[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:gpmA.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e58A.bssp"
#ERROR : Can't open dsspfile "1qhfA.bssp"
#ERROR : Can't open dsspfile "4pgmB.bssp"
#ERROR : Can't open dsspfile "1bq3C.bssp"
#ERROR : Can't open dsspfile "1bq3D.bssp"
#ERROR : Can't open dsspfile "3gp5A.bssp"
#ERROR : Can't open dsspfile "3gp3C.bssp"
#ERROR : Can't open dsspfile "3gp3A.bssp"
#ERROR : Can't open dsspfile "3eznB.bssp"
#ERROR : Can't open dsspfile "3eznA.bssp"
#ERROR : Can't open dsspfile "3fdzB.bssp"
#ERROR : Can't open dsspfile "3d8hB.bssp"
#ERROR : Can't open dsspfile "3d8hA.bssp"
#ERROR : Can't open dsspfile "1yjxK.bssp"
#ERROR : Can't open dsspfile "1yjxJ.bssp"
#ERROR : Can't open dsspfile "1yjxI.bssp"
#ERROR : Can't open dsspfile "1yjxH.bssp"
#ERROR : Can't open dsspfile "1yjxF.bssp"
#ERROR : Can't open dsspfile "1yjxE.bssp"
#ERROR : Can't open dsspfile "1yjxB.bssp"
#ERROR : Can't open dsspfile "1yjxA.bssp"
#ERROR : Can't open dsspfile "1yfkB.bssp"
#ERROR : Can't open dsspfile "1yfkA.bssp"
#ERROR : Can't open dsspfile "3pgmA.bssp"
#ERROR : Can't open dsspfile "1xq9B.bssp"
#ERROR : Can't open dsspfile "1xq9A.bssp"
#ERROR : Can't open dsspfile "1t8pA.bssp"
#ERROR : Can't open dsspfile "2h4zB.bssp"
#ERROR : Can't open dsspfile "2h4xB.bssp"
#ERROR : Can't open dsspfile "2h4xA.bssp"
#ERROR : Can't open dsspfile "2f90A.bssp"
#ERROR : Can't open dsspfile "2a9jA.bssp"
#ERROR : Can't open dsspfile "2hhjB.bssp"
#ERROR : Can't open dsspfile "2hhjA.bssp"
#ERROR : Can't open dsspfile "1riiD.bssp"
#ERROR : Can't open dsspfile "1riiC.bssp"
#ERROR : Can't open dsspfile "1riiB.bssp"
#ERROR : Can't open dsspfile "1riiA.bssp"
#ERROR : Can't open dsspfile "1fztA.bssp"
#ERROR : Can't open dsspfile "1h2eA.bssp"
#ERROR : Can't open dsspfile "1ebbA.bssp"
#ERROR : Can't open dsspfile "2p9fB.bssp"
#ERROR : Can't open dsspfile "2p9fA.bssp"
#ERROR : Can't open dsspfile "2eoaB.bssp"
#ERROR : Can't open dsspfile "2eoaA.bssp"
#ERROR : Can't open dsspfile "2p79B.bssp"
#ERROR : Can't open dsspfile "2p79A.bssp"
#ERROR : Can't open dsspfile "2p6oB.bssp"
#ERROR : Can't open dsspfile "2p6oA.bssp"
#ERROR : Can't open dsspfile "2p2zB.bssp"
#ERROR : Can't open dsspfile "2p2zA.bssp"
#ERROR : Can't open dsspfile "2enuA.bssp"
#ERROR : Can't open dsspfile "1v7qA.bssp"
#ERROR : Can't open dsspfile "1v37B.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "2p9yB.bssp"
#ERROR : Can't open dsspfile "2p9yA.bssp"
#ERROR : Can't open dsspfile "2p77B.bssp"
#ERROR : Can't open dsspfile "2p77A.bssp"
#ERROR : Can't open dsspfile "2p6mB.bssp"
#ERROR : Can't open dsspfile "2p6mA.bssp"
#ERROR : Can't open dsspfile "2p30A.bssp"
#ERROR : Can't open dsspfile "2p2yA.bssp"
#ERROR : Can't open dsspfile "2owdB.bssp"
#ERROR : Can't open dsspfile "2owdA.bssp"
#ERROR : Can't open dsspfile "2ekbB.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "2p75B.bssp"
#ERROR : Can't open dsspfile "2p75A.bssp"
#ERROR : Can't open dsspfile "2oweA.bssp"
#ERROR : Can't open dsspfile "2pa0B.bssp"
#ERROR : Can't open dsspfile "2pa0A.bssp"
#ERROR : Can't open dsspfile "2p78B.bssp"
#ERROR : Can't open dsspfile "2p78A.bssp"
#ERROR : Can't open dsspfile "2ekzB.bssp"
#ERROR : Can't open dsspfile "2ekzA.bssp"
#ERROR : Can't open dsspfile "2p9zB.bssp"
#ERROR : Can't open dsspfile "2p9zA.bssp"
#ERROR : Can't open dsspfile "2enwB.bssp"
#ERROR : Can't open dsspfile "2enwA.bssp"
#ERROR : Can't open dsspfile "3e9dB.bssp"
#ERROR : Can't open dsspfile "3e9dA.bssp"
#ERROR : Can't open dsspfile "3e9eB.bssp"
#ERROR : Can't open dsspfile "3e9eA.bssp"
#ERROR : Can't open dsspfile "3dcyA.bssp"
#ERROR : Can't open dsspfile "1c7zA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3f3kA.bssp"
#ERROR : Can't open dsspfile "3f3kB.bssp"
#ERROR : Can't open dsspfile "3e9cB.bssp"
#ERROR : Can't open dsspfile "3e9cA.bssp"

## Summary of PDB Search
:228
    3e-72  57%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    7e-70  57%  1e58A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    6e-69  54%  1qhfA  [c.60.1] PROTEIN (PHOSPHOGLYCERATE MUTASE)
    6e-69  54%  4pgmB  [c.60.1] PHOSPHOGLYCERATE MUTASE 1
    6e-69  54%  1bq3C  [c.60.1] PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
    6e-69  54%  1bq3D  [c.60.1] PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
    4e-68  55%  3gp5A  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    4e-68  55%  3gp3C  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    4e-68  55%  3gp3A  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    4e-68  55%  3eznB  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    4e-68  55%  3eznA  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    8e-66  55%  3fdzB  [x.x.x] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    8e-65  53%  3d8hB  [x.x.x] GLYCOLYTIC PHOSPHOGLYCERATE MUTASE
    8e-65  53%  3d8hA  [x.x.x] GLYCOLYTIC PHOSPHOGLYCERATE MUTASE
    4e-64  52%  1yjxK  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxJ  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxI  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxH  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxF  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxE  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxB  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yjxA  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yfkB  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  1yfkA  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    4e-64  52%  3pgmA  [x.x.x] PHOSPHOGLYCERATE MUTASE 1
