[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00433.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ct6B.bssp"
#ERROR : Can't open dsspfile "3ct6A.bssp"
#ERROR : Can't open dsspfile "3cr3C.bssp"
#ERROR : Can't open dsspfile "3b48D.bssp"
#ERROR : Can't open dsspfile "3b48F.bssp"
#ERROR : Can't open dsspfile "3b48E.bssp"
#ERROR : Can't open dsspfile "3b48C.bssp"
#ERROR : Can't open dsspfile "3b48B.bssp"
#ERROR : Can't open dsspfile "3b48A.bssp"

## Summary of PDB Search
:122
    6e-36  52%  3ct6B  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    6e-36  52%  3ct6A  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    2e-29  52%  3cr3C  [x.x.x] PTS-DEPENDENT DIHYDROXYACETONE KINASE,
    5e-08  38%  3b48D  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-08  40%  3b48F  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-08  40%  3b48E  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-08  40%  3b48C  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-08  40%  3b48B  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-07  46%  3b48A  [x.x.x] UNCHARACTERIZED PROTEIN
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
3ct6B           MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSA
3ct6A           MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSA
3cr3C           ---GIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRV-NAIEENEADNLLTFFDLGSA
3b48D           -----------------------------------------------KIIDTINEADDREFLIFADLGSA
3b48F           -----------------------------------------------KIIDTINEADSDEFLIFADLGSA
3b48E           -----------------------------------------------KIIDTINEADSDEFLIFADLGSA
3b48C           -----------------------------------------------KIIDTINEADSDEFLIFADLGSA
3b48B           -----------------------------------------------KIIDTINEADSDEFLIFADLGSA
3b48A           -----------------------------------------------KIIDTINEADSDEFLIFADLGSA


                         .         .         *         .         .         .         .:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLKIK
3ct6B           RMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIE
3ct6A           RMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIE
3cr3C           R-NLDLVSE-TDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKL---
3b48D           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48F           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48E           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48C           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48B           VLSSELAFDLEEKHYHLVDAPLVEGAFASAITAGVSDDLTQI----------
3b48A           VLSSELAFDLEEKHYHLVDAPLVEGAFASA--ITAGSD--------------