[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:glgP

[Show Plain Result]

#ERROR : Can't open dsspfile "2qn8A.bssp"
#ERROR : Can't open dsspfile "1p2dA.bssp"
#ERROR : Can't open dsspfile "1p29A.bssp"
#ERROR : Can't open dsspfile "1k08A.bssp"
#ERROR : Can't open dsspfile "1xc7A.bssp"
#ERROR : Can't open dsspfile "1p4gA.bssp"
#ERROR : Can't open dsspfile "1lwnA.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "1ktiA.bssp"
#ERROR : Can't open dsspfile "2fetA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "1z62A.bssp"
#ERROR : Can't open dsspfile "2qn9A.bssp"
#ERROR : Can't open dsspfile "1k06A.bssp"
#ERROR : Can't open dsspfile "1uzuA.bssp"
#ERROR : Can't open dsspfile "1ww3A.bssp"
#ERROR : Can't open dsspfile "1p2bA.bssp"
#ERROR : Can't open dsspfile "2iegB.bssp"
#ERROR : Can't open dsspfile "2gm9A.bssp"
#ERROR : Can't open dsspfile "1gfzA.bssp"
#ERROR : Can't open dsspfile "1ww2A.bssp"
#ERROR : Can't open dsspfile "1wutA.bssp"
#ERROR : Can't open dsspfile "2gpaA.bssp"
#ERROR : Can't open dsspfile "2gj4A.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "2qrpA.bssp"
#ERROR : Can't open dsspfile "1h5uA.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "2qn1A.bssp"
#ERROR : Can't open dsspfile "2iegA.bssp"
#ERROR : Can't open dsspfile "2pydA.bssp"
#ERROR : Can't open dsspfile "1skc-.bssp"
#ERROR : Can't open dsspfile "1gpyA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "2qrgA.bssp"
#ERROR : Can't open dsspfile "2qnbA.bssp"
#ERROR : Can't open dsspfile "2pyiA.bssp"
#ERROR : Can't open dsspfile "1nojA.bssp"
#ERROR : Can't open dsspfile "8gpbA.bssp"
#ERROR : Can't open dsspfile "6gpbA.bssp"
#ERROR : Can't open dsspfile "3gpbA.bssp"
#ERROR : Can't open dsspfile "2gpbA.bssp"
#ERROR : Can't open dsspfile "1gpbA.bssp"
#ERROR : Can't open dsspfile "1gpaB.bssp"
#ERROR : Can't open dsspfile "1gpaA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "2ieiA.bssp"
#ERROR : Can't open dsspfile "2gpnA.bssp"
#ERROR : Can't open dsspfile "2qn3A.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "1noiA.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "1z8dA.bssp"
#ERROR : Can't open dsspfile "1l5sB.bssp"
#ERROR : Can't open dsspfile "1l5sA.bssp"
#ERROR : Can't open dsspfile "2g9uA.bssp"
#ERROR : Can't open dsspfile "1l7xB.bssp"
#ERROR : Can't open dsspfile "2g9vA.bssp"
#ERROR : Can't open dsspfile "2g9qA.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "1l5rA.bssp"
#ERROR : Can't open dsspfile "1l5qB.bssp"
#ERROR : Can't open dsspfile "1l5qA.bssp"
#ERROR : Can't open dsspfile "1fc0B.bssp"
#ERROR : Can't open dsspfile "2zb2B.bssp"
#ERROR : Can't open dsspfile "2zb2A.bssp"
#ERROR : Can't open dsspfile "1em6A.bssp"
#ERROR : Can't open dsspfile "1l7xA.bssp"
#ERROR : Can't open dsspfile "1exvA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "1fc0A.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "2ieiB.bssp"
#ERROR : Can't open dsspfile "1xoiA.bssp"
#ERROR : Can't open dsspfile "1fa9A.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "1pygB.bssp"
#ERROR : Can't open dsspfile "1pygA.bssp"
#ERROR : Can't open dsspfile "2qllA.bssp"
#ERROR : Can't open dsspfile "1ygpA.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "1l5wA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"

## Summary of PDB Search
:807
    e-178  41%  2qn8A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-178  41%  1p2dA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-178  41%  1p29A  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-178  41%  1k08A  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-178  41%  1xc7A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-178  41%  1p4gA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-178  42%  1lwnA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-178  42%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    e-178  42%  1ktiA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  2fetA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  42%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-177  41%  1z62A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  2qn9A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1k06A  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-177  41%  1uzuA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1ww3A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1p2bA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  42%  2iegB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  42%  2gm9A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1gfzA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-177  41%  1ww2A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1wutA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  42%  2gpaA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-177  42%  2gj4A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  42%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-177  42%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    e-177  41%  2qrpA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-177  41%  1h5uA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-177  41%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  2qn1A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  2iegA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  2pydA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  1skc-  [x.x.x] PYRIDOXAL PHOSPHORYLASE B
    e-176  41%  1gpyA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-176  41%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-176  41%  2qrgA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  2qnbA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  42%  2pyiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-176  41%  1nojA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-176  41%  8gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  6gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  3gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  2gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  1gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-176  41%  1gpaB  [c.87.1] GLYCOGEN PHOSPHORYLASE A
    e-176  41%  1gpaA  [c.87.1] GLYCOGEN PHOSPHORYLASE A
    e-176  41%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-176  41%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-175  42%  2ieiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-175  42%  2gpnA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-175  41%  2qn3A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-175  41%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  42%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  42%  1noiA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-174  42%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  41%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  42%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    e-174  41%  1z8dA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  41%  1l5sB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-174  41%  1l5sA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-174  42%  2g9uA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  41%  1l7xB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-174  41%  2g9vA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  42%  2g9qA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-174  42%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  1l5rA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  1l5qB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  1l5qA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  1fc0B  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  2zb2B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  41%  2zb2A  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  42%  1em6A  [c.87.1] LIVER GLYCOGEN PHOSPHORYLASE