    7e-62  51%  1xq9B  [c.60.1] PHOSPHOGLYCERATE MUTASE
    7e-62  51%  1xq9A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-61  48%  1t8pA  [c.60.1] BISPHOSPHOGLYCERATE MUTASE
    3e-61  48%  2h4zB  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    3e-61  48%  2h4xB  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    3e-61  48%  2h4xA  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    3e-61  48%  2f90A  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    3e-61  48%  2a9jA  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    5e-59  48%  2hhjB  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    5e-59  48%  2hhjA  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    3e-57  49%  1riiD  [c.60.1] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    3e-57  49%  1riiC  [c.60.1] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    3e-57  49%  1riiB  [c.60.1] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    3e-57  49%  1riiA  [c.60.1] 2,3-BISPHOSPHOGLYCERATE-DEPENDENT
    1e-53  54%  1fztA  [c.60.1] PHOSPHOGLYCERATE MUTASE
    7e-13  34%  1h2eA  [c.60.1] PHOSPHATASE
    7e-13  34%  1ebbA  [c.60.1] PHOSPHATASE
    8e-09  38%  2p9fB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    8e-09  38%  2p9fA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2eoaB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2eoaA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p79B  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p79A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p6oB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p6oA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p2zB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2p2zA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-08  38%  2enuA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  1v7qA  [x.x.x] PHOSPHOGLYCERATE MUTASE
    2e-08  38%  1v37B  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-08  38%  1v37A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-08  38%  2p9yB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p9yA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p77B  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p77A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p6mB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p6mA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p30A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p2yA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2owdB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2owdA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2ekbB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p75B  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  38%  2p75A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    2e-08  36%  2oweA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2pa0B  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2pa0A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2p78B  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2p78A  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2ekzB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    3e-08  37%  2ekzA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    4e-08  35%  2p9zB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    4e-08  35%  2p9zA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    5e-08  39%  2enwB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    5e-08  39%  2enwA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    1e-07  35%  3e9dB  [x.x.x] ZGC:56074
    1e-07  35%  3e9dA  [x.x.x] ZGC:56074
    2e-06  34%  3e9eB  [x.x.x] ZGC:56074
    2e-06  34%  3e9eA  [x.x.x] ZGC:56074
    4e-06  36%  3dcyA  [x.x.x] REGULATOR PROTEIN
    1e-05  31%  1c7zA  [c.60.1] FRUCTOSE-2,6-BISPHOSPHATASE
    6e-05  36%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-04  28%  3f3kA  [x.x.x] UNCHARACTERIZED PROTEIN YKR043C
    5e-04  39%  3f3kB  [x.x.x] UNCHARACTERIZED PROTEIN YKR043C
    8e-04  42%  3e9cB  [x.x.x] ZGC:56074
    8e-04  42%  3e9cA  [x.x.x] ZGC:56074
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
1e59A           --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
1e58A           --KLVLVR-GESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
1qhfA           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
4pgmB           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
1bq3C           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
1bq3D           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
3gp5A           MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3gp3C           MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3gp3A           MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3eznB           MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3eznA           MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3fdzB           MYKLVLIR-GESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
3d8hB           --KLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLK
3d8hA           --KLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLK
1yjxK           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxJ           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxI           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxH           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxF           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxE           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxB           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yjxA           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yfkB           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
