[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rpmG.2

[Show Plain Result]

#ERROR : Can't open dsspfile "3huz6.bssp"
#ERROR : Can't open dsspfile "2hgu5.bssp"
#ERROR : Can't open dsspfile "3hux6.bssp"
#ERROR : Can't open dsspfile "2j016.bssp"
#ERROR : Can't open dsspfile "3bbo3.bssp"

## Summary of PDB Search
:50
    9e-10  49%  3huz6  [x.x.x] 50S RIBOSOMAL PROTEIN L33
    9e-10  49%  2hgu5  [x.x.x] 50S RIBOSOMAL PROTEIN L33
    3e-09  49%  3hux6  [x.x.x] 50S RIBOSOMAL PROTEIN L33
    1e-08  50%  2j016  [x.x.x] 50S RIBOSOMAL PROTEIN L33
    1e-06  56%  3bbo3  [x.x.x] RIBOSOMAL PROTEIN L33
:50

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
3huz6           -----KLLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHREVK
2hgu5           -----KLLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHREVK
3hux6           -----KLLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHRE--
2j016           --------LECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHRE--
3bbo3           -----KVILECTGCGSRGYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK