[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00427.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"

## Summary of PDB Search
:248
    2e-51  46%  2oukB  [x.x.x] PROTEIN ARTP
    2e-51  46%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-38  36%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-36  36%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-36  39%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-36  39%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-32  36%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-32  37%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    3e-31  40%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-31  40%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-30  33%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    7e-30  40%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-28  36%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    5e-28  36%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-28  36%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-28  36%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-28  31%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-27  36%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-27  36%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-27  37%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-27  37%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    9e-25  35%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-24  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    9e-23  31%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-22  36%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    2e-22  30%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-22  31%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-22  31%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-21  33%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-21  33%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-21  36%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-21  40%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-21  32%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-18  28%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-18  28%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    6e-18  35%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    6e-18  35%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-17  35%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    4e-17  34%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-16  33%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    3e-16  33%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-16  33%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-16  31%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    3e-16  34%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    3e-16  31%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    8e-16  37%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-16  31%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    8e-16  31%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    8e-16  31%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  39%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-15  34%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-15  32%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-15  31%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-15  31%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-15  30%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-14  33%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-14  31%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    4e-14  28%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-14  28%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-14  33%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    6e-14  32%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    1e-13  31%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-13  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-13  30%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    4e-13  30%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-12  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-12  31%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  35%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-11  35%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-10  28%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-10  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-10  28%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  28%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  31%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    3e-09  32%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-09  36%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-09  28%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-09  30%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  29%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  27%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-08  27%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  30%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  26%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-08  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-08  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  37%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-08  37%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-07  