1yfkA           --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
3pgmA           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKGVNVLVDYTSKLSRAIQTANIALE
1xq9B           ---LVLLRHGESTWNKENKFTGWTDVPLSXXXXXXXXXXXXYLKEKNFKFDVVYTSVLKRAICTAWNVLK
1xq9A           ---LVLLRHGESTWNKENKFTGWTDVPLSXXXXXXXXXXXXYLKEKNFKFDVVYTSVLKRAICTAWNVLK
1t8pA           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2h4zB           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2h4xB           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2h4xA           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2f90A           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2a9jA           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2hhjB           --KLIMLR-GEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
2hhjA           --KLIMLR-GEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
1riiD           ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
1riiC           ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
1riiB           ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
1riiA           ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
1fztA           ---LVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILE
1h2eA           ---LYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLE--AVELAAIYTSTSGRALETAE--IV
1ebbA           ---LYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLE--AVELAAIYTSTSGRALETAE--IV
2p9fB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p9fA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2eoaB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2eoaA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p79B           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p79A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p6oB           --ELWLVRHGETMWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p6oA           --ELWLVRHGETMWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p2zB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p2zA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2enuA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
1v7qA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
1v37B           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
1v37A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p9yB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p9yA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p77B           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAEMA-G
2p77A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAEMA-G
2p6mB           --ELWLVRHGETLWNREGRLLGWTDMPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p6mA           --ELWLVRHGETLWNREGRLLGWTDMPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p30A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p2yA           --ELWMVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2owdB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLMRARRTAELA-G
2owdA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLMRARRTAELA-G
2ekbB           --ELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2ekbA           --ELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p75B           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-MPSLPAFSSDLLRARRTAELA-G
2p75A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-MPSLPAFSSDLLRARRTAELA-G
2oweA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA--
2pa0B           --ELWLVRHGETLWNREGRLLGWTDLPMTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2pa0A           --ELWLVRHGETLWNREGRLLGWTDLPMTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p78B           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2p78A           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2ekzB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDMLRARRTAELA-G
2ekzA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDMLRARRTAELA-G
2p9zB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA--
2p9zA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA--
2enwB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
2enwA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQA----RRLKGA-LPSLPAFSSDLLRARRTAELA-G
3e9dB           ---LTIVRHGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
3e9dA           ---LTIVRHGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
3e9eB           ---LTIVRAGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
3e9eA           ---LTIVRAGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
3dcyA           ---LTVVRHGETRFNKEKIIQGQGDEPLSETGFKQAAAAGIFLNN--VKFTHAFSSDLRT--KQTHGILE
1c7zA           MRSIYLCRHGESELNLRGRIGG--DSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQT------
1bifA           -PRSIYLRHGESELNLKGRIGG--DPGLSPRGREFSKHLAQFISDQNIKDLKVFTSQMKRTIQT------
3f3kA           -PRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQLRTGESVFRNQFLNPDNIFTSPRLRARQTVDLVLK
3f3kB           -PRCIIVRHGQTEWSKSGQYTGLTDLPLTPYG--------------------------------------
3e9cB           ---LTIVRHGET------------DTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIIL-
3e9cA           ---LTIVRHGET------------DTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIIL-


                         .         .         *         .         .         .         .:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