    e-173  41%  1l7xA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  42%  1exvA  [c.87.1] LIVER GLYCOGEN PHOSPHORYLASE
    e-173  41%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-173  42%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  41%  1fc0A  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  41%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  42%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  42%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  41%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  41%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  41%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  41%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  41%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  42%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  41%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-172  42%  2ieiB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-172  42%  1xoiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-171  41%  1fa9A  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-171  41%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-171  41%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-171  41%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-171  41%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-171  41%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-170  42%  1pygB  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    e-170  42%  1pygA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    e-168  42%  2qllA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-159  41%  1ygpA  [c.87.1] YEAST GLYCOGEN PHOSPHORYLASE
    e-158  41%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-158  41%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-158  41%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-155  41%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    e-154  41%  1l5wA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    e-152  41%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    e-152  41%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
:807

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
2qn8A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1p2dA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1p29A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1k08A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1xc7A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1p4gA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1lwnA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1b4dA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1ktiA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2fetA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1c8lA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1z62A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qn9A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1k06A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1uzuA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1ww3A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1p2bA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2iegB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2gm9A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1gfzA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1ww2A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1wutA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2gpaA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2gj4A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1e1yA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1bx3A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qrpA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1h5uA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3cuvA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qn1A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2iegA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2pydA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1skc-           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1gpyA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1axrA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2amvA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qrgA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qnbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2pyiA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1nojA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
8gpbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
6gpbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3gpbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2gpbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1gpbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1gpaB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1gpaA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1c8kA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1a8iA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2ieiA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2gpnA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qn3A           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3oB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1noiA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3oA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1abbA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1z8dA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1l5sB           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1l5sA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2g9uA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1l7xB           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2g9vA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2g9qA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3cejA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1l5rA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1l5qB           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1l5qA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1fc0B           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2zb2B           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2zb2A           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1em6A           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1l7xA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1exvA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3cehA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2atiA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1fc0A           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3ddwB           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3e3nE           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nC           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lD           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3ddsB           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3ddsA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3e3oD           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3oC           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3dd1B           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2ieiB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYKDP--KRIYYLSLEF