26%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  27%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    9e-07  30%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-06  30%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    3e-06  31%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-06  46%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-06  46%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-06  46%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  46%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  46%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  31%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    3e-06  31%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-06  31%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-06  31%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    4e-06  32%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-06  32%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-06  31%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKG
2oukB           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKD-
2oljA           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKD-
1b0uA           -LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVKV
3dhwC           MIKLSNITKVFHQGTALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTT---
2it1B           -IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVT----
2it1A           -IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVT----
2yyzA           -IRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVN----
2pcjA           ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYT--
1l2tB           MIKLKNVTKTYGEEIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTN---D
1l2tA           MIKLKNVTKTYGEEIALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTN---D
1g291           -VRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDLVADPEKG
1f3oA           -IKLKNVTKTYKGEYALKNVNLNIKEGEF-VSIGPSGSGKST-LNIIGCLDKPTEGEVYIDNIKTN---D
1q12A           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
3fh6A           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2awoA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2awnB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
3d31A           MIEIESLSRKWK-NFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLD--------G
2r6gB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2r6gA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
1oxvA           ---VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD-RLVASNG
1oxsC           ---VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD-RLVASNG
2d62A           -VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYIEDLVADPEKG
2onkA           ------------------------------VLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADIT----
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFEN------KD
3gfoA           ILKVEELNYNYSGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDY---
1gajA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFEN------KD
1g9xA           ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFEN------KD
1v43A           -VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTY---
3fvqB           -LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSG-----EISLSGKTI
3fvqA           -LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSG-----EISLSGKTI
2awoC           -----------------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2awnC           -----------------KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL-------------------G
1oxxK           ---VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDD-RLVASNG
1z47B           -----------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIG--------G
1z47A           -----------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIG--------G
3g60A           ----------------LKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINV
3g5uA           ----------------LKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINV
1pf4A           ---------------ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVDYK--
1jj7A           --------------LVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDG------KP
2hydA           ---IDHVSFQYNDNEALKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIDFLTG
2ixfC           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLQYDHH
2ixfA           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLQYDHH
1mt0A           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
2ghiA           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLL----------YRFYDAEGDIKKN
2ff7A           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
2ihyA           LIQLDQIGRKQGKTI-LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGT-----VNLFGKPG
2fgkA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
2ffbA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
3b5jA           ----------------LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
2ihyB           LIQLDQIGRKQGKTI-LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGT-----VNLFGKPG
2ixfD           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD--------G
2ixeA           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLQYDHH
1xefA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
2ffaA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL-----
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNG------QD
