[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3a1dB.bssp"
#ERROR : Can't open dsspfile "3a1cB.bssp"
#ERROR : Can't open dsspfile "3a1dA.bssp"
#ERROR : Can't open dsspfile "3a1eB.bssp"
#ERROR : Can't open dsspfile "3a1cA.bssp"
#ERROR : Can't open dsspfile "3a1eA.bssp"
#ERROR : Can't open dsspfile "2b8eC.bssp"
#ERROR : Can't open dsspfile "2b8eA.bssp"
#ERROR : Can't open dsspfile "2b8eB.bssp"
#ERROR : Can't open dsspfile "2iyeA.bssp"
#ERROR : Can't open dsspfile "3b8cA.bssp"
#ERROR : Can't open dsspfile "2hc8A.bssp"
#ERROR : Can't open dsspfile "1mhsA.bssp"
#ERROR : Can't open dsspfile "2voyI.bssp"
#ERROR : Can't open dsspfile "2kijA.bssp"
#ERROR : Can't open dsspfile "2zxeA.bssp"
#ERROR : Can't open dsspfile "3b8eA.bssp"
#ERROR : Can't open dsspfile "2voyJ.bssp"
#ERROR : Can't open dsspfile "1su4A.bssp"
#ERROR : Can't open dsspfile "2oa0A.bssp"
#ERROR : Can't open dsspfile "2o9jA.bssp"
#ERROR : Can't open dsspfile "3ba6A.bssp"
#ERROR : Can't open dsspfile "3e81A.bssp"

## Summary of PDB Search
:643
    3e-46  45%  3a1dB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    3e-46  45%  3a1cB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    1e-45  45%  3a1dA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    2e-45  45%  3a1eB  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    4e-45  44%  3a1cA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    9e-45  44%  3a1eA  [x.x.x] PROBABLE COPPER-EXPORTING P-TYPE ATPASE A
    5e-36  44%  2b8eC  [x.x.x] CATION-TRANSPORTING ATPASE
    7e-34  43%  2b8eA  [x.x.x] CATION-TRANSPORTING ATPASE
    6e-33  43%  2b8eB  [x.x.x] CATION-TRANSPORTING ATPASE
    9e-27  36%  2iyeA  [x.x.x] COPPER-TRANSPORTING ATPASE
    2e-15  24%  3b8cA  [x.x.x] ATPASE 2, PLASMA MEMBRANE-TYPE
    6e-15  35%  2hc8A  [x.x.x] CATION-TRANSPORTING ATPASE, P-TYPE
    8e-14  23%  1mhsA  [i.18.1] PLASMA MEMBRANE ATPASE
    3e-13  42%  2voyI  [x.x.x] CATION-TRANSPORTING ATPASE
    1e-11  38%  2kijA  [x.x.x] COPPER-TRANSPORTING ATPASE 1
    1e-10  30%  2zxeA  [x.x.x] NA, K-ATPASE ALPHA SUBUNIT
    6e-10  30%  3b8eA  [x.x.x] SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT
    4e-08  40%  2voyJ  [x.x.x] CATION-TRANSPORTING ATPASE
    4e-06  28%  1su4A  [f.33.1 - b.82.7 - c.108.1 - d.220.1]
    4e-06  26%  2oa0A  [x.x.x] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM
    4e-06  27%  2o9jA  [x.x.x] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM
    4e-06  28%  3ba6A  [x.x.x] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM
    7e-05  36%  3e81A  [x.x.x] ACYLNEURAMINATE CYTIDYLYLTRANSFERASE
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3a1dB           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3a1dA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2iyeA           ----------------------------------------------------------------------
3b8cA           ----------------------------------------------------------------------
2hc8A           ----------------------------------------------------------------------
1mhsA           ----------------------------------------------------------------------
2voyI           ----------------------------------------------------------------------
2kijA           ----------------------------------------------------------------------
2zxeA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
2voyJ           ----------------------------------------------------------------------
1su4A           ----------------------------------------------------------------------
2oa0A           ----------------------------------------------------------------------
2o9jA           ----------------------------------------------------------------------
3ba6A           ----------------------------------------------------------------------
3e81A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
3a1dB           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3a1dA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2iyeA           ----------------------------------------------------------------------
3b8cA           ---------------------------------------------------------DGKWSEQEAAILV
2hc8A           ---------------------------------------EAIKKLVGLQAKTAVVIRDGKEIAVPVEEVA
1mhsA           ---------------------------------------------------------DGTLKEIEAPEVV
2voyI           ----------------------------------------------------------------------
2kijA           -------------------------------------------------------------EQVDVELVQ
2zxeA           -------------------------------------SSRIMDSFKNMVPQQALVIRDGEKSTINAEFVV
3b8eA           -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
2voyJ           ----------------------------------------------------------------------
1su4A           ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