1xoiA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1fa9A           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3e3lC           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nH           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nF           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nD           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1pygB           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1pygA           -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2qllA           -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1ygpA           --------------------------------YEAASMSIRDNLVIDWNKTQQKFTTRDPKRVYYLSLEF
2c4mC           --------------------------ATDRKFWTGLSRAVQERIADDWERTREAY--GAARQQHYFSAEF
2c4mB           --------------------------ATDRKFWTGLSRAVQERIADDWERTREAY--GAARQQHYFSAEF
2c4mA           --------------------------ATDRKFWTGLSRAVQERIADDWERTREAY--GAARQQHYFSAEF
1e4oA           -----------------------------------------------------------QRHVNYISMEF
1l5wA           -----------------------------------------------------------QRHVNYISMEF
2ecpA           -----------------------------------------------------------QRHVNYISMEF
1ahpA           -----------------------------------------------------------QRHVNYISMEF


                         .         .         *         .         .         .         .:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
2qn8A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1p2dA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1p29A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1k08A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1xc7A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1p4gA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1lwnA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1b4dA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1ktiA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2fetA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1c8lA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1z62A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qn9A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1k06A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1uzuA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1ww3A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1p2bA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2iegB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2gm9A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1gfzA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1ww2A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1wutA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2gpaA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2gj4A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1e1yA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1bx3A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qrpA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1h5uA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3cuvA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qn1A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2iegA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2pydA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1skc-           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1gpyA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1axrA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2amvA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qrgA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qnbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2pyiA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1nojA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
8gpbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
6gpbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3gpbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2gpbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1gpbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1gpaB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1gpaA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1c8kA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1a8iA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2ieiA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2gpnA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qn3A           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3oB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3lA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1noiA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3oA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3lB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1abbA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1z8dA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l5sB           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l5sA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2g9uA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l7xB           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2g9vA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2g9qA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3cejA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l5rA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l5qB           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l5qA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1fc0B           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2zb2B           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2zb2A           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1em6A           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1l7xA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1exvA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3cehA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2atiA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1fc0A           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3ddwB           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nE           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nC           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3lD           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3ddsB           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3ddsA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3oD           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3oC           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3dd1B           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2ieiB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1xoiA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1fa9A           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3lC           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nH           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nF           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nD           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
3e3nA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1pygB           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1pygA           YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
2qllA           YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
1ygpA           LMGRALDNALINMKIREMIKGALDELGFKLEDVLDQEPDXXXXXXXXXXXXXCFVDSMATEGIPAWGYGL
2c4mC           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDXXXXXXXXXXXXXCFLDSAVTQDYPVTGYGL
2c4mB           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDXXXXXXXXXXXXXCFLDSAVTQDYPVTGYGL
