[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rplN

[Show Plain Result]

#ERROR : Can't open dsspfile "1whiA.bssp"
#ERROR : Can't open dsspfile "1vsaI.bssp"
#ERROR : Can't open dsspfile "2j01O.bssp"
#ERROR : Can't open dsspfile "3i1nK.bssp"
#ERROR : Can't open dsspfile "2gyaI.bssp"
#ERROR : Can't open dsspfile "1vs6K.bssp"
#ERROR : Can't open dsspfile "2zjrH.bssp"
#ERROR : Can't open dsspfile "1vorL.bssp"
#ERROR : Can't open dsspfile "1vs9I.bssp"
#ERROR : Can't open dsspfile "3bboM.bssp"
#ERROR : Can't open dsspfile "1s72K.bssp"
#ERROR : Can't open dsspfile "1jj2J.bssp"
#ERROR : Can't open dsspfile "2zkrk.bssp"
#ERROR : Can't open dsspfile "1s1iR.bssp"

## Summary of PDB Search
:122
    3e-41  79%  1whiA  [i.1.1 (1c04D)] RIBOSOMAL PROTEIN L14
    2e-34  68%  1vsaI  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    2e-34  68%  2j01O  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    8e-32  54%  3i1nK  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    1e-31  54%  2gyaI  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    3e-31  53%  1vs6K  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    9e-31  68%  2zjrH  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    1e-29  68%  1vorL  [i.1.1] 50S RIBOSOMAL PROTEIN L14
    1e-29  68%  1vs9I  [x.x.x] 50S RIBOSOMAL PROTEIN L14
    7e-29  52%  3bboM  [x.x.x] RIBOSOMAL PROTEIN L14
    2e-16  38%  1s72K  [b.39.1] 50S RIBOSOMAL PROTEIN L14P
    3e-16  38%  1jj2J  [b.39.1] RIBOSOMAL PROTEIN L14
    3e-12  35%  2zkrk  [x.x.x] 60S RIBOSOMAL PROTEIN L23
    7e-12  36%  1s1iR  [i.1.1] 60S RIBOSOMAL PROTEIN L23
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
1whiA           MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
1vsaI           MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEVK
2j01O           MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEIK
3i1nK           MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
2gyaI           -IQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
1vs6K           -IQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
2zjrH           MIMPQSRLDVADNSGAREIMCIRVLNSXXXRYAHVGDIIVASVKDAAPRXXXXXXXXXXXXXXRTSHAIK
1vorL           -IMPQSRLDVADNSGAREIMCIRVLNSXXXRYAHVGDIIVASVKDAAPRXXXXXXXXXXXXXXRTSHAIK
1vs9I           ----QTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEVK
3bboM           MIQPQTHLNVADNSGARELMCIRIIGASNRRYARIGDVIVAVIKEAIPNTPLERSEVIRAVVVRTCKELK
1s72K           -LEKGSLITCADNTGARELKVISVHGYSRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVV---RQRKPIR
1jj2J           -LEKGSLITCADNTGARELKVISVHGYSGTKNAGLGDKITVSVTKGTPEMRRQVLEAVVV---RQRKPIR
2zkrk           -------INCADNTGAKNLYIISVKGINRLPAAGVGDMVMATVKKGKPELRKKVHPAVVI---RQRKSYR
1s1iR           -------MNCADNSGARNLYIIAVKGSNRLPAASLGDMVMATVKKGKPELRKKVMPAIVV---RQAKSWR


                         .         .         *         .         .         .         .:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL
1whiA           XPDGSYIRFDENACVIIRDDKSPRGTRIFGPVARELRDKDFMKIISLAPEVI
1vsaI           RPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL
2j01O           RPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL
3i1nK           RPDGSVIRFDGNACVLLNNNEQPIGTRIFGPVTRELRSEKFMKIISLAPEV-
2gyaI           RPDGSVIRFDGNACVLLNNNEQPIGTRIFGPVTRELRSEKFMKIISLAPEVL
1vs6K           RPDGSVIRFDGNACVLLNNNEQPIGTRIFGPVTRELRSEKFMKIISLAPEV-
2zjrH           RADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRDRRFMKIVSLAPEVL
1vorL           RADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRDRRFMKIVSLAPEV-
1vs9I           RPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREG-FMKIVSLAP---
3bboM           RDNGMIIRYDDNAAVIIDQEGNPKGTRIFGAIARELRQ-KFAKIVSLAPEVL
1s72K           RPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQ-RFGSVASAATMIV
1jj2J           RPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQ-RFGSVASAATMIV
2zkrk           RKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECAD--------------
1s1iR           RRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECAD--------------