2ixeD           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLD--------G
2ghiC           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLL----------YRFYDAEGDIKKN
2yz2B           ---------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG--------
2yz2A           ---------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG--------
2ghiD           -VNIEFSDVNFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLL----------YRFYDAEGDIKKN
2ghiB           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLL----------YRFYDAEGDIKKN
2ixgA           ----------------LQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLQYDHH
1vplA           ---VKDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSG------IVTVFGKN
1mv5D           ----------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPID----
1mv5A           ----------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPID----
2awnA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2pzfA           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMMGELEPSESGRISFCSQFSWIMPG
3bk7A           -------------------------------IVGPNGIGKTTFVKMLAGVEEPTEGKVEWD-LTVAYKPQ
1yqtA           -------------------------------IVGPNGIGKTTFVK-LAGVEEPTEGKIEWD---------
2pzgA           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RISFCSQ
2pzfB           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMMGELEPSESGRISFCSQFSWIMPG
2pzeA           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RISFCSQ
2pzeB           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RISFCSQ
2pjzA           MIQLKNVGITLSGKFSLENINLEV-NGEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFING--------
2nq2C           -------------NFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGK-------------
2nq2D           -----------------------FDLNKGDILLGQNGCGKSTLLDLLLGIHRPIQGK-------------
2pzgB           ---MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK-------------
2bbsA           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQNSWIMPG
2bbtA           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQNSWIMPG
1xmiE           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQFSWIMPG
1xmiC           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQFSWIMPG
1xmiB           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK-------------
1xmiA           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQFSWIMPG
2d2eA           -LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTL------------GKILAGDPEYTVERG
1xmiD           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK-------------
1xfaA           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1xf9D           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1xf9C           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1xf9B           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1xf9A           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
2bbsB           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQNSWIMPG
1r10A           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0zD           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0zC           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0zB           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0zA           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0xD           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0xC           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0xB           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0xA           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0wC           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0wB           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1r0wA           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1q3hD           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1q3hC           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1q3hB           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
1q3hA           ------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLLGELEASESGRVSFCSQFSWIMPG
2d2fA           -LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTL------------GKILAGDPEYTVERG
1xmjA           ---MENVT-AFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMMGELEPSESGRISFCSQFSWIMPG
2bbtB           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIGELEPSESGRISFCSQNSWIMPG
2awoD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2awnD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN----
2bboA           ------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-RISFCSQ
1sgwA           ----------------LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKG
3b60A           -LEFRNVTFTYPGREALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL-----
2iwhB           ----------------------------------------------------------------------
1z2rA           -----NVTFTYPGREALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL-----
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQ
2oukB           ---TNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDS
2oljA           ---TNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDS
1b0uA           ADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGYPVH
3dhwC           LSESELTKARRQIGMIFQHFNLLSSRTVFGNVAL-PLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSN
2it1B           ----ELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQ
2it1A           ----ELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQ
2yyzA           ----DIPPKYREVGMVFQNYALYPHMTVFENIAF-PLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQ
2pcjA           -NEKELSLLRRKLGFVFQFHYLIPELTALENVIV-PMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYE
1l2tB           LDDDELTKIRRDKGFVFQQFNLIPLLTALENV-ELPL-IFKYSGEERRKRALECLKMAELEERANHKPNQ
1l2tA           LDDDELTKIRRDKGFVFQQFNLIPLLTALENV-ELPL-IFKYSGEERRKRALECLKMAELEERANHKPNQ
1g291           IF---VPPKDRDIAMVFQSYALYPHMTVYDNIAF-PLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRE
1f3oA           LDDDELTKIRRDKGFVFQQFNLIPLLTALENV-ELPL-IFKASGEERRKRALECLKAELEERFANHKPNQ
1q12A           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
3fh6A           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2awoA           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2awnB           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
3d31A           KDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFG----MRMKKIKDPKRVLDTARDLKIEHLLDRNPLT
2r6gB           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2r6gA           ----DTPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
1oxvA           --KLIVPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRE
1oxsC           --KLIVPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRE
2d62A           V----FVPPKERDVAVFQSYALYPH-TVYDN-IAFPLKLRKVPKQEIDKRVRE-VAELGLTELLNRKPRE
2onkA           ----PLPPERRGIGFVPQDYALFPHLSVYRNIAYG---LXXXXXXXXXXXXXXMAEKLGIAHLLDRKPAR
1g6hA           ITNKEPAELHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAGE
3gfoA           -SRKGIMKLRESIGIVFQDPNQLFSASVYQDVSFGAVN-MKLPEDEIRKRVDNALKRTGIEHLKDKPTHC
1gajA           ITNKEPAELHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAGE
1g9xA           ITNKEPAELHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAGE
1v43A           LPPKD-----RNISMVFQ------HMTVYENIAFPLKKFPKDEIDKRVRWAAELLQ---IEELLNRYPAQ
3fvqB           FSKNTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPHE
3fvqA           FSKNTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPHE
2awoC           ----DTPPAERGVGMVA----LYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
2awnC           VG------------MVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKA
1oxxK           --KLIVPPEDRKIGMVFQTWALYPNLTAFEN-IAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRE
1z47B           KRVTDLPPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANRFPHE
1z47A           KRVTDLPPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANRFPHE
3g60A           RYLREIIGVVSQEPVLFAT-------TIAENIRYGREDVTMDEIEKAVKEAYDFIMKLPLVGERGA---Q
3g5uA           RYLREIIGVVSQEPVLFAT-------TIAENIRYGREDVTMDEIEKAVKEAYDFIMKLPLVGERGA---Q
1pf4A           -----LTNLRRHFALVSQNVHLFND-TIANNIAEG--EYTREQIEQAARQAHEFIENMGLDTVIGENGTS
1jj7A           LPQYEHRYLHRQVAAVGQEPQVFGR-SLQENIAYGLTQTMEEITAAAVKSAHSFISGLGYDTEVDEAGSQ
2hydA           -------SLRNQIGLVQQDNILFSD-TVKENILLGRPTATDEEVVEAAKNAHDFIMNLGYDTEVGERGVK
2ixfC           YLHTQVAAVGQEPLLFGRSFR--------ENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
2ixfA           YLHTQVAAVGQEPLLFGRSFR--------ENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
1mt0A           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
2ghiA           VNKYNRNSIRSIIGIVPQDTILFNE-TIKYNILYGKLDATDEEVIKATKSAYDFIE--ALPKKWDTIVMK
2ff7A           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
2ihyA           YSAETVRQ-----HIGFVSHSLLEKFQEGERVIDVVISGAIDDE--IRNEAHQLLKLVGSA-KAQQYIGY
2fgkA           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
2ffbA           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
3b5jA           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
2ihyB           -------KVGYSAETVRQHIGFVSH-SLLEKFQEGEIGVYQDIDDEIRNEAHQLLKLVGSA-KAQQYIGY
2ixfD           EPLVQYDHHYLHTQVAAVGQLLFGR-SFRENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
2ixeA           YLHTQVAAVGQEPLLFGRSFR--------ENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
1xefA           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
2ffaA           -ALADPNWLRRQVGVVLQD-NVLLNRSIIDNILANPMSVEKVIYAAKLAGAHDFISELGYNTIVGEQGAG
1ji0A           ITNKPAHVINRGIALVPEGRRIFPELTVYENL--GAYN--RKDKE-GIKRDLEWIFSLRLKERLKQLGGT
2ixeD           EPLVQYDHHYLHTQVAAVGPLLFGR-SFRENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
2ghiC           VNKYNRNSIRSIIGIVPQDTILFNE-TIKYNILYGKLDATEEVKATKSAQLYDFIE--ALPKKWDTIVGG
2yz2B           -ERKKGYEIRRNIGIAFQ----YPEDQFFERVFDEVAFAVKNDPVPLVKKAMEF---VGLDFDSDRVPFF
2yz2A           -ERKKGYEIRRNIGIAFQ----YPEDQFFERVFDEVAFAVKNDPVPLVKKAMEF---VGLDFDSDRVPFF
2ghiD           VNKYNRNSIRSIIGIVPQDTILFNE-TIKYNILYGKLDATDEEVIKATKSAQ-------LYDFIEALPKK
2ghiB           VNKYNRNSIRSIIGIVPQDTILFNE-TIKYNILYGKLDATDEEVIKATKSAYDFIEALPKKDTIVGNKMK
2ixgA           YLHTQVAAVGQEPLLFGRSFR--------ENIAYGLTRTPTMEEITA------VAMESGAHDFISGFPQQ
1vplA           VVE-EPHEVRKEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIA-------GLGEKIKDRVST
1mv5D           --NISLENWRSQIGFVSQDSAIMAG-TIRENLTYGL------EGDYTDEDLWQVLDLAFARSFVENMPDQ
1mv5A           --NISLENWRSQIGFVSQDSAIMAG-TIRENLTYGL------EGDYTDEDLWQVLDLAFARSFVENMPDQ
2awnA           ----DTPPAERGVGMVFQSYAL----------------------EVINQRVNQV----------------
2pzfA           TIKENIIGV---------SYDEYRYRSVIK------ACQLEEDISKFAEKDNIVLGEGGIT---------
3bk7A           YIKAEY---------------------------EGTVYELKIDSSKLNSNFYELLKPLGIIDLYDRNVED
1yqtA           ------LTVAYKPQYIKADY-------------EGTVYELKIDASKLNSNFYELLKPLGIIDLYDREVNE