1e59A           ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
1e58A           ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
1qhfA           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
4pgmB           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
1bq3C           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
1bq3D           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
3gp5A           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3gp3C           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3gp3A           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3eznB           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3eznA           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3fdzB           QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
3d8hB           ELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKG
3d8hA           ELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKG
1yjxK           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxJ           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxI           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxH           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxF           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxE           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxB           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yjxA           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yfkB           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
1yfkA           AIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVXXXXXXXXXXSNISKDRRYAD
3pgmA           KADRLWIPVNRSWRLNERHYGDLQGKDKAQTLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
1xq9B           TADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKN
1xq9A           TADLLHVPVVKTWRLNERHYGSLQGLNKSETAKKYGEEQVKIWRRSYDIPPPKLDKEDNRWPGHNVVYKN
1t8pA           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2h4zB           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2h4xB           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2h4xA           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2f90A           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2a9jA           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2hhjB           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
2hhjA           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPQEIYNDRRYKV
1riiD           SADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYAD
1riiC           SADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYAD
1riiB           SADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYAD
1riiA           SADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYAD
1fztA           EVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAP-------------------
1h2eA           RGGRL-IPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQ------APHLYAPQRG-----ERFCD
1ebbA           RGGRL-IPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQ------APHLYAPQRG-----ERFCD
2p9fB           FSPRLY-PEMR-----EIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p9fA           FSPRLY-PEMR-----EIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2eoaB           FSPRLY-PE-----LREIHFGALEGALHETLDPRYKEALL--------------------------RFQG
2eoaA           FSPRLY-PE-----LREIHFGALEGALHETLDPRYKEALL--------------------------RFQG
2p79B           FSPRLY-PE-----LREIHFGALEGAMWETLDPRYKEALL--------------------------RFQG
2p79A           FSPRLY-PE-----LREIHFGALEGAMWETLDPRYKEALL--------------------------RFQG
2p6oB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p6oA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p2zB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p2zA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2enuA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
1v7qA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
1v37B           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
1v37A           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p9yB           FSPRLY-PE-----LREIHFGALEGALWETMDPRYKEALL--------------------------RFQG
2p9yA           FSPRLY-PE-----LREIHFGALEGALWETMDPRYKEALL--------------------------RFQG
2p77B           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p77A           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p6mB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p6mA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p30A           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p2yA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2owdB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2owdA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2ekbB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2ekbA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p75B           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p75A           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2oweA           ----GFSPRMYP-ELREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2pa0B           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2pa0A           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p78B           FSPRLY-PE-----LREIHFGAMEGALWETLDPRYKEALL--------------------------RFQG
2p78A           FSPRLY-PE-----LREIHFGAMEGALWETLDPRYKEALL--------------------------RFQG