2c4mA           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDXXXXXXXXXXXXXCFLDSAVTQDYPVTGYGL
1e4oA           XXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXXXXXCFLDSMATVGQSATGYGL
1l5wA           XXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXXXXXCFLDSMATVGQSATGYGL
2ecpA           XXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXXXXXCFLDSMATVGQSATGYGL
1ahpA           XXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXXXXXCFLDSMATVGQSATGYGL


                         +         .         .         .         .         *         .:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
2qn8A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1p2dA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1p29A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1k08A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1xc7A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1p4gA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1lwnA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1b4dA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1ktiA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2fetA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1c8lA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1z62A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qn9A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1k06A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1uzuA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1ww3A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1p2bA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2iegB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRV------EHTGAKWVDTQVVLAMP
2gm9A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1gfzA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1ww2A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1wutA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2gpaA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2gj4A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1e1yA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1bx3A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qrpA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1h5uA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3cuvA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qn1A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2iegA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTQGAKWV-----DTQVVLAMP
2pydA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1skc-           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1gpyA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1axrA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2amvA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qrgA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qnbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2pyiA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1nojA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
8gpbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
6gpbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3gpbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2gpbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1gpbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1gpaB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1gpaA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1c8kA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1a8iA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2ieiA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSGAKWV-----DTQVVLAMP
2gpnA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qn3A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3oB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3lA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1noiA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3oA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3lB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1abbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1z8dA           RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQG----AKWVDTQVVLAMP
1l5sB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1l5sA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2g9uA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1l7xB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2g9vA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2g9qA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3cejA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1l5rA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1l5qB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1l5qA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1fc0B           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2zb2B           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2zb2A           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1em6A           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1l7xA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1exvA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3cehA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2atiA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1fc0A           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3ddwB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3e3nE           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3lD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3ddsB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3ddsA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3e3oD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3oC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3dd1B           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
2ieiB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1xoiA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1fa9A           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
3e3lC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nH           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nF           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1pygB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1pygA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2qllA           RY----FNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
1ygpA           RYEYGIFAQKIIDGYQVETPDYWLNSGNPWEIERNEVQIPVTFYG---YVDRPTTLSASWIGGERVLAVA
2c4mC           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCF------------------DDMKTRAIP
2c4mB           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCF------------------DDMKTRAIP
2c4mA           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCF------------------DDMKTRAIP
1e4oA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGKVTKDGR-------WEPEFTITGQA
1l5wA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGKVTKDGR-------WEPEFTITGQA
2ecpA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGAVTKDGR-------WEPEFTITGQA
1ahpA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGAVTKDGR-------WEPEFTITGQA


                         .         .         .         +         .         .         .:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