2pzgA           FSW--IMPGTIKENIIFGSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
2pzfB           TIKENIIGV---------SYDEYRYRSVIK------ACQLEEDISKFAEKDNIVLGEGGIT---------
2pzeA           FSW--IMPGTIKENIIFGSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
2pzeB           FSW--IMPGTIKENIIFGSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
2pjzA           ------MEVRKIRNYIRYSTNL-PEAYEIGVTVNDIVYLYEELKGLDRDLFLEMLKALKLGEELRRKLYK
2nq2C           ------IEVYQSIGFVPQFFSSPFAYSVLDIVLMGRINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTS
2nq2D           ------IEVYQSIGFVPQFFSSPFAYSVLDIVLMGRINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTS
2pzgB           --------IKHSGRISFSQFSWIMPGTIKENIIFGVSY--DEYRYRSVIKACQLEEDISKFAEKDVLGIT
2bbsA           TIKENIIGV---------SYDEYRYRSVIKAC------QLEEDISK-------------FAEKDNIVLIT
2bbtA           TIKENIIGV---------SYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGGI-----------T
1xmiE           TIKENII--------AGVSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
1xmiC           TIKENII--------AGVSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
1xmiB           --------IKHSGRISFSQFSWIMPGTIKENIIAGVSY--------DEYRYRSVIKACQLEEDISKIVLT
1xmiA           TIKENII--------AGVSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
2d2eA           LDGENILELRKGLFLAFQ-YPVVPGVTI-ANFLRLALQA-KLGREVGVAEFWTKVKKLELLDWDESYSRY
1xmiD           --------IKHSGRISFSQFSWIMPGTIKENIIAGVSY--DEYRYRSVIKACQLISKFAEKDNIVLGEIT
1xfaA           TIKENIIRG--------VSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1xf9D           TIKENIISG--------VSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1xf9C           TIKENIISG--------VSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1xf9B           TIKENIISG--------VSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1xf9A           TIKENIISG--------VSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
2bbsB           TIKENIIGV---------SYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGGI-----------T
1r10A           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0zD           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0zC           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0zB           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0zA           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0xD           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0xC           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0xB           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0xA           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0wC           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0wB           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1r0wA           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1q3hD           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1q3hC           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1q3hB           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
1q3hA           TIKENII--------FGVSYDEYRYKSVVKAC------QLQQDITKFAEQDNTVLGEGGVT---------
2d2fA           LDGENILELRKGLFLAFQYPVEVPGVTIA-NFLRLALQA-KLGREVGVAEFWTKVKKLELLDWDESYLSR
1xmjA           TIKENIIGV---------SYDEYRYRSVIK------ACQLEEDISKFAEKDNIVLGEGGIT---------
2bbtB           TIKENIIGV---------SYDEYRYRSVIKAC------QLEEDISKFAEKDNIVL---GIT---------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2bboA           FSW--IMPGTIKENIIFGSYDEYRYRSVIKAC------QLEEDISKFAEKDNIVLGEGGIT---------
1sgwA           ----KIFFLPEEI-IVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKKKLG----------E
3b60A           -REYTLASLRNQVALVSQNVHLF-NDTVANNIAYARTEYSREQIEEAARMAYDFINKMGLDTIIGENGVL
2iwhB           ----------------------------------------------------------------------
1z2rA           -REYTLASLRNQVALVSQNVHLF-NDTVANNIAYARTEYSREQIEEAARMAYDFINKMGLDTIIGENGVL
2vf8B           --------------------------------------------ESAIFRALDTLREVGLGYLRLGQPAE
2vf8A           --------------------------------------------ESAIFRALDTLREVGLGYLRLGQPAE
2vf7C           --------------------------------------------ESAIFRALDTLREVGLGYLRLGQPAE
2vf7B           --------------------------------------------ESAIFRALDTLREVGLGYLRLGQPAE
2vf7A           --------------------------------------------ESAIFRALDTLREVGLGYLRLGQPAE
2ix3A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2r6fB           ----------RETEVTYKGKNIAEVLDTVEDALDFFASIPK------IKRKLETLYDVGLGYKLGQPATT
2r6fA           ----------RETEVTYKGKNIAEVLDTVEDALDFFASIPK------IKRKLETLYDVGLGYKLGQPATT
2cbzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSGGQAQRVAIARSLAMNPRYILLDEPTSALDPXXXXXXXXXXXXXXXXXXSLIIVTHNLAFAQKVADKI
2oukB           LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRV
2oljA           LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRV
1b0uA           LSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHV
3dhwC           LSGGQKQRVAIARALASNPKVLLCDEATSALDPTTRSILELLKDINRRLGLTILLITHEMDVVKRICDCV
2it1B           LSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRI
2it1A           LSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRI
2yyzA           LSGGQQQRVALARALVKQPKVLLFDEPLSNLDALRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRI
2pcjA           LSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAE-LTHRT
1l2tB           LSGGQQQRVAIARALANNPPIILADQPTGALDKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-RFGERI
1l2tA           LSGGQQQRVAIARALANNPPIILADQPTGALDKTGEKIMQLLKKLNEEDGKTVVVVTHDINVA-RFGERI