2oa0A           ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
2o9jA           ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
3ba6A           ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
3e81A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
3a1dB           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3a1dA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2iyeA           ----------------------------------------------------------------------
3b8cA           PGDIVSIKLGDIIPADALLEGDPLKVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFF
2hc8A           VGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPVLKSKGDEVFGATINNTGVLKIRATRVGGETLL
1mhsA           PGDILQVEEGTIIPADGRIVTDDAFLQVSALTGESLAVDKHKGDQVFASSAVKRGEAFVVITATGDNTFV
2voyI           ----------------------------------------------------------------------
2kijA           RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTL
2zxeA           AGDLVEVKGGDRIPADRIISAHGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGVVVYTG--DRTV
3b8eA           VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
2voyJ           ----------------------------------------------------------------------
1su4A           PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKALGI-VATTGVSTEI
2oa0A           PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKALGI-VATTGVSTEI
2o9jA           PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKALGI-VATTGVSTEI
3ba6A           PGDIVEVAVGDKVPADLSIKSTTLRVDQSILTGESDPRAVNQDNMLFSGTIAAGKALGI-VATTGVSTEI
3e81A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
3a1dB           ----------------------------------------------------------------------
3a1cB           ----------------------------------------------------------------------
3a1dA           ----------------------------------------------------------------------
3a1eB           ----------------------------------------------------------------------
3a1cA           ----------------------------------------------------------------------
3a1eA           ----------------------------------------------------------------------
2b8eC           ----------------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
2b8eB           ----------------------------------------------------------------------
2iyeA           ----------------------------------------------------------------------
3b8cA           GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAIGMVIEIIVMYPIQRRKYRLLVLLIGGIPIAM
2hc8A           AQIVKLVEDA------------------------------------------------------------
1mhsA           GRAAALV-NAASGGSGHFTEVLNXXXXXXXXXXXXXXXXXWVSSFYRSNPIVQILEFTLAITIIGVPVGL
2voyI           ----------------------------------------------------------------------
2kijA           SQIVKLVEEA------------------------------------------------------------
2zxeA           MRIATLASGLEVGRTPXXXXXXXXXXXXTGVAVFLGVSFF-ILSLILGYS---WL-EAVIFLVANVPEGX
3b8eA           MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
2voyJ           ----------------------------------------------------------------------
1su4A           GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWIRGAIYYAVALAVAAIPEGL
2oa0A           GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINHGGSWIRGAIYYFKIAVALAVAAPEGL
2o9jA           GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAV------WLINRGAIYYFKIAVALAVAAPEGL
3ba6A           GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWIRGAIYYAVALAVAAIPEGL
3e81A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
3a1dB           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1cB           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1dA           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1eB           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1cA           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
3a1eA           ------------------GILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2b8eC           ---------------------------LEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2b8eA           ---------------------------LEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2b8eB           -----------------------------------AVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
2iyeA           ------------------GMIIKNSNVYEKIKEIDTIIFDKTGTLTYGTPIVTQFI-GDSLS----LAYA
3b8cA           PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVCKGVEKDQVLLFA
2hc8A           ----------------------------------------------------------------------
1mhsA           PXXXXXXXXXXXXYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHDPYTVAGVDPEDLMLTA
2voyI           ----------------------------------------------------------------------
2kijA           ----------------------------------------------------------------------
2zxeA           XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
3b8eA           XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWSDNQIHEAD-----
2voyJ           ---------------------------------------------------VTDLVPLNG-DERELLRLA
1su4A           PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKM---------------
2oa0A           PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKM---------------
2o9jA           PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKM---------------
3ba6A           PAVITTCLALGTRRMAKKNAIVRSLPSVETLG-CTSVICSKTGTLTTNQMSVCKM---------------
3e81A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
3a1dB           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
3a1cB           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
3a1dA           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
3a1eB           AIAERRSEQPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
3a1cA           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
3a1eA           AIAERRSEQPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
2b8eC           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLVSNXXXXXXXXXXXXXX
2b8eA           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLVSNXXXXXXXXXXXXXX
2b8eB           AIAERRSEHPIAEAIVKKHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLVSNXXXXXXXXXXXXXX
2iyeA           ASVEALSSHPIAKAIVKEQGVKILEVKDFKEISGIGVRG------------KISDKI-------IEVKKA
3b8cA           AMASRADPNPVDKRTALTYSGNWHRVSKPEQILELAKAS----NDLSKKVLSIIDKYAERGLRSLAVARQ
2hc8A           ----------------------------------------------------------------------
1mhsA           CLAKSLKYYPRAKSVLSKYKVLQFHPFDPVSKKVVAVVESPQGERITVKGAPLFVLKTVEEDHPIPEEVN
2voyI           ----------------------------------------------------------------------
2kijA           ----------------------------------------------------------------------
2zxeA           ----------------------------------------------------------------------
3b8eA           ----------------------------------------------------------------------
2voyJ           AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLVSNXXXXXXXXXXXXXX
1su4A           ----------------------------------------------------------------------
2oa0A           ----------------------------------------------------------------------
2o9jA           ----------------------------------------------------------------------
3ba6A           ----------------------------------------------------------------------
3e81A           ---------------------------------------------------------DIDGVWT----DG


                         .         .         +         .         .         .         .:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
3a1dB           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1cB           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1dA           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1eB           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1cA           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
3a1eA           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
2b8eC           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKR-GIK--VGITGDNWRSAEAISRELNLDLVIAEVLPH
2b8eA           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKR-GIK--VGITGDNWRSAEAISRELNLDLVIAEVLPH
2b8eB           XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKR-GIK--VGITGDNWRSAEAISRELNLDLVIAEVLPH
2iyeA           EDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGL-KIIILSGDKEDKVKELSKELNIQEYYSNLSPE
3b8cA           VVPEKTKESEFVGLLPLFDPPRHDSAETIRRALNLGV-NVKMITGDQLAIGKETGRRLNLASIPVEVFPE
2hc8A           ----------------------------------------------------------------------
1mhsA           KVAEFATRGEILGIMPCMDPPRHDTYKTVCEAKTLGL-SIKMLTGDAVGIARETSRQLNIYNAEAEVFPQ
2voyI           --------------------LKESAKPAVQELKR-GIK--VGITGDNWRSAEAISRELNLDLVIAEVLPH
2kijA           ----------------------------------------------------------------------
2zxeA           --------------------------------------------------------------------PQ
3b8eA           --------------------------------------------------------------------PQ
2voyJ           XXVIVARNGRVEGIIAVSD---------------------------------------------------
1su4A           ----------FVGVVGMLDPPRKEVMGSIQLCRDAGI-RVIMITGDNKGTAIAICRRIGIFGENEEVAPS
2oa0A           ----------FVGVVGMLDPPRKEVMGSIQLCRDAGI-RVIMITGDNKGTAIAICRRIGIFGENEEVAPS
2o9jA           ----------FVGVVGMLDPPRKEVMGSIQLCRDAGI-RVIMITGDNKGTAIAICRRIGIFGENEEVAPS
3ba6A           ----------FVGVVGMLDPPRKEVMGSIQLCRDAGI-RVIMITGDNKGTAIAICRRIGIFGENEEVAPS
3e81A           GMFYDQTGNEW-------KKFNTSDSAGIFWAHNKGIP-VGILTGEKTEIVRRRAEKLKVDYLFQGVV--


                         *         .         .         .         .         +         .:560
query           DKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK
3a1dB           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1cB           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1dA           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1eB           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1cA           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
3a1eA           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GSDVAVESGDIVLIRDDLRDVVAAIQ
2b8eC           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS-GS------GDIVLIRDDLRDVVAAIQ
2b8eA           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS---------GDIVLIRDDLRDVVAAIQ
2b8eB           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVG-----------DIVLIRDDLRDVVAAIQ
2iyeA           DKVRIIEKLKQ---NGNKVLMIGDGVNXXXXXXXXXXXXXMGN-GVDISKNVADIILVSNDIGTLLGLIK
3b8cA           HKYEIVKKLQER---KHIVGMTGDGVNDAPAL-KKXXXXXXXXXXXXXXXXXXXIVLTEPGLSVIISAVL
2hc8A           ----------------------------------------------------------------------
1mhsA           HKYNVVEILQQ----RGYLVMTGDGVNDAPSLKKADTGIAVEG-SSDAARSAADIVFLAPGLGAIIDALK
2voyI           QKSEEVKKLQA----KEVVAFVGDGINDAPALAQADLGIAVGS---------GDIVLIRDDLRDVVAAIQ
2kijA           ----------------------------------------------------------------------
2zxeA           QKLIIVEGCQRQ----GAIVAVGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVE
3b8eA           QKLIIVEGCQRQ----GAIVAVGDGVNDSPASKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVE
2voyJ           ----------------------------------------------------------------------
1su4A           HKSKIVEYLQSEI-----TAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE
2oa0A           HKSKIVEYLQSEI-----TAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE
2o9jA           HKSKIVEYLQSEI-----TAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE
3ba6A           HKSKIVEYLQSEI-----TAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE
3e81A           DKLSAAEELCNELGNLEQVAYIGDDLNDAKLLKR--VGIA------------------------------


                         .         .         .         *         .         .         .:630
query           IARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAILNALRLLKMKEENKKINKYPH
3a1dB           LSRKT-----------------------------------------------------------------
3a1cB           LSRKT-----------------------------------------------------------------
3a1dA           LSRK------------------------------------------------------------------
3a1eB           LSRKT-----------------------------------------------------------------
3a1cA           LSR-------------------------------------------------------------------
3a1eA           LSRK------------------------------------------------------------------
2b8eC           LSRKT-----------------------------------------------------------------
2b8eA           ----------------------------------------------------------------------
2b8eB           LS--------------------------------------------------------------------
2iyeA           ----------------------------------------------------------------------
3b8cA           TSRAIFQRMKNYTIYAVSI-TIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTPD
2hc8A           ----------------------------------------------------------------------
1mhsA           TSRQIFHRMYAYVVYRIALSIHLEIFLGLWIAILNRSLNIEL-VVFIAIFADVATLAIAYDNAPYSQTP-
2voyI           ----------------------------------------------------------------------
2kijA           ----------------------------------------------------------------------
2zxeA           EGR----LIFDNL---------------------------------------------------------
3b8eA           EGR----LIFDNL---------------------------------------------------------
2voyJ           ----------------------------------------------------------------------
1su4A           EGR-------------------------------------------------------------------
2oa0A           EGR-------------------------------------------------------------------
2o9jA           EGR-------------------------------------------------------------------
3ba6A           EGR-------------------------------------------------------------------
3e81A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           Sxxxxxxxxxxxx
3a1dB           -------------
3a1cB           -------------
3a1dA           -------------
3a1eB           -------------
3a1cA           -------------
3a1eA           -------------
2b8eC           -------------
2b8eA           -------------
2b8eB           -------------
2iyeA           -------------
3b8cA           S------------
2hc8A           -------------
1mhsA           -------------
2voyI           -------------
2kijA           -------------
2zxeA           -------------
3b8eA           -------------
2voyJ           -------------
1su4A           -------------
2oa0A           -------------
2o9jA           -------------
3ba6A           -------------
3e81A           -------------