2qn8A           YDTPVPGYRNNVVNTMRLWSAKAPNDVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1p2dA           YDTPVPGYRNNVVNTMRLWSAKAPNDLGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1p29A           YDTPVPGYRNNVVNTMRLWSAKAPNDLGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1k08A           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1xc7A           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1p4gA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1lwnA           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1b4dA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1ktiA           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2fetA           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1c8lA           YDTPVPGYRNNVVNTMRLWSAKAPNG--GYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1z62A           YDTPVPGYRNNVVNTMRLWSAKAPN-DGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qn9A           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1k06A           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1uzuA           YDTPVPGYRNNVVNTMRLWSAKAPN-DFGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1ww3A           YDTPVPGYRNNVVNTMRLWSAKAPN-DFGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1p2bA           YDTPVPGYRNNVVNTMRLWSAKAPN-DLGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2iegB           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2gm9A           YDTPVPGYRNNVVNTMRLWSAKAPNG--GYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1gfzA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1ww2A           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1wutA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2gpaA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2gj4A           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1e1yA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1bx3A           YDTPVPGYRNNVVNTMRLWSAKAPGYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qrpA           YDTPVPGYRNNVVNTMRLWSAKAPNDNVGGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1h5uA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3cuvA           YDTPVPGYRNNVVNTMRLWSAKAPNDNVGGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qn1A           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2iegA           YDTPVPGYRNNVVNTMRLWSAKAPNG--GYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2pydA           YDTPVPGYRNNVVNTMRLWSAKAPN--DGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1skc-           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1gpyA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1axrA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2amvA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qrgA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qnbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2pyiA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1nojA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
8gpbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
6gpbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3gpbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2gpbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1gpbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1gpaB           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1gpaA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1c8kA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1a8iA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2ieiA           YDTPVPGYRNNVVNTMRLWSAKAPYIQ-----AVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2gpnA           YDTPVPGYRNNVVNTMRLWSAKAPGYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2qn3A           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLNVQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3oB           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYQAVLDRNLAENISRVLYPE-----GKELRLKQEYFVVAA
3e3lA           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYQAVLDRNLAENISRVLYPE-----GKELRLKQEYFVVAA
1noiA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPE-----GKELRLKQEYFVVAA
3e3oA           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYQAVLDRNLAENISRVLYPE-----GKELRLKQEYFVVAA
3e3lB           YDTPVPGYRNNVVNTMRLWSAKAPNDFGGYIQAVLDRNLAENISRVLYP------GKELRLKQEYFVVAA
1abbA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPE-----GKELRLKQEYFVVAA
1z8dA           YDTPVPGYRNNVVNTMRLWSAKAPGYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l5sB           YDTPVPGYMNNTVNTMRLWSARAPNDDYIQ--AVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l5sA           YDTPVPGYMNNTVNTMRLWSARAPNDDYIQ--AVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2g9uA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPN-----GKELRLKQEYFVVAA
1l7xB           YDTPVPGYMNNTVNTMRLWSARAPNDGDY-IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2g9vA           YDTPVPGYRNNVVNTMRLWSAKAPNDFNLGYQAVLDRNLAENISRVLYPNFFE--GKELRLKQEYFVVAA
2g9qA           YDTPVPGYRNNVVNTMRLWSAKAPN-DFGYIQAVLDRNLAENISRVLYPFEGKE----LRLKQEYFVVAA
3cejA           YDTPVPGYMNNTVNTMRLWSARAPDYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l5rA           YDTPVPGYMNNTVNTMRLWSARAPNDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l5qB           YDTPVPGYMNNTVNTMRLWSARAPNDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l5qA           YDTPVPGYMNNTVNTMRLWSARAPNDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1fc0B           YDTPVPGYMNNTVNTMRLWSARAPGDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2zb2B           YDTPVPGYMNNTVNTMRLWSARAPNGDYIQ--AVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2zb2A           YDTPVPGYMNNTVNTMRLWSARAPNDFGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1em6A           YDTPVPGYMNNTVNTMRLWSARAPGDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1l7xA           YDTPVPGYMNNTVNTMRLWSARAPNDGDY-IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1exvA           YDTPVPGYMNNTVNTMRLWSARAPGDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3cehA           YDTPVPGYMNNTVNTMRLWSARAPNDFDY-IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2atiA           YDTPVPGYMNNTVNTMRLWSARAPDYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1fc0A           YDTPVPGYMNNTVNTMRLWSARAPGDY---IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3ddwB           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3nE           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nC           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3lD           YDTPVPGYRNNVVNTMRLWSAKAPN--DFYIQAVLDRNLAENISRVLY------EGKELRLKQEYFVVAA
3ddsB           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3ddsA           YDTPVPGYMNNTVNTMRLWSARAPNDGDY-IQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3oD           YDTPVPGYRNNVVNTMRLWSAKAPN--DFYIQAVLDRNLAENISRVLY------EGKELRLKQEYFVVAA
3e3oC           YDTPVPGYRNNVVNTMRLWSAKAPNDFNGYIQAVLDRNLAENISRVLYKE--------LRLKQEYFVVAA
3e3nB           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLYP------GKELRLKQEYFVVAA
3dd1B           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2ieiB           YDTPVPGYRNNVVNTMRLWSAKAPGYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1xoiA           YDTPVPGYMNNTVNTMRLWSARAPYIQ-----AVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1fa9A           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3lC           YDTPVPGYRNNVVNTMRLWSAKAPNDFNGYIQAVLDRNLAENISRVLYKE--------LRLKQEYFVVAA
3e3nH           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nF           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nD           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nA           YDTPVPGYRNNVVNTMRLWSAKAPNGY---IQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
1pygB           YDTPVPGYRNNVVNTMRLWSAKAPQA-------VLDRNLAENI--------SKE----LRLKQEYFVVAA
1pygA           YDTPVPGYRNNVVNTMRLWSAKAPQA-------VLDRNLAENI--------SKE----LRLKQEYFVVAA
2qllA           YDTPVPGYMNNTVNTMRLWSARAPN--------VLDRNLAENISRVLYPFEGKE----LRLKQEYFVVAA
1ygpA           YDFPVPGFKTSNVNNLRLWQAR-PTTENGDYKSVAQQQRAESITAVLYPNDNFAQGKELRLKQQYFWCAA