1g291           LSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRI
1f3oA           LSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHDINVA-RFGERI
1q12A           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
3fh6A           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2awoA           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2awnB           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
3d31A           LSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLITHDQTEARIMADRI
2r6gB           LSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2r6gA           LSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
1oxvA           LSGGQQQRVALARALVKDPSLLLLDEPFSNLDAMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-
1oxsC           LSGGQQQRVALARALVKDPSLLLLDEPFSNLDAMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-
2d62A           LSGGQRQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQ--VEATGDRI
2onkA           LSGGERQRVALARALVIQPRLLLLDEPLSAVDKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEV
1g6hA           LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHL
3gfoA           LSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDP-------------------------------------
1gajA           LSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHL
1g9xA           LSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHL
1v43A           LSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRI
3fvqB           LSGGXXXXXXXXXXXXPDPELILLDEPFSALDQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRI
3fvqA           LSGGXXXXXXXXXXXXPDPELILLDEPFSALDQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRI
2awoC           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2awnC           LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
1oxxK           LSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDAMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-
1z47B           LSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRV
1z47A           LSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRV
3g60A           LSGGQKQRIAIARALVRNPKILLLDEATSALD-TESEAVVQAALDKAREGRTTIVIAHRLSTVRN-ADVI
3g5uA           LSGGQKQRIAIARALVRNPKILLLDEATSALD-TESEAVVQAALDKAREGRTTIVIAHRLSTVRN-ADVI
1pf4A           LSGGQRQRVAIARALLRDAPVLILDEATSALD-TESERAIQAALDELQKNKTVLVIAHRLSTIEQ-ADEI
1jj7A           LSGGQRQAVALARALIRKPCVLILDDATSALDASQLQVEQLLYESPERYSRSVLLITQHLSLVEQ-ADHI
2hydA           LSGGQKQRLSIARIFLNNPPILILDEATSALD-LESESIIQEALDVLSKDRTTLIVAHRLSTITH-ADKI
2ixfC           LSGGQRQAVALARALIRKPRLLILDQATSALDANQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHI
2ixfA           LSGGQRQAVALARALIRKPRLLILDQATSALDANQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHI
1mt0A           LSGGQRQRIAIARALVNNPKILIFDEATSALD-YESEHVIMRNMHKICKGRTVIIIAHRLS-TVKNADRI
2ghiA           LSGGERQRIAIARCLLKDPKIVIFDEATSSLD-SKTEYLFQKAVEDLRKNRTLIIIAHRLSTISS-AESI
2ff7A           LSGGQRQRIAIARALVNNPKILIFDEATSALD-YESEHVIMRNMHKICKGRTVIIIAHRLS-TVKNADRI
2ihyA           LSTGEKQRV-IARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSKI
2fgkA           LSGGQRQRIAIARALVNNPKILIFDQATSALD-YESEHVIMRNMHKICKGRTVIIIAHRLS-TVKNADRI
2ffbA           LSGGQRQRIAIARALVNNPKILIFDQATSALD-YESEHVIMRNMHKICKGRTVIIIAHRLS-TVKNADRI
3b5jA           LSGGQRQRIAIARALVNNPKILIFDEATSALD-YESEHVIMRNMHKICKGRTVIIIAHRLS-TVKNADRI
2ihyB           LSTGEKQRV-IARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSKI
2ixfD           LSGGQRQAVALARALIRKPRLLILDQATSALDANQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHI
2ixeA           LSGGQRQAVALARALIRKPRLLILDNATSALDANQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHI
1xefA           LSGGQRQRIAIARALVNNPKILIFDEATSALD-YESEHVIMRNMHKICKGRTVIIIAARLS-TVKNADRI
2ffaA           LSGGQRQRIAIARALVNNPKILIFDEATSALD-YESEHVIMRNMHKICKGRTVIIIAARLS-TVKNADRI
1ji0A           LSGGE-QQLAIGRALS---RPKLLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYG
2ixeD           LSGGQRQAVALARALIRKPRLLILDNATSALDANQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHI
2ghiC           MKLGERQRIAIARCLLKDPKIVIFDEATSSLD-SKTEYLFQKAVEDLRKNRTLIIIAHRLSTISS-AESI
2yz2B           LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRV
2yz2A           LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRV
2ghiD           LSGGERQRIAIARCLLKDPKIVIFDDSKT----------EYLFQKAVEDNRTLIIIAHRLSTISS-AESI
2ghiB           LSGGERQRIAIARCLLKDPKIVIFDEATS---DSKTEYLFQKAVEDLRKNRTLIIIAHRTISS---AESI
2ixgA           LAVGQRQAVALARALIRKPRLLILDNATSALDANQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHI
1vplA           YSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRI
1mv5D           LSGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI-AHRLSTIVD-ADKI
1mv5A           LSGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVI-AHRLSTIVD-ADKI
2awnA           -----AEVLAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKI
2pzfA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
3bk7A           LSGGELQRVAIAATLLRDADIYLLDEPSAYLDEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRL
1yqtA           LSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV-LIDYVSDRL
2pzgA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2pzfB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2pzeA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2pzeB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2pjzA           LSAGQSVLVRTSLALASQPEIVGLDEPFENVD--------------------------------------
2nq2C           LSGGQRQLILIARAIASECKLILLDEPTSALD--------------------------------------
