[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00312.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "2oggA.bssp"
#ERROR : Can't open dsspfile "2ooiA.bssp"
#ERROR : Can't open dsspfile "2ooiB.bssp"
#ERROR : Can't open dsspfile "3ddvD.bssp"
#ERROR : Can't open dsspfile "3ddvB.bssp"
#ERROR : Can't open dsspfile "3ddvC.bssp"
#ERROR : Can't open dsspfile "3ddvA.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "2ra5A.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2p19C.bssp"
#ERROR : Can't open dsspfile "2p19B.bssp"
#ERROR : Can't open dsspfile "2p19A.bssp"
#ERROR : Can't open dsspfile "3ihuB.bssp"
#ERROR : Can't open dsspfile "3ihuA.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"

## Summary of PDB Search
:241
    3e-17  27%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-16  28%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    8e-16  30%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-14  29%  2oggA  [x.x.x] TREHALOSE OPERON TRANSCRIPTIONAL REPRESSOR
    3e-13  29%  2ooiA  [x.x.x] SA0254 PROTEIN
    1e-11  29%  2ooiB  [x.x.x] SA0254 PROTEIN
    1e-11  22%  3ddvD  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    1e-11  22%  3ddvB  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-07  28%  3ddvC  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-07  29%  3ddvA  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-07  24%  3edpA  [x.x.x] LIN2111 PROTEIN
    1e-06  25%  3edpB  [x.x.x] LIN2111 PROTEIN
    5e-05  30%  2ra5A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    6e-05  30%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    6e-05  30%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    6e-05  30%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-04  24%  2p19C  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-04  24%  2p19B  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-04  24%  2p19A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-04  31%  3ihuB  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    2e-04  31%  3ihuA  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    4e-04  47%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    4e-04  47%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
3bwgB           -------------------------KLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSGIFVR--
3bwgC           -------------------------KLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSGIFV---
3bwgA           -------------------------KLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKS
2oggA           ----------------------------------------------------------------------
2ooiA           ----------------------------------------------------------------------
2ooiB           ----------------------------------------------------------------------
3ddvD           ----------------------------------------------------------------------
3ddvB           ----------------------------------------------------------------------
3ddvC           ----------------------------------------------------------------------
3ddvA           ----------------------------------------------------------------------
3edpA           ----LFEVIASKIKDSINRDEYKTG--PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQPK
3edpB           ----LFEVIASKIKDSINRDEYKTG--PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQP-
2ra5A           ----------------------------------------------------------------------
2ek5C           ----LYKQIASLIEDSIVDGTLSDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG------
2ek5A           ----LYKQIASLIEDSIVDGTLSDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG------
2du9A           ----LYKQIASLIEDSIVDGTLSDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG------
2p19C           ----------------------------------------------------------------------
2p19B           ----------------------------------------------------------------------
2p19A           ----------------------------------------------------------------------
3ihuB           -----------------------------ETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRL
3ihuA           -----------------------------ETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRL
2di3B           --------------------------LPSERALSETLGVSRSSLREALRVLEALGTISTATGSG------
2di3A           --------------------------LPSERALSETLGVSRSSLREALRVLEALGTISTATGSG------


                         .         .         *         .         .         .         .:140
query           YLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
3bwgB           --------KHKRKGYISLLSNQDLEDFNVTSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
3bwgC           ----------RKHKRKGYISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
3bwgA           LLSNQGDFNV-------------------TSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
2oggA           -----------------------------KTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEH
2ooiA           ------------------------------SKVLVFEMATPPKSVQDELQLNADDTVYYLERLRFVDDDV
2ooiB           ------------------------------SKVLVFEMATPPKSVQDELQLNA-DTVYYLERLRFVDDDV
3ddvD           ------------------------------SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3ddvB           ------------------------------SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3ddvC           ------------------------QNRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3ddvA           ----------------------------PSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3edpA           L----------------TAQNILETGVKNLKKDIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSE-HG
3edpB           KLTAQNI----------------LETGVLKKDIKDF-YIRKAGKFYAEIFGKENELVYSIKFVQKSE-HG
2ra5A           --------------------------RRPATKVLVNTVVPATAEIAAALGVAEDSEVHRIERLRLTHGEP
2ek5C           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2p19C           ----------------------------PKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2p19B           ----------------------------PKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2p19A           ----------------------------PKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
3ihuB           SLQETDVLDVAERTGLLARAATRGSGNQPQVQAL------------------------------------
3ihuA           SLQETDVLDVAERTGLLARAATRGSGNQPQVQAL------------------------------------
2di3B           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
3bwgB           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQXXXXXXXXXXXXXXXPKLYIES
3bwgC           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQXXXXXXXXXXXXXXXPKLYIES
3bwgA           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQXXXXXXXXXXXXXXXPKLYIES
2oggA           VILDKDYFFRKHVPHLTKEICENSIYEYIEGELGLSISYAQKEIVAEPCTDEDRELLDLRGYDHV-VVRN
2ooiA           LCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQ
2ooiB           LCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQ
3ddvD           ICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQ
3ddvB           ICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQ
3ddvC           ICFEVASIPYSLV-----------------GHSNQTIS-------AVQASEQIAEYLEIKRGDAILRVRQ
3ddvA           ICFEVASIPYSLV-KIGHS--------------NQTIS-------AVQASEQIAEYLEIKRGDAILRVRQ
3edpA           ATLDRLILPLGLYPDL---QAKDFQIINIIELVNSGKYKLFXXXXXXXXILAGNEQIKLNENDPVFKLSS
3edpB           ATLDRLILPLGLYPDL---QAKDFQIINIIELVNSGKYKLFXXXXXXXXILAGNEQIKLNENDPVFKLSS
2ra5A           AYL-CNYLPPGLV-DLDTGQLEAT-GLYRLRAAGITLHSARQSIGARAATSGEAERLGEDAGAPL-LTER
2ek5C           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2p19C           VAILENYLP-PAFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVER
2p19B           VAILENYLP-PAFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVER
2p19A           VAILENYLP-PAFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVER
3ihuB           ----------------------------------------------------------------------
3ihuA           ----------------------------------------------------------------------
2di3B           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IFFLDNGTPFEFSQMRLHFKYLKFNTFxxxx
3bwgB           IFHLTNGQPFDYSKISYNYEQSQF-------
3bwgC           IFHLTNGQPFDYSKISYNYEQSQF-------
3bwgA           IFHLTNGQPFDYSKISYNYEQSQF-------
2oggA           YVFLEDTSLFQYTESRHRLDKFRFVDF----
2ooiA           TFYTMTGKPFDSSDIVFHYRHAQF-------
2ooiB           TFYTMTGKPFDSSDIVFHYRHAQF-------
3ddvD           VSYFENGLPFEY-------------------
3ddvB           VSYFENGLPFEY-------------------
3ddvC           VSYFENGLPFEY-------------------
3ddvA           VSYFENGLPFEY-------------------
3edpA           VFYAEN-------------------------
3edpB           VFYAEN-------------------------
2ra5A           TTFDDTGRAVEF-------------------
2ek5C           -------------------------------
2ek5A           -------------------------------
2du9A           -------------------------------
2p19C           VALDNSGQVIE--------------------
2p19B           VALDNSGQVIE--------------------
2p19A           VALDNSGQVIE--------------------
3ihuB           -------------------------------
3ihuA           -------------------------------
2di3B           -------------------------------
2di3A           -------------------------------