[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for lsal0:dnaB.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6aA.bssp"
#ERROR : Can't open dsspfile "2vyeA.bssp"
#ERROR : Can't open dsspfile "2r6dA.bssp"
#ERROR : Can't open dsspfile "2r6dC.bssp"
#ERROR : Can't open dsspfile "2r6eA.bssp"
#ERROR : Can't open dsspfile "2r6dE.bssp"
#ERROR : Can't open dsspfile "2vyfA.bssp"
#ERROR : Can't open dsspfile "2r6dB.bssp"
#ERROR : Can't open dsspfile "2vyeB.bssp"
#ERROR : Can't open dsspfile "2r6cA.bssp"
#ERROR : Can't open dsspfile "2vyfB.bssp"
#ERROR : Can't open dsspfile "2r6aB.bssp"
#ERROR : Can't open dsspfile "2q6tA.bssp"
#ERROR : Can't open dsspfile "2q6tB.bssp"
#ERROR : Can't open dsspfile "2q6tC.bssp"
#ERROR : Can't open dsspfile "2q6tD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2r5uE.bssp"
#ERROR : Can't open dsspfile "2r5uF.bssp"
#ERROR : Can't open dsspfile "2r5uD.bssp"
#ERROR : Can't open dsspfile "2r5uC.bssp"
#ERROR : Can't open dsspfile "2r5uB.bssp"
#ERROR : Can't open dsspfile "2r5uA.bssp"
#ERROR : Can't open dsspfile "1jweA.bssp"
#ERROR : Can't open dsspfile "1b79B.bssp"
#ERROR : Can't open dsspfile "1b79A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "1q57A.bssp"

## Summary of PDB Search
:463
    e-141  62%  2r6aA  [x.x.x] REPLICATIVE HELICASE
    e-138  62%  2vyeA  [x.x.x] REPLICATIVE DNA HELICASE
    e-133  62%  2r6dA  [x.x.x] REPLICATIVE HELICASE
    e-130  62%  2r6dC  [x.x.x] REPLICATIVE HELICASE
    e-129  65%  2r6eA  [x.x.x] REPLICATIVE HELICASE
    e-128  63%  2r6dE  [x.x.x] REPLICATIVE HELICASE
    e-124  62%  2vyfA  [x.x.x] REPLICATIVE DNA HELICASE
    e-123  64%  2r6dB  [x.x.x] REPLICATIVE HELICASE
    e-123  63%  2vyeB  [x.x.x] REPLICATIVE DNA HELICASE
    e-115  65%  2r6cA  [x.x.x] REPLICATIVE HELICASE
    e-115  63%  2vyfB  [x.x.x] REPLICATIVE DNA HELICASE
    e-114  61%  2r6aB  [x.x.x] REPLICATIVE HELICASE
    9e-98  46%  2q6tA  [x.x.x] DNAB REPLICATION FORK HELICASE
    1e-93  46%  2q6tB  [x.x.x] DNAB REPLICATION FORK HELICASE
    3e-92  46%  2q6tC  [x.x.x] DNAB REPLICATION FORK HELICASE
    5e-90  46%  2q6tD  [x.x.x] DNAB REPLICATION FORK HELICASE
    2e-74  41%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-73  42%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-62  49%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-28  43%  2r5uE  [x.x.x] REPLICATIVE DNA HELICASE
    1e-27  42%  2r5uF  [x.x.x] REPLICATIVE DNA HELICASE
    2e-27  43%  2r5uD  [x.x.x] REPLICATIVE DNA HELICASE
    2e-27  43%  2r5uC  [x.x.x] REPLICATIVE DNA HELICASE
    4e-26  45%  2r5uB  [x.x.x] REPLICATIVE DNA HELICASE
    4e-26  45%  2r5uA  [x.x.x] REPLICATIVE DNA HELICASE
    1e-24  46%  1jweA  [a.81.1] PROTEIN (DNAB HELICASE)
    2e-22  47%  1b79B  [a.81.1] DNAB HELICASE
    4e-22  47%  1b79A  [a.81.1] DNAB HELICASE
    2e-08  22%  1e0jA  [c.37.1] DNA HELICASE
    3e-08  22%  1e0jB  [c.37.1] DNA HELICASE
    5e-06  22%  1q57A  [e.13.1 - c.37.1] DNA PRIMASE/HELICASE
:463

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxDNLPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
2r6aA           ---------IPPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2vyeA           ---------IPPQSIEAEQAVLGAVFLDPTALTLASERLIPEDFYRAAHQKIFHAMLRVADKGEPVDLVT
2r6dA           ----------PPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2r6dC           ----------PPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2r6eA           ---------IPPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2r6dE           ----------PPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2vyfA           ---------IPPQSIEAEQAVLGAVFLDPTALTLASERLIPEDFYRAAHQKIFHAMLRVADKGEPVDLVT
2r6dB           ----------PPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2vyeB           -------ERIPPQSIEAEQAVLGAVFLDPTALTLASERLIPEDFYRAAHQKIFHAMLRVADKGEPVDLVT
2r6cA           ---------------EAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2vyfB           -------ERIPPQSIEAEQAVLGAVFLDPTALTLASERLIPEDFYRAAHQKIFHAMLRVADKGEPVDLVT
2r6aB           ---------IPPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADRGEPVDLVT
2q6tA           ---------IPPHSLEAEQSVLGSILLDSDVMDEVEGLLSPEAFYAEAHRKIYAAMQALRSQGRPVDLVT
2q6tB           ---------IPPHSLEAEQSVLGSILLDSDVMDEVEGLLSPEAFYAEAHRKIYAAMQALRSQGRPVDLVT
2q6tC           ---------IPPHSLEAEQSVLGSILLDSDVMDEVEGLLSPEAFYAEAHRKIYAAMQALRSQGRPVDLVT
2q6tD           ---------IPPHSLEAEQSVLGSILLDSDVMDEVEGLLSPEAFYAEAHRKIYAAMQALRSQGRPVDLVT
3bgwA           -------------NEYAEQAVLGSILTEPELIKECP--LTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTS
3bgwD           -------------NEYAEQAVLGSILTEPELIKECP--LTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTS
3bh0A           ----------------------------------------------------------------------
2r5uE           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
2r5uF           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
2r5uD           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
2r5uC           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
2r5uB           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
2r5uA           ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
1jweA           ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
1b79B           ----------PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
1b79A           ----------PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
1e0jA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
1q57A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSL
2r6aA           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2vyeA           VTXXXXXXXXXXXVGGVSYLSELADSVPTAANVEYYARIVEEKSLLRRLIRTATSIAQDGYTREDEIDVL
2r6dA           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2r6dC           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2r6eA           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2r6dE           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2vyfA           VTXXXXXXXXXXXVGGVSYLSELADSVPTAANVEYYARIVEEKSLLRRLIRTATSIAQDGYTREDEIDVL
2r6dB           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2vyeB           VTXXXXXXXXXXXVGGVSYLSELADSVPTAANVEYYARIVEEKSLLRRLIRTATSIAQDGYTREDEIDVL
2r6cA           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2vyfB           VTXXXXXXXXXXXVGGVSYLSELADSVPTAANVEYYARIVEEKSLLRRLIRTATSIAQDGYTREDEIDVL
2r6aB           VTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRTATSIAQDGYTREDEIDVL
2q6tA           LSEELSRRGQLEEVGGTAYLLQLSEATPTAAYAEHYARIVAEKWTLRRLIQAAGEAMRLAYEEAGSLDEI
2q6tB           LSEELSRRGQLEEVGGTAYLLQLSEATPTAAYAEHYARIVAEKWTLRRLIQAAGEAMRLAYEEAGSLDEI
2q6tC           LSEELSRRGQLEEVGGTAYLLQLSEATPTAAYAEHYARIVAEKWTLRRLIQAAGEAMRLAYEEAGSLDEI
2q6tD           LSEELSRRGQLEEVGGTAYLLQLSEATPTAAYAEHYARIVAEKWTLRRLIQAAGEAMRLAYEEAGSLDEI
3bgwA           IA--ARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVN------VKP
3bgwD           IA--ARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVN------VKP
3bh0A           ----------------------------------------------------------------------
2r5uE           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAG--AVAEV
2r5uF           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVV-QYGYAGAEVAEV
2r5uD           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAE----V
2r5uC           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAE----V
2r5uB           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVV-------------
2r5uA           VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVV-------------
1jweA           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMIS-------------------
1b79B           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRER---------------------------
1b79A           LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRE----------------------------
1e0jA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
1q57A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
2r6aA           LDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVA
2vyeA           LDEAERKIMEVSQRKHSGAFKNIKDVLVQTYDNIEMLHNRNGDITGIPTGFTELDRMTSGFQRSDLIIVA
2r6dA           LDEADRKIMEVSQR----AFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVA
2r6dC           LDEADRKIME----------KNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLIIVA
2r6eA           LDEADRKIMEVS---------------------------------GIPTGFTELDRMTSGFQRSDLIIVA