2nq2D           LSGGQRQLILIARAIASECKLILLDEPTSALD--------------------------------------
2pzgB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2bbsA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2bbtA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1xmiE           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1xmiC           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1xmiB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1xmiA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2d2eA           LNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIPDKV
1xmiD           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1xfaA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1xf9D           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1xf9C           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1xf9B           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1xf9A           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
2bbsB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1r10A           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0zD           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0zC           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0zB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0zA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0xD           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0xC           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0xB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0xA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0wC           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0wB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1r0wA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1q3hD           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1q3hC           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1q3hB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
1q3hA           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKI
2d2fA           FSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIPDKV
1xmjA           LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2bbtB           LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2bboA           LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKI
1sgwA           LSQGTIRRVQLASTLLVNAEIYVLDDPVVAID--------------------------------------
3b60A           LSXXXXXXXXXXXXXXXDSPILILDEATSALD--------------------------------------
2iwhB           LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEV
1z2rA           LSXXXXXXXXXXXXXXXDSPILILDEATSALD--------------------------------------
2vf8B           LSGGEAQRIKLATELRRSGRVYVLDEPTTGLHP-------------------------------------
2vf8A           LSGGEAQRIKLATELRRSGRVYVLDEPTTGLHP-------------------------------------
2vf7C           LSGGEAQRIKLATELRRSGRVYVLDEPTTGLHP-------------------------------------
2vf7B           LSGGEAQRIKLATELRRSGRVYVLDEPTTGLHP-------------------------------------
2vf7A           LSGGEAQRIKLATELRRSGRVYVLDEPTTGLHP-------------------------------------
2ix3A           LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEV
2ix8A           LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEV
2iw3B           LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEV
2iw3A           LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEV
2r6fB           LSGGEAQRVKLAAELRSNGRTLILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI-KTADYI
2r6fA           LSGGEAQRVKLAAELRSNGRTLILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI-KTADYI
2cbzA           LSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQV-DVI


                         .         .         .         +         .         .         .:280
query           LFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLSNLD
2oukB           LFMDGGYIIEEGPEDLFDRPQHERTKAFLS--------
2oljA           LFMDGGYIIEEGPEDLFDRPQHERTKAFLS--------
1b0uA           IFLHQGKIEEEGPEQVFGNPQSPRLQQFL---------
3dhwC           AVISNGELIEQDTVSEVFS-------------------
2it1B           AVIREGEILQVGTPDEVY--------------------
2it1A           AVIREGEILQVGTPDEVY--------------------
2yyzA           AVFNQGKLVQYGTPDEVYDSP----KNMFVASFIGN--
2pcjA           LEMKDGKVV-----------------------------
1l2tB           IYLKDGEV------------------------------
1l2tA           IYLKDGEV------------------------------
1g291           AVMNRGVLQQVGSPDEVYDKPNTFVAGFIGSPPMNFLD
1f3oA           IYLKDGEV------------------------------
1q12A           VVLDAGRVLYHYPADRF---------------------
3fh6A           VVLDAGRVLYHYPADRF---------------------
2awoA           VVLDAGRVLYHYPADRF---------------------
2awnB           VVLDAGRVLYHYPADRF---------------------
3d31A           AVVMDGKLIQVGKPEEIFEKPVERVASFV---------
2r6gB           VVLDAGRVLYHYPADRF---------------------
2r6gA           VVLDAGRVLYHYPADRF---------------------
1oxvA           --------------------------------------
1oxsC           --------------------------------------
2d62A           A-VNKGELQQVGTPDEYYKPVNTFVAGFIGS-------
2onkA           AVMLNGRIVEKGKLKELFSAKNGEVAEFLSARNL----
1g6hA           YVMFNGQIIAEG-------RGEEEIKNVLS--------
3gfoA           --------------------------------------
1gajA           YVMFNGQIIAEG-------RGEEEIKNVLS--------
1g9xA           YVMFNGQIIAEG-------RGEEEIKNVLS--------
1v43A           AVMNRGQLLQIGPTEVYLRPNSVFVATFIGAPEMNILE
3fvqB           AVMKQGRIL-----------------------------