2c4mC           YDMPITGYGTHNVGTLRLWKAE--PWEEFDYDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
2c4mB           YDMPITGYGTHNVGTLRLWKAE--PWEEFDYDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
2c4mA           YDMPITGYGTHNVGTLRLWKAE--PWEEFDYDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
1e4oA           WDLPVVGYRNGVAQPLRLWQADLTKFNDGDFLRAEQQGNAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
1l5wA           WDLPVVGYRNGVAQPLRLWQADLTKFNDGDFLRAEQQGNAEKLTKVLYPNDNAFEGKKLRLMQQYFQCAC
2ecpA           WDLPVVGYRNGVAQPLRLWQADLTKFNDGDFLRAEQQGNAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
1ahpA           WDLPVVGYRNGVAQPLRLWQADLTKFNDGDFLRAEQQGNAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC


                         .         *         .         .         .         .         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
2qn8A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1p2dA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1p29A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1k08A           TLQDIIRRFKSSKTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1xc7A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1p4gA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1lwnA           TLQDIIRRFKSSN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1b4dA           TLQDIIRRFKS-SKNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1ktiA           TLQDIIRRFKSSN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2fetA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1c8lA           TLQDIIRRFKSSN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1z62A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2qn9A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1k06A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1uzuA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1ww3A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1p2bA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2iegB           TLQDIIRRFKSTN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2gm9A           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1gfzA           TLQDIIRRFKSSKTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1ww2A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1wutA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2gpaA           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2gj4A           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1e1yA           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1bx3A           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2qrpA           TLQDIIRRFKS-SKNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1h5uA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3cuvA           TLQDIIRRFKS-SKNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2qn1A           TLQDIIRRFKKFGTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2iegA           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2pydA           TLQDIIRRFKS-SKNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1skc-           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1gpyA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1axrA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2amvA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2qrgA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2qnbA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2pyiA           TLQDIIRRFKS-SKNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1nojA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
8gpbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
6gpbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3gpbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2gpbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1gpbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1gpaB           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1gpaA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1c8kA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1a8iA           TLQDIIRRFKKFRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2ieiA           TLQDIIRRFKSFDAFPDKVA----IQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2gpnA           TLQDIIRRFKSTN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2qn3A           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3oB           TLQDIIRRFKSSKTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3lA           TLQDIIRRFKSTN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1noiA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3oA           TLQDIIRRFKSTN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3lB           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1abbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1z8dA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVL
1l5sB           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1l5sA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2g9uA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1l7xB           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2g9vA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2g9qA           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3cejA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1l5rA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1l5qB           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1l5qA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1fc0B           TLQDIIRRFKKFGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2zb2B           TLQDIIRRFKA-STVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2zb2A           TLQDIIRRFKKFGAGFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1em6A           TLQDIIRRFKA-STVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1l7xA           TLQDIIRRFKASKFTVDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1exvA           TLQDIIRRFKAFDA----FPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3cehA           TLQDIIRRFKASKFTVDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2atiA           TLQDIIRRFKASKFTVDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1fc0A           TLQDIIRRFKASKFTVDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3ddwB           TLQDIIRRFKKFGGTVDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3e3nE           TLQDIIRRFKSSN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nC           TLQDIIRRFKSSN--FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3lD           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3ddsB           TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3ddsA           TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3e3oD           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3oC           TLQDIIRRFKSSRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3nB           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3dd1B           TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2ieiB           TLQDIIRRFKS---NFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1xoiA           TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1fa9A           TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3e3lC           TLQDIIRRFKS-STNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nH           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nF           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nD           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1pygB           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1pygA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVL