[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:ABE00490.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eh3A.bssp"
#ERROR : Can't open dsspfile "2f07B.bssp"
#ERROR : Can't open dsspfile "2f07A.bssp"
#ERROR : Can't open dsspfile "1ui6A.bssp"
#ERROR : Can't open dsspfile "1ui5B.bssp"
#ERROR : Can't open dsspfile "1ui5A.bssp"
#ERROR : Can't open dsspfile "2dg7A.bssp"
#ERROR : Can't open dsspfile "2uxhB.bssp"
#ERROR : Can't open dsspfile "2uxhA.bssp"
#ERROR : Can't open dsspfile "1ui6B.bssp"
#ERROR : Can't open dsspfile "3dcfB.bssp"
#ERROR : Can't open dsspfile "3dcfA.bssp"
#ERROR : Can't open dsspfile "2vkeA.bssp"
#ERROR : Can't open dsspfile "2tctA.bssp"
#ERROR : Can't open dsspfile "1orkA.bssp"
#ERROR : Can't open dsspfile "2o7oA.bssp"
#ERROR : Can't open dsspfile "1du7A.bssp"
#ERROR : Can't open dsspfile "1bjzA.bssp"
#ERROR : Can't open dsspfile "1bjyB.bssp"
#ERROR : Can't open dsspfile "1bj0A.bssp"
#ERROR : Can't open dsspfile "2qopA.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "1a6iA.bssp"
#ERROR : Can't open dsspfile "2zcnB.bssp"
#ERROR : Can't open dsspfile "2w53A.bssp"
#ERROR : Can't open dsspfile "1qpiA.bssp"
#ERROR : Can't open dsspfile "1vi0B.bssp"
#ERROR : Can't open dsspfile "1vi0A.bssp"
#ERROR : Can't open dsspfile "2ns8D.bssp"
#ERROR : Can't open dsspfile "2ns8C.bssp"
#ERROR : Can't open dsspfile "2ns8A.bssp"
#ERROR : Can't open dsspfile "2ns7B.bssp"
#ERROR : Can't open dsspfile "2iu5B.bssp"
#ERROR : Can't open dsspfile "2iu5A.bssp"
#ERROR : Can't open dsspfile "1zkgA.bssp"
#ERROR : Can't open dsspfile "2zcmA.bssp"
#ERROR : Can't open dsspfile "2ns8B.bssp"
#ERROR : Can't open dsspfile "2ns7D.bssp"
#ERROR : Can't open dsspfile "2ns7A.bssp"
#ERROR : Can't open dsspfile "2zcnA.bssp"
#ERROR : Can't open dsspfile "3ih2A.bssp"
#ERROR : Can't open dsspfile "2iekA.bssp"
#ERROR : Can't open dsspfile "2id6A.bssp"
#ERROR : Can't open dsspfile "2ns7C.bssp"
#ERROR : Can't open dsspfile "2vkvA.bssp"
#ERROR : Can't open dsspfile "2zcnD.bssp"
#ERROR : Can't open dsspfile "2g3bB.bssp"
#ERROR : Can't open dsspfile "3geuA.bssp"
#ERROR : Can't open dsspfile "2g3bA.bssp"
#ERROR : Can't open dsspfile "2zcmB.bssp"
#ERROR : Can't open dsspfile "2vprA.bssp"
#ERROR : Can't open dsspfile "1u9nA.bssp"
#ERROR : Can't open dsspfile "3bruB.bssp"
#ERROR : Can't open dsspfile "3bruA.bssp"
#ERROR : Can't open dsspfile "2hytA.bssp"
#ERROR : Can't open dsspfile "2qwtA.bssp"
#ERROR : Can't open dsspfile "2fd5A.bssp"
#ERROR : Can't open dsspfile "2dg8D.bssp"
#ERROR : Can't open dsspfile "2dg8C.bssp"
#ERROR : Can't open dsspfile "2dg8B.bssp"
#ERROR : Can't open dsspfile "2dg8A.bssp"
#ERROR : Can't open dsspfile "3bhqA.bssp"
#ERROR : Can't open dsspfile "1rktB.bssp"
#ERROR : Can't open dsspfile "1rktA.bssp"
#ERROR : Can't open dsspfile "1t56A.bssp"
#ERROR : Can't open dsspfile "3g1lA.bssp"

## Summary of PDB Search
:197
    8e-11  31%  2eh3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-08  42%  2f07B  [x.x.x] YVDT
    3e-08  42%  2f07A  [x.x.x] YVDT
    1e-07  34%  1ui6A  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-07  34%  1ui5B  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-07  34%  1ui5A  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    1e-07  40%  2dg7A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    3e-07  33%  2uxhB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR TTGR
    3e-07  33%  2uxhA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR TTGR
    3e-07  33%  1ui6B  [a.4.1 - a.121.1] A-FACTOR RECEPTOR HOMOLOG
    9e-07  29%  3dcfB  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    9e-07  29%  3dcfA  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    1e-06  30%  2vkeA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    1e-06  30%  2tctA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  30%  1orkA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  30%  2o7oA  [a.4.1 - a.121.1 (1bjyA)] TETRACYCLINE REPRESSOR PROTEIN
    1e-06  30%  1du7A  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR PROTEIN
    1e-06  30%  1bjzA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-06  30%  1bjyB  [a.4.1 - a.121.1] TETRACYCLINE REPRESSOR
    1e-06  30%  1bj0A  [x.x.x] TETRACYCLINE REPRESSOR
    2e-06  30%  2qopA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR ACRR
    2e-06  33%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-06  33%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-06  33%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-06  33%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-06  27%  1a6iA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    3e-06  29%  2zcnB  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    3e-06  29%  2w53A  [x.x.x] REPRESSOR
    3e-06  30%  1qpiA  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR)
    3e-06  41%  1vi0B  [a.4.1 - a.121.1] TRANSCRIPTIONAL REGULATOR
    3e-06  41%  1vi0A  [a.4.1 - a.121.1] TRANSCRIPTIONAL REGULATOR
    3e-06  25%  2ns8D  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns8C  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns8A  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  25%  2ns7B  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    3e-06  29%  2iu5B  [x.x.x] HYPOTHETICAL PROTEIN YCEG
    3e-06  29%  2iu5A  [x.x.x] HYPOTHETICAL PROTEIN YCEG
    6e-06  32%  1zkgA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    6e-06  28%  2zcmA  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    6e-06  25%  2ns8B  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    6e-06  25%  2ns7D  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    6e-06  25%  2ns7A  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    8e-06  28%  2zcnA  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    8e-06  33%  3ih2A  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-06  33%  2iekA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-06  33%  2id6A  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-05  25%  2ns7C  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN
    1e-05  27%  2vkvA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS B FROM
