[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:proC

[Show Plain Result]

#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2amfD.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "2ahrE.bssp"
#ERROR : Can't open dsspfile "2ahrD.bssp"
#ERROR : Can't open dsspfile "2ahrC.bssp"
#ERROR : Can't open dsspfile "2ahrA.bssp"
#ERROR : Can't open dsspfile "2izzE.bssp"
#ERROR : Can't open dsspfile "2izzD.bssp"
#ERROR : Can't open dsspfile "2izzC.bssp"
#ERROR : Can't open dsspfile "2izzB.bssp"
#ERROR : Can't open dsspfile "2izzA.bssp"
#ERROR : Can't open dsspfile "2gr9A.bssp"
#ERROR : Can't open dsspfile "2gerA.bssp"
#ERROR : Can't open dsspfile "2gerB.bssp"
#ERROR : Can't open dsspfile "2gr9B.bssp"
#ERROR : Can't open dsspfile "2rcyC.bssp"
#ERROR : Can't open dsspfile "2rcyA.bssp"
#ERROR : Can't open dsspfile "2rcyB.bssp"
#ERROR : Can't open dsspfile "2rcyD.bssp"
#ERROR : Can't open dsspfile "2rcyE.bssp"
#ERROR : Can't open dsspfile "3gt0A.bssp"
#ERROR : Can't open dsspfile "1yqgA.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "1i36A.bssp"
#ERROR : Can't open dsspfile "1hyhC.bssp"
#ERROR : Can't open dsspfile "1hyhB.bssp"
#ERROR : Can't open dsspfile "1hyhA.bssp"
#ERROR : Can't open dsspfile "2gf2D.bssp"
#ERROR : Can't open dsspfile "2gf2B.bssp"
#ERROR : Can't open dsspfile "2gf2A.bssp"

## Summary of PDB Search
:264
    1e-45  40%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-45  40%  2amfD  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-45  40%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-45  40%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    6e-38  41%  2ahrE  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    6e-38  41%  2ahrD  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    6e-38  41%  2ahrC  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    6e-38  41%  2ahrA  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    7e-36  33%  2izzE  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2izzD  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2izzC  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2izzB  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2izzA  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2gr9A  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    7e-36  33%  2gerA  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    1e-34  33%  2gerB  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    2e-34  33%  2gr9B  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
    1e-27  35%  2rcyC  [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
    1e-27  35%  2rcyA  [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
    1e-24  34%  2rcyB  [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
    4e-24  35%  2rcyD  [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
    8e-24  34%  2rcyE  [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
    1e-12  32%  3gt0A  [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE
    4e-10  24%  1yqgA  [c.2.1 - a.100.1 (1xc2A)] PYRROLINE-5-CARBOXYLATE REDUCTASE
    9e-05  39%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    0.001  30%  1i36A  [c.2.1 - a.100.1] CONSERVED HYPOTHETICAL PROTEIN MTH1747
    0.001  47%  1hyhC  [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
    0.001  47%  1hyhB  [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
    0.001  47%  1hyhA  [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
    0.001  30%  2gf2D  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    0.001  30%  2gf2B  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    0.001  30%  2gf2A  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
2amfE           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
2amfD           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
2amfC           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
2amfA           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
2ahrE           -KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQVDLVILGIKP
2ahrD           -KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQVDLVILGIKP
2ahrC           -KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQVDLVILGIKP
2ahrA           -KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQVDLVILGIKP
2izzE           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2izzD           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2izzC           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2izzB           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2izzA           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2gr9A           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2gerA           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
2gerB           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKT-PHNKETVQHSDVLFLAVKP
2gr9B           MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVLT-PHNKETVQHSDVLFLAVKP
2rcyC           IKLGF-GLGQ-GSALAHGIANANIIKKNLFYYGPSKKNTTLYS---------SNEELARHCDIIVCAVKP
2rcyA           IKLGF-GLGQ-GSALAHGIANANIIKKNLFYYGPSKKNTTLYS---------SNEELARHCDIIVCAVKP
2rcyB           ----------------------------------------------------SSNEELARHCIIVCAVKP
2rcyD           IKLGF-GLGQ-GSALAHGIANANII---LFYYGPSKKTTLNYS---------SNEELI-----IVCAVKP
2rcyE           -------------------LAHGIANANLFYYGPSKKNTTLYS---------SNEEA---RHIIVCAVKP
3gt0A           -----------------------VSSNQIICSDLNTANLKNASEKYGLTTTTDNNEVAKNADILILSIKP
1yqgA           ----------------------------IYIANRGAEKRERLEKELGVETSATLPE-LHSDDVLILAVKP
3dojA           MEVGFLGLGIMGKAMSMNLLKNGFKV-TVWNRTLSKCDELV---EHGASVCESPAEVIKK----------
1i36A           LRVGFIGFGEVAQTLASRLRSRGVEV----VTSLEGRSPSTIERARTVGVTETSEEDVYSCPVVISAVTP
1hyhC           -KIGIIGLGNVGAAVAHGLIAQGVADDYVFI---------------------------------------
1hyhB           -KIGIIGLGNVGAAVAHGLIAQGVADDYVFI---------------------------------------
1hyhA           -KIGIIGLGNVGAAVAHGLIAQGVADDYVFI---------------------------------------
2gf2D           MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEKADRIITMLPT
2gf2B           MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEKADRIITMLPT
2gf2A           MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEKADRIITMLPT


                         .         .         *         .         .         .         .:140
query           IVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
2amfE           QLFETVLKPLKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2amfD           QLFETVLKPLKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2amfC           QLFETVLKPLKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2amfA           QLFETVLKPLKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2ahrE           QLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN-NAQILQSSTALTGNALVSQ
2ahrD           QLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN-NAQILQSSTALTGNALVSQ
2ahrC           QLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN-NAQILQSSTALTGNALVSQ
2ahrA           QLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN-NAQILQSSTALTGNALVSQ
2izzE           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2izzD           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2izzC           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2izzB           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2izzA           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2gr9A           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2gerA           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2gerB           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2gr9B           HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
2rcyC           DIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WVPNTPCLVGEGSFIYCSNKNVNS
2rcyA           DIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WVPNTPCLVGEGSFIYCSNKNVNS
2rcyB           DIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WVPNTPCLVGEGSFIYCSNKNVNS
2rcyD           DIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WVPNTPCLVGEGSFIYCSNKNVNS
2rcyE           DIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GS-----IVWVPNTPCLVGEGSFIYCSNKNVNS
3gt0A           DLYASXXXXXXXXXXXX-----VTIAAGKSIESTENAFNKKVKVVR-VPNTPALVGEG-SALCPNE-VTE
1yqgA           -QDEAACKNIR----TNGALVLSVAAGLSVGTLSRYLGGTR-RIVR-VPNTPGKIGLGVSG-YAEAEVSE
3dojA           ----------------------------------------------------------------------
1i36A           ----------------------------------------------------------------------
1hyhC           ----------------------------------------------------------------------
1hyhB           ----------------------------------------------------------------------
1hyhA           ----------------------------------------------------------------------
2gf2D           SIANGILKKVKKGSLLID----------------------------------------------------
2gf2B           SIANGILKKVKKGSLLID----------------------------------------------------
2gf2A           SIANGILKKVKKGSLLID----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
2amfE           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2amfD           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2amfC           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2amfA           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrE           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrD           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrC           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrA           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2izzE           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2izzD           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2izzC           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2izzB           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2izzA           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2gr9A           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2gerA           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2gerB           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2gr9B           EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
2rcyC           TDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS
2rcyA           TDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS
2rcyB           TDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS
2rcyD           TDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS
2rcyE           TDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS
3gt0A           KDLEDVLNIFNSFGQTEIVSEK-LDVVTSVSGSSPAYVY--IIEAADAAVLDGPRNQ-AYKFAAQAVLGS
1yqgA           TDRRIADRI-KSVGLTVWLDDEEKHGITGISGSGPAYVFYLLDALQNAAIRQGFDAE-ARALSLATFKGA
3dojA           ----------------------------------------------------------------------
1i36A           ----------------------------------------------------------------------
1hyhC           ----------------------------------------------------------------------
1hyhB           ----------------------------------------------------------------------
1hyhA           ----------------------------------------------------------------------
2gf2D           ----------------------------------------------------------------------
2gf2B           ----------------------------------------------------------------------
2gf2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKx
2amfE           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTIDKAK-
2amfD           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTIDKAK-
2amfC           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTIDKAK-
2amfA           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTIDKAK-
2ahrE           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTIDKAK-
2ahrD           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTIDKAK-
2ahrC           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTIDKAK-
2ahrA           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTIDKAK-
2izzE           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2izzD           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2izzC           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2izzB           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2izzA           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2gr9A           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2gerA           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2gerB           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2gr9B           AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
2rcyC           -VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAACEKSK-
2rcyA           -VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAACEKSK-
2rcyB           -VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAACEKSK-
2rcyD           -VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAACEKSK-
2rcyE           -VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAACEKSK-
3gt0A           A-KVLET-----------------------------------------------
1yqgA           VALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQ-
3dojA           ------------------------------------------------------
1i36A           ------------------------------------------------------
1hyhC           ------------------------------------------------------
1hyhB           ------------------------------------------------------
1hyhA           ------------------------------------------------------
2gf2D           ------------------------------------------------------
2gf2B           ------------------------------------------------------
2gf2A           ------------------------------------------------------