[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:napA.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3jxoB.bssp"
#ERROR : Can't open dsspfile "3jxoA.bssp"

## Summary of PDB Search
:618
    9e-05  41%  3jxoB  [x.x.x] TRKA-N DOMAIN PROTEIN
    9e-05  41%  3jxoA  [x.x.x] TRKA-N DOMAIN PROTEIN
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3jxoB           ----------------------------------------------------------------------
3jxoA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVNDSIFVGV
3jxoB           ------------------------------------------------------------VEEDSPVVGK
3jxoA           ------------------------------------------------------------VEEDSPVVGK


                         .         .         .         *         .         .         .:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESxxxxxxxxxxxx
3jxoB           KLKDLPLPRDSIIAAIVRGGVLVVPRGDTEILSGDYVIVSAEAKET------------
3jxoA           KLKDLPLPRDSIIAAIVRGGVLVVPRGDTEILSGDYVIVSAEAKET------------