    2e-05  30%  2zcnD  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    2e-05  31%  2g3bB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-05  26%  3geuA  [x.x.x] INTERCELLULAR ADHESION PROTEIN R
    5e-05  38%  2g3bA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-05  30%  2zcmB  [x.x.x] BIOFILM OPERON ICAABCD HTH-TYPE NEGATIVE
    6e-05  40%  2vprA  [x.x.x] TETRACYCLINE RESISTANCE REPRESSOR PROTEIN
    6e-05  23%  1u9nA  [a.4.1 - a.121.1] TRANSCRIPTIONAL REPRESSOR ETHR
    1e-04  35%  3bruB  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    1e-04  35%  3bruA  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    2e-04  33%  2hytA  [x.x.x] TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-04  32%  2qwtA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-04  35%  2fd5A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-04  26%  2dg8D  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    3e-04  26%  2dg8C  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    3e-04  26%  2dg8B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    3e-04  26%  2dg8A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    3e-04  25%  3bhqA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-04  29%  1rktB  [a.4.1 - a.121.1] PROTEIN YFIR
    5e-04  29%  1rktA  [a.4.1 - a.121.1] PROTEIN YFIR
    0.001  23%  1t56A  [a.4.1 - a.121.1] ETHR REPRESSOR
    0.001  23%  3g1lA  [a.4.1 - a.121.1 (1u9oA)] TRANSCRIPTIONAL REGULATORY
:197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
2eh3A           ----------TKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKII
2f07B           -------------KILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAE-------
2f07A           -------------KILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAE-------
1ui6A           -----LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILE-------
1ui5B           -----LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILE-------
1ui5A           -----LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILE-------
2dg7A           -------------RLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVL------------
2uxhB           --------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
2uxhA           --------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
1ui6B           ------RAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILE-------
3dcfB           -----------RTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEAL
3dcfA           -----------RTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEAL
2vkeA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
2tctA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1orkA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
2o7oA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1du7A           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1bjzA           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1bjyB           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1bj0A           --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
2qopA           --------QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESNIG
3dpjF           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3dpjE           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3dpjB           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
3dpjA           ---------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTA
1a6iA           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAVEIL
2zcnB           -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
2w53A           ----------TREGILDAAEACFHEHGVARTTLEMIGARAGYTRGAVYWHFKNKSEVLAAIVERVHLPFM
1qpiA           -----------RESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
1vi0B           -----------------AAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISL---------
1vi0A           -----------------AAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISL---------
2ns8D           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2ns8C           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2ns8A           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2ns7B           --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2iu5B           ----------TQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFE---NDFA
2iu5A           ----------TQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFE---NDFA
1zkgA           -------VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQ----------
2zcmA           -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
2ns8B           -----------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2ns7D           -----------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2ns7A           -----------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2zcnA           -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
3ih2A           -----------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQ----------
2iekA           -----------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQ----------
2id6A           -----------RDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQ----------
2ns7C           ------------SKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
2vkvA           -----------KSKVINSALELGNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAVEIL
2zcnD           -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
2g3bB           -----------RDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYI-NDRA
3geuA           -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLN
2g3bA           -----------RDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLE-----------
2zcmB           -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFN---
2vprA           --------------IDNALI-LLNEVGIEGLTTRKLAQKIGVEQPTLYWHVKNKRALLDALAETI-----
1u9nA           ----------------------LEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVQADAL
3bruB           ----------------RAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEA------