2r6dE           LDEADRKIME----------KNIKDILVQTYDNI-------EEITGIPTGFTELDRMTSGFQRSDLIIVA
2vyfA           LDEAERKIMEVSQRKHSGAFKNIKDVLVQTYDNIEMLHNRNGDITGIPTGFTELDRMTSGFQRSDLIIVA
2r6dB           LDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVA
2vyeB           LDEAERKIMEVSQRKHSGAF---KDVLVQTYDNIEMLHNRNGDITGIPTGFTELDRMTSGFQRSDLIIVA
2r6cA           LDEADRKIME---------------------------------ITGIPTGFTELDRMTSGFQRSDLIIVA
2vyfB           LDEAERKIMEVSQRK---AFKNIKDVLVQTYDNIEML----HNITGIPTGFTELDRMTSGFQRSDLIIVA
2r6aB           LDEADRKIMEVSQRKHSGAFKNIKDILVQTYDNIE--------ITGIPTGFTELDRMTSGFQRSDLIIVA
2q6tA           LDTAGKKILEVALTKTDTEARPMRELVHETF----------EHIEAVRTGFKELDQLIGTLGPGSLNIIA
2q6tB           LDTAGKKILEVALAR------PMRELVHETFEHIEALVR---------TGFKELDQLIGTLGPGSLNIIA
2q6tC           LDTAGKKILEVALTKTDTEARPMRELVHETFEHI--------------TGFKELDQLIGTLGPGSLNIIA
2q6tD           LDTAGKKILEVALTKTEA--RPMRELVHETF----------EHIEALFTGFKELDQLIGTLGPGSLNIIA
3bgwA           IQEAVSELMEIEA----SGTDDDDGSIDEALVTVEEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIA
3bgwD           IQEAVSELMEI----------EIDEALVTVYEEIE---SADGNITGVPSGFTELDRMTYGYKRRNFVLIA
3bh0A           ----------------------------------EEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIA
2r5uE           VDRAQAEIYDVA----------------------------------------------------------
2r5uF           VDRAQAEIYD------------------------------------------------------------
2r5uD           VDRAQAEIYDV-----------------------------------------------------------
2r5uC           VDRAQAEIYDV-----------------------------------------------------------
2r5uB           ----------------------------------------------------------------------
2r5uA           ----------------------------------------------------------------------
1jweA           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
1b79A           ----------------------------------------------------------------------
1e0jA           ----------------------IPDGVVSALSLRERIREHLSSSVGLLSGCTGINDKTLGARGGEVIMVT
1e0jB           ----------------------------------------SEESVGLLSGCTGINDKTLGARGGEVIMVT
1q57A           ----------------------IPDGVVSALSLRERIREHSEESVGLLSGCTGINDKTLGARGGEVIMVT


                         .         .         .         +         .         .         .:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
2r6aA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2vyeA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2r6dA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2r6dC           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2r6eA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2r6dE           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2vyfA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGN-------TGKLTPEDWGKLTMA
2r6dB           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2vyeB           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNLTPE----------DWGKLTMA
2r6cA           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2vyfB           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2r6aB           ARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMA
2q6tA           ARPAMGKTAFALTIAQNAALKEGVGVGIYSLEMPAAQLTLRMMCSEARIDMNRVRLGQLTDRDFSRLVDV
2q6tB           ARPAMGKTAFALTIAQNAALKEGVGVGIYSLEMPAAQLTLRMMCSEARIDMNRVR---LTDRDFSRLVDV
2q6tC           ARPAMGKTAFALTIAQNAALKEGVGVGIYSLEMPAAQLTLRMMCSEARIDMN----------DFSRLVDV
2q6tD           ARPAMGKTAFALTIAQNAALKEGVGVGIYSLEMPAAQLTLRMMCSEA---------------RFSRLVDV
3bgwA           ARPSMGKTAFALKQAKNMSDNDDV-VNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDSEDWGKLSMA
3bgwD           ARPSMGKTAFALKQAKNMSDNDDV-VNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDSEDWGKLSMA
3bh0A           ARPSMGKTAFALKQAKNMSDNDDV-VNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDSEDWGKLSMA
2r5uE           ----------------------------------------------------------------------
2r5uF           ----------------------------------------------------------------------
2r5uD           ----------------------------------------------------------------------
2r5uC           ----------------------------------------------------------------------