2ekzB           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2ekzA           FSPRLY-PE-----LREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p9zB           ----GFSPRLHP-ELREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2p9zA           ----GFSPRLHP-ELREIHFGALEGALWETLDPRYKEALL--------------------------RFQG
2enwB           FSPRLY-PE-----LREIHFGALEGA---------------LWE----------TLDPRHKEAL-LRFQG
2enwA           FSPRLY-PE-----LREIHFGALEGA---------------LWE----------TLDPRHKEAL-LRFQG
3e9dB           NNLHSSATEMLDPLLRERGFGVAEGRPK------------------------------------------
3e9dA           NNLHSSATEMLDPLLRERGFGVAEGRPK------------------------------------------
3e9eB           NNLHSSATEMLDPLLRERGFGVAEGRPK------------------------------------------
3e9eA           NNLHSSATEMLDPLLRERGFGVAEGRPK------------------------------------------
3dcyA           RSKFCKDTVKYDSRLRERKYGVVEGK--------------------------------------------
1c7zA           -AEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEE---------------FALRDQ----DKYRYR-
1bifA           ----------------------------------------------------------------------
3f3kA           ----------------------------------------------------------------------
3f3kB           ----------------------------------------------------------------------
3e9cB           ----------------------------------------------------------------------
3e9cA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
1e59A           LSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGV
1e58A           LSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGV
1qhfA           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
4pgmB           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
1bq3C           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
1bq3D           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
3gp5A           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3gp3C           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3gp3A           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3eznB           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3eznA           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3fdzB           VPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIAAHGNSLRALIKYLDGISDADIVGLNIPNGV
3d8hB           ICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTAC
3d8hA           ICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTAC
1yjxK           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxJ           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxI           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxH           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxF           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxE           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxB           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yjxA           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yfkB           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
1yfkA           LTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGI
3pgmA           VDPNVLPETESLALVIDRLLPYWQDVIAK--LVGKTSMIAAHGNSLRGLVKHLEGISDADIAKLNIPPGT
1xq9B           VPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGV
1xq9A           VPKDALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGV
1t8pA           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2h4zB           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2h4xB           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2h4xA           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2f90A           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2a9jA           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2hhjB           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
2hhjA           CDVPLLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
1riiD           IGGG--PLTECLADVVARFLPYFTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGI
1riiC           IGGG--PLTECLADVVARFLPYFTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGI
1riiB           IGGG--PLTECLADVVARFLPYFTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGI
1riiA           IGGG--PLTECLADVVARFLPYFTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGI
1fztA           ------PNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGV
1h2eA           VQQR----------ALEAVQSIVDRH------EGETVLIVTHGVVLKTL---------------------
1ebbA           VQQR----------ALEAVQSIVDRH------EGETVLIVTHGVVLKTL---------------------
2p9fB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p9fA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2eoaB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2eoaA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p79B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p79A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p6oB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p6oA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p2zB           FHP---PGGESLSAFQERVFRFLEGMKAP-------AVLFTHGGVVRAVLR-------------------
2p2zA           FHP---PGGESLSAFQERVFRFLEGMKAP-------AVLFTHGGVVRAVLR-------------------
2enuA           FHP---PGGESLSAFQERVFRFMEGLKAP-------AVLFTHGGVVRAVLR-------------------
1v7qA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
1v37B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
1v37A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p9yB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p9yA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p77B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p77A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p6mB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p6mA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p30A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p2yA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2owdB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2owdA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2ekbB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2ekbA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p75B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p75A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2oweA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2pa0B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2pa0A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p78B           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p78A           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2ekzB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2ekzA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p9zB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2p9zA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2enwB           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
2enwA           FHP---PGGESLSAFQERVFRFLEGLKAP-------AVLFTHGGVVRAVLR-------------------
3e9dB           ----------------------------------------------------------------------
3e9dA           ----------------------------------------------------------------------
3e9eB           ----------------------------------------------------------------------
3e9eA           ----------------------------------------------------------------------
3dcyA           ----------------------------------------------------------------------
1c7zA           -----YPKGESYEDLVQRLEP-----VIMELERQENVLVICHQAVMRCLLAYLDKSSDE-----------
1bifA           ----------------------------------------------------------------------
3f3kA           ----------------------------------------------------------------------
3f3kB           ----------------------------------------------------------------------
3e9cB           ----------------------------------------------------------------------
3e9cA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PVVYDLDDKLNIVNKExx
1e59A           PLVYEFDE----------
1e58A           PLVYEFDE----------
1qhfA           PLVFELDENL--------
4pgmB           PLVFELDENL--------
1bq3C           PLVFELDENL--------
1bq3D           PLVFELDENL--------
3gp5A           PLVYELDESL--------
3gp3C           PLVYELDESL--------
3gp3A           PLVYELDESL--------
3eznB           PLVYELDESL--------
3eznA           PLVYELDESL--------
3fdzB           PLVYELDESL--------
3d8hB           PLVLELDDYLKVTKK---
3d8hA           PLVLELDDYLKVTKK---
1yjxK           PIVYELDKNL--------
1yjxJ           PIVYELDKNL--------
1yjxI           PIVYELDKNL--------
1yjxH           PIVYELDKNL--------
1yjxF           PIVYELDKNL--------
1yjxE           PIVYELDKNL--------
1yjxB           PIVYELDKNL--------
1yjxA           PIVYELDKNL--------
1yfkB           PIVYELDKNL--------
1yfkA           PIVYELDKNL--------
3pgmA           ILVFELDENL--------
1xq9B           PLVYELDENL--------
1xq9A           PLVYELDENL--------
1t8pA           PILLELDENLRAV-----
2h4zB           PILLELDENLRAV-----
2h4xB           PILLELDENLRAV-----
2h4xA           PILLELDENLRAV-----
2f90A           PILLELDENLRAV-----
2a9jA           PILLELDENLRAV-----
2hhjB           PILLELDENLRAV-----
2hhjA           PILLELDENLRAV-----
1riiD           PLRYDLDSAM--------
1riiC           PLRYDLDSAM--------
1riiB           PLRYDLDSAM--------
1riiA           PLRYDLDSAM--------
1fztA           PIVYHLDKDGKYVSKE--
1h2eA           ------------------
1ebbA           ------------------
2p9fB           ------------------
2p9fA           ------------------
2eoaB           ------------------
2eoaA           ------------------
2p79B           ------------------
2p79A           ------------------
2p6oB           ------------------
2p6oA           ------------------
2p2zB           ------------------
2p2zA           ------------------
2enuA           ------------------
1v7qA           ------------------
1v37B           ------------------
1v37A           ------------------
2p9yB           ------------------
2p9yA           ------------------
2p77B           ------------------
2p77A           ------------------
2p6mB           ------------------
2p6mA           ------------------
2p30A           ------------------
2p2yA           ------------------
2owdB           ------------------
2owdA           ------------------
2ekbB           ------------------
2ekbA           ------------------
2p75B           ------------------
2p75A           ------------------
2oweA           ------------------
2pa0B           ------------------
2pa0A           ------------------
2p78B           ------------------
2p78A           ------------------
2ekzB           ------------------
2ekzA           ------------------
2p9zB           ------------------
2p9zA           ------------------
2enwB           ------------------
2enwA           ------------------
3e9dB           ------------------
3e9dA           ------------------
3e9eB           ------------------
3e9eA           ------------------
3dcyA           ------------------
1c7zA           ------------------
1bifA           ------------------
3f3kA           ------------------
3f3kB           ------------------
3e9cB           ------------------
3e9cA           ------------------