3bruA           ----------------RAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEA------
2hytA           ---------ETRATLLATARKVFSERGYAD-TSDDLTAQASLTRGALYHHFGDKKGLLAAVVEQI-----
2qwtA           ---------RNRARVLEVAYDTFAAEGLG-VPMDEIARRAGVGAGTVYRHFPTKQALVVAVAE-------
2fd5A           ---------QTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALLEAFEQ-------
2dg8D           -----------RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
2dg8C           -----------RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
2dg8B           -----------RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
2dg8A           -----------RERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHIV
3bhqA           --------RKDREIIQAATAAFIS-KGYDG-TSEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVN
1rktB           ---------KRQAEILEAAKTVFKRKGF-ELTTKDVVEESGFSRGGVYLYFSSTEEFRRIIETGL-----
1rktA           ---------KRQAEILEAAKTVFKRKGF-ELTTKDVVEESGFSRGGVYLYFSSTEEFRRIIETGL-----
1t56A           ----------------------LEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQAD
3g1lA           ----------------------LEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQAD


                         .         .         *         .         .         .         .:140
query           QLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFYHKIKQILTRELLKRMEYLGI
2eh3A           SLFEENKEKTPEELLEFLEVLYREKKVVYIF---------------------------------------
2f07B           ----------------------------------------------------------------------
2f07A           ----------------------------------------------------------------------
1ui6A           ----------------------------------------------------------------------
1ui5B           ----------------------------------------------------------------------
1ui5A           ----------------------------------------------------------------------
2dg7A           ----------------------------------------------------------------------
2uxhB           ---HDH--LARASESED-----------------------------------------------------
2uxhA           ---HDH--LARASESED-----------------------------------------------------
1ui6B           ----------------------------------------------------------------------
3dcfB           ERFH------------------------------------------------------------------
3dcfA           ERFH------------------------------------------------------------------
2vkeA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
2tctA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1orkA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
2o7oA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1du7A           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1bjzA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1bjyB           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1bj0A           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
2qopA           EL--------------------------------------------------------------------
3dpjF           QLADWQGT--------------------------------------------------------------
3dpjE           QLADWQGT--------------------------------------------------------------
3dpjB           QLADWQGT--------------------------------------------------------------
3dpjA           QLADWQGT--------------------------------------------------------------
1a6iA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
2zcnB           DFLLRNHNYSIDGLY-----QFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
2w53A           QELERTSTDQRDTPVHDLRAVMIHSFIELSEDER------------------------------------
1qpiA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
1vi0B           ----------------------------------------------------------------------
1vi0A           ----------------------------------------------------------------------
2ns8D           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2ns8C           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2ns8A           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2ns7B           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2iu5B           ELINDNNEXXXXXRYLDENQIFYQKIFVIDKNFEHFFL--------------------------------
2iu5A           ELINDNNEXXXXXRYLDENQIFYQKIFVIDKNFEHFFL--------------------------------
1zkgA           ----------------------------------------------------------------------
2zcmA           DFYSIDGLY-----------QFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
2ns8B           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2ns7D           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2ns7A           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2zcnA           DFLLRDDNYSIDGLY-----QFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
3ih2A           ----------------------------------------------------------------------
2iekA           ----------------------------------------------------------------------
2id6A           ----------------------------------------------------------------------
2ns7C           DRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHR------------------------------------
2vkvA           ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
2zcnD           DFLDDNYSI-------DGLYQFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
2g3bB           RAYRSEGEGSGDSARDRLTR--------------------------------------------------
3geuA           NIINQNKSNYSI----DALYQFLFEFIFDI--EERYIRYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
2g3bA           ----------------------------------------------------------------------
2zcmB           -YFIDFRNYSIDGLY-----QFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
2vprA           ----------------------------------------------------------------------
1u9nA           QTLAENPADTDRENWRTGINVFFETFGSH-----------------------------------------
3bruB           ----------------------------------------------------------------------
3bruA           ----------------------------------------------------------------------
2hytA           ----------------------------------------------------------------------
2qwtA           ----------------------------------------------------------------------