2r5uB           ----------------------------------------------------------------------
2r5uA           ----------------------------------------------------------------------
1jweA           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
1b79A           ----------------------------------------------------------------------
1e0jA           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRSDSLKREIIENGKFDQWFDE
1e0jB           SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRSDSLKREIIENGKFDQWFDE
1q57A           SGSGMVMSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRSDSLKREIIENGKFDQWFDE


                         .         *         .         .         .         .         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
2r6aA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR--RQQEVSEISRSLKALA
2vyeA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMVVIDYLQLIQGSNRENRQQEVSEISRSLKALA
2r6dA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR-----EVSEISRSLKALA
2r6dC           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR-----EVSEISRSLKALA
2r6eA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR--RQQEVSEISRSLKALA
2r6dE           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR-----EVSEISRSLKALA
2vyfA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMVVIDYLQLIQGSNRENRQQEVSEISRSLKALA
2r6dB           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGR-----EVSEISRSLKALA
2vyeB           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMVVIDYLQLIQGSNRENRQQEVSEISRSLKALA
2r6cA           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLI---------QEVSEISRSLKALA
2vyfB           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMVVIDY--------RENRQQEVSEISRSLKALA
2r6aB           MGSLSNAGIYIDDTPSIRVSDIRAKCRRLKQESG-LGMIVIDYLQLI----------EVSEISRSLKALA
2q6tA           ASRLSEAPIYIDDTPDLTLMEVRARARRLVSQ-NQVGLIIIDYLQLMSGPN---RQQEIAAISRGLKALA
2q6tB           ASRLSEAPIYIDDTPDLTLMEVRARARRLVSQN-QVGLIIIDYLQLMSGPN---RQQEIAAISRGLKALA
2q6tC           ASRLSEAPIYIDDTPDLTLMEVRARARRLVSQN-QVGLIIIDYLQLMSGPN---RQQEIAAISRGLKALA
2q6tD           ASRLSEAPIYIDDTPDLTLMEVRARARRLVSQN-QVGLIIIDYLQLMSGN----RQQEIAAISRGLKALA
3bgwA           IGEISNSNINIFDKAGQSVNYIWSKTRQTKKNPGKRVIVMIDYLQLLEPAKNDSRTNQISQISRDLKKMA
3bgwD           IGEISNSNINIFDKAGQSVNYIWSKTRQTKKNPGKRVIVMIDYLQLLEPAKNDSRTNQISQISRDLKKMA
3bh0A           IGEISNSNINIFDKAGQSVNYIWSKTRQTKKNPGKRVIVMIDYLQLLEPAKNDSRTNQISQISRDLKKMA
2r5uE           ----------------------------------------------------------------------
2r5uF           ----------------------------------------------------------------------
2r5uD           ----------------------------------------------------------------------
2r5uC           ----------------------------------------------------------------------
2r5uB           ----------------------------------------------------------------------
2r5uA           ----------------------------------------------------------------------
1jweA           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
1b79A           ----------------------------------------------------------------------
1e0jA           L--FGNDTFHLYDS--FAEAETDRLLAKLAYMRSGLGVIILDHISIVVSASGESDERKIDNLMTKLKGFA
1e0jB           L--FGNDTFHLYDS--FAEAETDRLLAKLAYMRSGLGVIILDHISIVVSASGESDERKIDNLMTKLKGFA
1q57A           L--FGNDTFHLYDS-----FETDRLLAKLAYMRSGLGVIILDHISIVVSASGESDERKIDNLMTKLKGFA


                         .         .         .         .         *         .         .:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
2r6aA           RELEVPVIALSQLSRSVEQR---RPMMSDIRESGSIEQDADIVAFLYRDDY-------------------
2vyeA           RELEVPVIALSQLSRSVEQRQD--PMMSDLRESGSIEQDADIVAFLYRD--------------DNKDSEN
2r6dA           RELEVPVIALSQLSRSVE-----RPMMSDIRESGSIEQDADIVAFLYKN---------------------
2r6dC           RELEVPVIALSQLSRSVE-----RPMMSDIRESGSIEQDADIVAFLYKN---------------------
2r6eA           RELEVPVIALSQLSRSVEQR---RPMMSDIRESGSIEQDADIVAFLYRDDY-------------------
2r6dE           RELEVPVIALSQLSRSVE-----RPMMSDIRESGSIEQDADIVAFLYKN---------------------
2vyfA           RELEVPVIALSQLS-----------------ESGSIEQDADIVAFLYRDNI-------------------
2r6dB           RELEVPVIALSQLSRSVE-----RPMMSDIRESGSIEQDADIVAFLYKN---------------------
