[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rplE

[Show Plain Result]

#ERROR : Can't open dsspfile "1iq4A.bssp"
#ERROR : Can't open dsspfile "2zjrD.bssp"
#ERROR : Can't open dsspfile "1vorG.bssp"
#ERROR : Can't open dsspfile "1vsaE.bssp"
#ERROR : Can't open dsspfile "1vs9E.bssp"
#ERROR : Can't open dsspfile "2j01G.bssp"
#ERROR : Can't open dsspfile "2hguG.bssp"
#ERROR : Can't open dsspfile "3d5bG.bssp"
#ERROR : Can't open dsspfile "3bboH.bssp"
#ERROR : Can't open dsspfile "1vs6F.bssp"
#ERROR : Can't open dsspfile "2gyaD.bssp"
#ERROR : Can't open dsspfile "3i1nF.bssp"
#ERROR : Can't open dsspfile "1mjiB.bssp"
#ERROR : Can't open dsspfile "1mjiA.bssp"
#ERROR : Can't open dsspfile "1yl3G.bssp"
#ERROR : Can't open dsspfile "1jj2D.bssp"
#ERROR : Can't open dsspfile "1s1iJ.bssp"
#ERROR : Can't open dsspfile "2zkrd.bssp"

## Summary of PDB Search
:180
    6e-84  82%  1iq4A  [d.77.1] 50S RIBOSOMAL PROTEIN L5
    4e-63  59%  2zjrD  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    4e-63  59%  1vorG  [i.1.1] 50S RIBOSOMAL PROTEIN L5
    3e-58  57%  1vsaE  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-58  57%  1vs9E  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-58  57%  2j01G  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-58  57%  2hguG  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-58  57%  3d5bG  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-58  58%  3bboH  [x.x.x] RIBOSOMAL PROTEIN L5
    3e-56  53%  1vs6F  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    3e-56  53%  2gyaD  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    7e-56  53%  3i1nF  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    2e-54  56%  1mjiB  [d.77.1] 50S RIBOSOMAL PROTEIN L5
    2e-54  56%  1mjiA  [d.77.1] 50S RIBOSOMAL PROTEIN L5
    8e-15  46%  1yl3G  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    8e-15  46%  1jj2D  [d.77.1] RIBOSOMAL PROTEIN L5
    1e-12  33%  1s1iJ  [i.1.1] 60S RIBOSOMAL PROTEIN L11
    7e-11  30%  2zkrd  [x.x.x] 60S RIBOSOMAL PROTEIN L11
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
1iq4A           -MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQRPVVTR
2zjrD           ---QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDKAAKELALITLQKPIITK
1vorG           ---QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDKAAKELALITLQKPIITK
1vsaE           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
1vs9E           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
2j01G           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
2hguG           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
3d5bG           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
3bboH           ---RLKTNYIEKMVPLLKEEFSYSNILEVPKVVKIVVNCGIGDASQNAKGLDAAINELALITGQRPVKTK
1vs6F           ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
2gyaD           ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
3i1nF           ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
1mjiB           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
1mjiA           ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
1yl3G           --------------------------MREPRIEKVVVHMGIGHA--------NAEDILGEITGQMPVRTK
1jj2D           --------------------------MREPRIEKVVVHMGIGHA--------NAEDILGEITGQMPVRTK
1s1iJ           --------------------------MRDLKIEKLVLNISVGESGDRLTRASKVLEQLS---GQTPVQSK
2zkrd           --------------------------MRELRIRKLCLNICVGESGDRLTRAAKVLEQLT---GQTPVFSK


                         .         .         *         .         .         .         .:140
query           AKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
1iq4A           AKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLISVSLPRARDFRGVSKKSFDGRGNYTLGIKEQLIFP
2zjrD           AKKSISNFKLRQGMPVGIKVTLRGERMYVFLEKLINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFP
1vorG           AKKSISNFKLRQGMPVGIKVTLRGERMYVFLEKLINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFP
1vsaE           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
1vs9E           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
2j01G           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
2hguG           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
3d5bG           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
3bboH           AKTSIAGFKVREGMTLGIAVTLRGNLMYSFLDRLINLALPRTRDFQGVNPNSFDGHGNYSVGFREQSVFP
1vs6F           ARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFP
2gyaD           ARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFP
3i1nF           ARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFP
1mjiB           AKKSISNFKLRKGMPIGLRVTLRRDR-WIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
1mjiA           AKKSISNFKLRKGMPIGLRVTLRRDR-WIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
1yl3G           AKRTVGEFDIREGDPIGAKVTLRDEMAEEFL----QTALPLAE----LATSQFDDTGNFSFGL-------
1jj2D           AKRTVGEFDIREGDPIGAKVTLRDEMAEEFL----QTALPLAE----LATSQFDDTGNFSFGL-------
1s1iJ           ARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRD------RNFSATGNFGFGIDEHIDL-
2zkrd           ARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGL-----KVREYE-LRKNNFSDTGNFGFGIQEHIDL-


                         +         .         .         .         .         *         .:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK
1iq4A           EIDYDKVNKVRGMDIVIVTTANTDEEARELLALLGMPFQK
2zjrD           EITYDMVDKTRGMDITIVTTAKTDEEARALLQSMGLPFRK
1vorG           EITYDMVDKTRGMDITIVTTAKTDEEARALLQSMGLPFRK
1vsaE           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
1vs9E           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
2j01G           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
2hguG           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
3d5bG           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
3bboH           EIKPEIVGKARGMDVCITTTAKTDKEAYKLLSLMGMPF--
1vs6F           EIDYDKVDRVRGLDITITTTAKSDEEGRALLAAFDFPFRK
2gyaD           EIDYDKVDRVRGLDITITTTAKSDEEGRALLAAFDFPFRK
3i1nF           EIDYDKVDRVRGLDITITTTAKSDEEGRALLAAFDFPF--
1mjiB           EITYDMVDALRG-DIAVVTTAETDEEARALLELLGFPFRK
1mjiA           EITYDMVDALRG-DIAVVTTAETDEEARALLELLGFPFRK
1yl3G           ----------------------------------------
1jj2D           ----------------------------------------
1s1iJ           GIKYDPSIGIFGMDFYVV----------------------
2zkrd           GIKYDPSIGIYGLDFYVV----------------------