3fvqA           AVMKQGRIL-----------------------------
2awoC           VVLDAGRVLYHYPADRF---------------------
2awnC           VVLDAGRVLYHYPADRF---------------------
1oxxK           --------------------------------------
1z47B           LVLHEGNVEQFGTPEEVY--------------------
1z47A           LVLHEGNVEQFGTPEEVY--------------------
3g60A           AGFDGGVIVEQGNHDE----------------------
3g5uA           AGFDGGVIVEQGNHDE----------------------
1pf4A           LVVDEGEIIERGRHAD----------------------
1jj7A           LFLEGGAI------------------------------
2hydA           VVIENGHIVETG--------------------------
2ixfC           LFLKEGSVCEQG--------------------------
2ixfA           LFLKEGSVCEQG--------------------------
1mt0A           IVMEKGKIVEQG--------------------------
2ghiA           ILLNKGKIVEKGTHKDLLKLNGE---------------
2ff7A           IVMEKGKIVEQG--------------------------
2ihyA           LLLKDGQSIQQGAVEDILTSENSR--------------
2fgkA           IVMEKGKIVEQG--------------------------
2ffbA           IVMEKGKIVEQG--------------------------
3b5jA           IVMEKGKIVEQG--------------------------
2ihyB           LLLKDGQSIQQGAVEDILTSENSR--------------
2ixfD           LFLKEGSVCEQG--------------------------
2ixeA           LFLKEGSVCEQG--------------------------
1xefA           IVMEKGKIVEQG--------------------------
2ffaA           IVMEKGKIVEQG--------------------------
1ji0A           YVLETGQIVLEGKASELL--DNEVRKAYL---------
2ixeD           LFLKEGSVCEQG--------------------------
2ghiC           ILLNKGKIVEKGTHKDLLKLNGE---------------
2yz2B           VVLEKGKKVFDGTRMEFLEKYDPR--------------
2yz2A           VVLEKGKKVFDGTRMEFLEKYDPR--------------
2ghiD           ILLNKGKIVEKGTHKDLLKLNGE---------------
2ghiB           ILLNKGKIVEKGTHKDLLKLNGE---------------
2ixgA           LFLKEGSVCEQG--------------------------
1vplA           ALIHNGTIVETGTVEE----------------------
1mv5D           YFIEKGQITGSGKHNE----------------------
1mv5A           YFIEKGQITGSGKHNE----------------------
2awnA           VVLDAGRVLYHYPADRF---------------------
2pzfA           LILHEGSSYFYGTFSELQNLD-----------------
3bk7A           IVFE----------------------------------
1yqtA           VF------------------------------------
2pzgA           LILHEGSSYFYGTFSELQNPD-----------------
2pzfB           LILHEGSSYFYGTFSELQN-------------------
2pzeA           LILHEGSSYFYGTFSELQNLD-----------------
2pzeB           LILHEGSSYFYGTFSELQN-------------------
2pjzA           --------------------------------------
2nq2C           --------------------------------------
2nq2D           --------------------------------------
2pzgB           LILHEGSSYFYGTFSELQN-------------------
2bbsA           LILHEGSSYFYGTFSELQN-------------------
2bbtA           LILHEGSSYFYGTFSELQN-------------------
1xmiE           LILHEGSSYFYGTFSELQN-------------------
1xmiC           LILHEGSSYFYGTFSELQN-------------------
1xmiB           LILHEGSSYFYGTFSELQN-------------------
1xmiA           LILHEGSSYFYGTFSELQN-------------------
2d2eA           HVMMDGRVVATG--------------------------
1xmiD           LILHEGSSYFYGTFSELQN-------------------
1xfaA           LILHQGSSYFYG--------------------------
1xf9D           LILHQGSSYFYG--------------------------
1xf9C           LILHQGSSYFYG--------------------------
1xf9B           LILHQGSSYFYG--------------------------
1xf9A           LILHQGSSYFYG--------------------------
2bbsB           LILHEGSSYFYGTFSELQN-------------------
1r10A           LILHQGSSYFYG--------------------------
1r0zD           LILHQGSSYFYG--------------------------
1r0zC           LILHQGSSYFYG--------------------------
1r0zB           LILHQGSSYFYG--------------------------
1r0zA           LILHQGSSYFYG--------------------------
1r0xD           LILHQGSSYFYG--------------------------
1r0xC           LILHQGSSYFYG--------------------------
1r0xB           LILHQGSSYFYG--------------------------
1r0xA           LILHQGSSYFYG--------------------------
1r0wC           LILHQGSSYFYG--------------------------
1r0wB           LILHQGSSYFYG--------------------------
1r0wA           LILHQGSSYFYG--------------------------
1q3hD           LILHQGSSYFYG--------------------------
1q3hC           LILHQGSSYFYG--------------------------
1q3hB           LILHQGSSYFYG--------------------------
1q3hA           LILHQGSSYFYG--------------------------
2d2fA           HVMMDGRVVATG--------------------------
1xmjA           LILHEGSSYFYGTFSELQN-------------------
2bbtB           LILHEGSSYFYGTFSELQN-------------------
2awoD           --------------------------------------
2awnD           --------------------------------------
2bboA           LILHEGSSYFYGTFSELQN-------------------
1sgwA           --------------------------------------
3b60A           --------------------------------------
2iwhB           WAVKDGRMTPSG--------------------------
1z2rA           --------------------------------------
2vf8B           --------------------------------------
2vf8A           --------------------------------------
2vf7C           --------------------------------------
2vf7B           --------------------------------------
2vf7A           --------------------------------------
2ix3A           WAVKDGRM------------------------------
2ix8A           WAVKDGR-------------------------------
2iw3B           WAVKDGR-------------------------------
2iw3A           WAVKDGR-------------------------------
2r6fB           I-------------------------------------
2r6fA           I-------------------------------------
2cbzA           IVMSGGKISEMGSYQELLARD-----------------