[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:rluD.4

[Show Plain Result]

#ERROR : Can't open dsspfile "1v9fA.bssp"
#ERROR : Can't open dsspfile "2istA.bssp"
#ERROR : Can't open dsspfile "1xpiB.bssp"
#ERROR : Can't open dsspfile "1xpiA.bssp"
#ERROR : Can't open dsspfile "2i82A.bssp"
#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "2i82C.bssp"
#ERROR : Can't open dsspfile "2i82B.bssp"
#ERROR : Can't open dsspfile "1qyuA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"

## Summary of PDB Search
:296
    2e-23  36%  1v9fA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    2e-23  36%  2istA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    5e-23  36%  1xpiB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    1e-22  36%  1xpiA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    1e-20  38%  2i82A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    2e-20  38%  1v9kA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    5e-20  38%  2i82C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    8e-20  39%  2i82B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    1e-18  36%  1qyuA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    8e-15  36%  1przA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    8e-07  28%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    8e-07  28%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    8e-07  28%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
:296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
1v9fA           ----------------------------------------------------------------------
2istA           ----------------------------------------------------------------------
1xpiB           ----------------------------------------------------------------------
1xpiA           ----------------------------------------------------------------------
2i82A           -------------------------------------------------------------------ENY
1v9kA           ----------------------------------------------------------------------
2i82C           --------------------------------------------------------------------NY
2i82B           ----------------------------------------------------------------------
1qyuA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
3dh3C           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQL
3dh3B           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQL
3dh3A           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQL


                         .         .         *         .         .         .         .:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
1v9fA           -----PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
2istA           -----PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
1xpiB           --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
1xpiA           --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLR----ALRARFL--ELVHRLDRDTSGVL
2i82A           NPPQEPLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES-------VHRLDA-TSGVI
1v9kA           -------DVIYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
2i82C           NPPQEPLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES-------VHRLDA-TSGVI
2i82B           ---QEPLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES-------VHRLDA-TSGVI
1qyuA           -----PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLV
1przA           -------------------NKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLV
3dh3C           IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
3dh3B           IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
3dh3A           IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI


                         +         .         .         .         .         *         .:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
1v9fA           VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
2istA           VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
1xpiB           LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
1xpiA           LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
2i82A           VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
1v9kA           LVAKKRSALRSLHEQLREKG-QKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
2i82C           VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
2i82B           VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
1qyuA           -VAKTVPAQTRLVESLQRREITREYEAVAIGHTAG--GTVDEPISRHPTKRTHAVHPMGKPAVTHYRIEH
1przA           -VAKTVPAQTRLVESLQRREITREYEAVAIGHTAG--GTVDEPISRHPTKRTHAV-HPGKPAVTHYRIEH
3dh3C           FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE----------------------------------
3dh3B           FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE----------------------------------
3dh3A           FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE----------------------------------


                         .         .         .         +         .         .         .:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
1v9fA           HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
2istA           HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
1xpiB           RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
1xpiA           RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
2i82A           YAADNTARVVLKPITGRSHQLRVHL-ALGHPILGDRFYASPEARAAPRLLLHA-----------------
1v9kA           RYAF-ATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVRI--
2i82C           YAADNTARVVLKPITGRSHQLRVHL-ALGHPILGDRFYASPEARAAPRLLLHA-----------------
2i82B           YAADNTARVVLKPITGRSHQLRVHL-ALGHPILGDRFYASPEARAAPRLLLHA-----------------
1qyuA           FRVH--TXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGGRTLRKFDRQALHA-TLRLYHPISGIEE-WH
1przA           FRVH--TXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGGRTLRKFDRQALHA-TLRLYHPISGIEE-WH
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SEMPKDLENLIVRLKN
1v9fA           APIPQDMVELI-----
2istA           APIPQDMVELI-----
1xpiB           APMDEGLKRCLQKLRN
1xpiA           APMDEGLKRCLQKLRN
2i82A           ----------------
1v9kA           ----------------
2i82C           ----------------
2i82B           ----------------
1qyuA           APIPQDVELIEVR---
1przA           APIPQDVELIEVR---
3dh3C           ----------------
3dh3B           ----------------
3dh3A           ----------------