2vyeB           RELEVPVIALSQLSRSVEQRQDKR----DLRESGSIEQDADIVAFI------------------------
2r6cA           RELEVPVIALSQL----------RPMMSDIRESGSIEQDADIVAFLY-----------------------
2vyfB           RELEVPVIALSQLS-----------------ESGSIEQDADIVAFL------------------------
2r6aB           RELEVPVIALSQL-------------------------DADIVAFL------------------------
2q6tA           RELGIPIIALSQLSRAVEARPNKRPMLSDLRESGSIEQDADLVMFIYRDEYYNPHSEKA-----------
2q6tB           RELGIPIIALSQLSRAVEARPNKRPMLSDLRESGSIEQDADLVMFIYRDEYYNPHSEKA-----------
2q6tC           RELGIPIIALSQLSRAVEARPNKRPMLSDLRESGSIEQDADLVMFIYRDEYYNPHSEKA-----------
2q6tD           RELGIPIIALSQLSRAVEARPNKRPMLSDLRESGSIEQDADLVMFIYRDEYYNPHSEKA-----------
3bgwA           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK-ESESK----------
3bgwD           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK-ESESK----------
3bh0A           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK-ESESK----------
2r5uE           ----------------------------------------------------------------------
2r5uF           ----------------------------------------------------------------------
2r5uD           ----------------------------------------------------------------------
2r5uC           ----------------------------------------------------------------------
2r5uB           ----------------------------------------------------------------------
2r5uA           ----------------------------------------------------------------------
1jweA           ----------------------------------------------------------------------
1b79B           ----------------------------------------------------------------------
1b79A           ----------------------------------------------------------------------
1e0jA           KSTGVVLVVICHLKNPDKGKEEGRPVITDLRGSGALRQLSDTIIALERN---------------------
1e0jB           KSTGVVLVVICHLKNPDKGKEEGRPVITDLRGSGALRQLSDTIIALERN---------------------
1q57A           KSTGVVLVVICHLKNPDKGKEEGRPVITDLRGSGALRQLSDTIIALERN---------------------


                         .         .         +         .         .         .         .:490
query           QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNIxxxxxxxx
2r6aA           --KNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2vyeA           KN------XXXXXXAKQRNGVQLAFIKEYNKFVN---------
2r6dA           ----IIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2r6dC           ----IIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2r6eA           --KNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2r6dE           ----IIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2vyfA           -----IEIIIAKQRNGPVGTVQLAFIKEY--------------
2r6dB           ----IIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2vyeB           -------------------------------------------
2r6cA           ------EIIIAKQRNGPVGTVQLAFIKEYNKFVNL--------
2vyfB           -------------------------------------------
2r6aB           ----XXXXXXAKQRNGPVGTVQLAFIKEYNKFVNL--------
2q6tA           ---GIAEIIVGKQRNGPTGTVELQFHASHVRFNDL--------
2q6tB           ---GIAEIIVGKQRNGPTGTVELQFHASHVRFNDL--------
2q6tC           ---GIAEIIVGKQRNGPTGTVELQFHASHVRFNDL--------
2q6tD           ---GIAEIIVGKQRNGPTGTVELQFHASHVRFNDL--------
3bgwA           ---NIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
3bgwD           ---NIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
3bh0A           ---NIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL--------
2r5uE           -------------------------------------------
2r5uF           -------------------------------------------
2r5uD           -------------------------------------------
2r5uC           -------------------------------------------
2r5uB           -------------------------------------------
2r5uA           -------------------------------------------
1jweA           -------------------------------------------
1b79B           -------------------------------------------
1b79A           -------------------------------------------
1e0jA           -------------------------------------------
1e0jB           -------------------------------------------
1q57A           -------------------------------------------