2fd5A           ----------------------------------------------------------------------
2dg8D           AVFDEH----------------------------------------------------------------
2dg8C           AVFDEH----------------------------------------------------------------
2dg8B           AVFDEH----------------------------------------------------------------
2dg8A           AVFDEH----------------------------------------------------------------
3bhqA           DIIESVTTLLSEAIFEGGLQQLARRLIAVLDEELLKLRRLIIANAD------------------------
1rktB           ----------------------------------------------------------------------
1rktA           ----------------------------------------------------------------------
1t56A           MALQTLAENPADTDRENMWRTFFETFGSH-----------------------------------------
3g1lA           MALQTLAENPADTDRENMWRTFFETFGSH-----------------------------------------


                         +         .         .         .         .         *         .:210
query           KMSDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eh3A           ---------------------------------------------------------
2f07B           ---------------------------------------------------------
2f07A           ---------------------------------------------------------
1ui6A           ---------------------------------------------------------
1ui5B           ---------------------------------------------------------
1ui5A           ---------------------------------------------------------
2dg7A           ---------------------------------------------------------
2uxhB           ---------------------------------------------------------
2uxhA           ---------------------------------------------------------
1ui6B           ---------------------------------------------------------
3dcfB           ---------------------------------------------------------
3dcfA           ---------------------------------------------------------
2vkeA           ---------------------------------------------------------
2tctA           ---------------------------------------------------------
1orkA           ---------------------------------------------------------
2o7oA           ---------------------------------------------------------
1du7A           ---------------------------------------------------------
1bjzA           ---------------------------------------------------------
1bjyB           ---------------------------------------------------------
1bj0A           ---------------------------------------------------------
2qopA           ---------------------------------------------------------
3dpjF           ---------------------------------------------------------
3dpjE           ---------------------------------------------------------
3dpjB           ---------------------------------------------------------
3dpjA           ---------------------------------------------------------
1a6iA           ---------------------------------------------------------
2zcnB           ---------------------------------------------------------
2w53A           ---------------------------------------------------------
1qpiA           ---------------------------------------------------------
1vi0B           ---------------------------------------------------------
1vi0A           ---------------------------------------------------------
2ns8D           ---------------------------------------------------------
2ns8C           ---------------------------------------------------------
2ns8A           ---------------------------------------------------------
2ns7B           ---------------------------------------------------------
2iu5B           ---------------------------------------------------------
2iu5A           ---------------------------------------------------------
1zkgA           ---------------------------------------------------------
2zcmA           ---------------------------------------------------------
2ns8B           ---------------------------------------------------------
2ns7D           ---------------------------------------------------------
2ns7A           ---------------------------------------------------------
2zcnA           ---------------------------------------------------------
3ih2A           ---------------------------------------------------------
2iekA           ---------------------------------------------------------
2id6A           ---------------------------------------------------------
2ns7C           ---------------------------------------------------------
2vkvA           ---------------------------------------------------------
2zcnD           ---------------------------------------------------------
2g3bB           ---------------------------------------------------------
3geuA           KTKED----------------------------------------------------
2g3bA           ---------------------------------------------------------
2zcmB           ---------------------------------------------------------
2vprA           ---------------------------------------------------------
1u9nA           ---------------------------------------------------------
3bruB           ---------------------------------------------------------
3bruA           ---------------------------------------------------------
2hytA           ---------------------------------------------------------
2qwtA           ---------------------------------------------------------
2fd5A           ---------------------------------------------------------
2dg8D           ---------------------------------------------------------
2dg8C           ---------------------------------------------------------
2dg8B           ---------------------------------------------------------
2dg8A           ---------------------------------------------------------
3bhqA           ---------------------------------------------------------
1rktB           ---------------------------------------------------------
1rktA           ---------------------------------------------------------
1t56A           ---------------------------------------------------------
3g1lA           ---------------------------------------------------------