[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00428.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA.bssp"

## Summary of PDB Search
:231
    9e-08  24%  3dhwA  [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
:231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxLISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFYVWLFRSTPLL
3dhwA           -----------LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVVNIFRSIPFI


                         .         .         *         .         .         .         .:140
query           VQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAAITSIPKGQWEAAASIGMTHK
3dhwA           I---LLVWMIPFTRVIVGTSIGLQ-----AAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPM


                         +         .         .         .         .         *         .:210
query           QALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           QIVRKVLLPEA----LPGLVN-----------AATITLITL-----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxx
3dhwA           ---------------------