
    1e-22  46%  3e5yB  [x.x.x] TRMH FAMILY RNA METHYLTRANSFERASE
    5e-08  27%  2ha8B  [x.x.x] TAR (HIV-1) RNA LOOP BINDING PROTEIN
    5e-08  27%  2ha8A  [x.x.x] TAR (HIV-1) RNA LOOP BINDING PROTEIN
    6e-07  32%  1v2xA  [c.116.1] TRNA (GM18) METHYLTRANSFERASE
:170

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
1mxiA           ----IVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLES
3e5yA           ---NVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAA
3e5yB           ---NVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDQMRVHRD----WDAFVAAEAPD-PARMFA
2ha8B           ------------PTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSSAEQWLPLVEVKPPQLIDYLQQ
2ha8A           ------------PTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSSAEQWLPLVEVKPPQLIDYLQQ
1v2xA           ------------PHNLSAILRTCDAVGVEAHAVNPTG-GVPTFNETSGGSHKW--VYLRVHPDLHEAFRF


                         .         .         *         .         .         .         .:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
1mxiA           -EKPKRLFALTTKGCPAHSQVKF---KLGDYLMFGPETRGIPMSILNEMPEQKIRIPMT-ANSRSMNLSN
3e5yA           APDPARMFAFTTRGSGRFHDRAF---EPGDWFVFGAETRGLPALVDRFAPEQRVRLPMRPGN-RSLNLSN
3e5yB           FTTRGS----GRFHDRAFEPGD--------WFVFGAETRGLPALVDRFAPEQRVRLPMRPGN-RSLNLSN
2ha8B           KKTEGYTIIGVEQTAKSLDLTQYCFPEKS-LLLLGNEREGIPANLIQQL-DVCVEIPQQGI-IRSLNVHV
2ha8A           KKTEGYTIIGVEQTAKSLDLTQYCFPEKS-LLLLGNEREGIPANLIQQL-DVCVEIPQQGI-IRSLNVHV
1v2xA           LKERGFTVYATALREDAFREVDYT---KPTAVLFGAEKWGVSEEALAL-ADGAIKIPMLGM-VQSLNVSV


                         +         .         .         .         .         *         .:210
query           TAAIVVYEALRQQGFxxxxxxxxxxxxxxx
1mxiA           SVAVTVYEAWRQLGY---------------
3e5yA           TVAVVVFEAWRQAGF---------------
3e5yB           TVAVVVFEAWRQAGF---------------
2ha8B           SGALLIWEYTRQQ-----------------
2ha8A           SGALLIWEYTRQQ-----------------
1v2xA           AAAVILFEAQRQR-----------------