[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD98844.1

[Show Plain Result]


## Summary of Sequence Search
    1::288
    1::262     7e-40  41%  280 aa  YSUP_LACHE RecName: Full=Putative sugar uptake protein;
    1::256     2e-39  39%  282 aa  Y2594_LACPL RecName: Full=Putative sugar uptake protein lp_2594;
    1::265     4e-38  45%  287 aa  Y170_LACJO RecName: Full=Putative sugar uptake protein LJ_0170;
    1::262     1e-34  34%  285 aa  Y169_LISMO RecName: Full=Putative sugar uptake protein lmo0169;
    1::262     2e-34  34%  285 aa  Y212_LISIN RecName: Full=Putative sugar uptake protein lin0212;
    1::264     7e-30  30%  287 aa  Y928_ENTFA RecName: Full=Putative sugar uptake protein EF_0928;
    1::262     2e-26  29%  285 aa  Y2503_LACPL RecName: Full=Putative sugar uptake protein lp_2503;
   19::271     6e-26  34%  293 aa  RBSU_STAES RecName: Full=Putative ribose uptake protein rbsU;
   19::271     1e-25  34%  293 aa  RBSU_STAEQ RecName: Full=Putative ribose uptake protein rbsU;
   19::274     4e-25  34%  295 aa  RBSU_ENTFA RecName: Full=Putative ribose uptake protein rbsU;
    1::263     1e-24  29%  286 aa  GLCU_BACME RecName: Full=Probable glucose uptake protein glcU;
    4::272     1e-24  31%  294 aa  RBSU_LACSS RecName: Full=Putative ribose uptake protein rbsU;
   13::262     2e-24  30%  287 aa  GLCU_BACSU RecName: Full=Glucose uptake protein glcU;
   22::271     1e-23  31%  293 aa  RBSU_STAAN RecName: Full=Putative ribose uptake protein rbsU;
   22::271     1e-23  31%  293 aa  RBSU_STAAM RecName: Full=Putative ribose uptake protein rbsU;
   22::271     2e-23  31%  293 aa  RBSU_STAAW RecName: Full=Putative ribose uptake protein rbsU;
   22::271     2e-23  31%  293 aa  RBSU_STAAS RecName: Full=Putative ribose uptake protein rbsU;
   22::271     2e-23  31%  293 aa  RBSU_STAAR RecName: Full=Putative ribose uptake protein rbsU;
   22::271     2e-23  31%  293 aa  RBSU_STAAC RecName: Full=Putative ribose uptake protein rbsU;
    1::260     6e-23  37%  283 aa  Y220_BACC1 RecName: Full=Putative sugar uptake protein BCE_0220;
    1::260     6e-23  37%  283 aa  Y219_BACCR RecName: Full=Putative sugar uptake protein BC_0219;
    1::260     8e-23  37%  283 aa  Y200_BACAN RecName: Full=Putative sugar uptake protein
    1::262     2e-22  28%  286 aa  Y215_LISIN RecName: Full=Putative sugar uptake protein lin0215;
    1::262     7e-22  28%  286 aa  Y176_LISMO RecName: Full=Putative sugar uptake protein lmo0176;
    4::265     2e-20  29%  287 aa  GLCU_STAES RecName: Full=Probable glucose uptake protein glcU;
    4::265     2e-20  29%  287 aa  GLCU_STAEQ RecName: Full=Probable glucose uptake protein glcU;
    4::270     2e-20  29%  295 aa  YXFA_LACLA RecName: Full=Putative sugar uptake protein yxfA;
    4::265     4e-20  36%  287 aa  GLCU_STAAW RecName: Full=Probable glucose uptake protein glcU;
    4::265     4e-20  36%  287 aa  GLCU_STAAS RecName: Full=Probable glucose uptake protein glcU;
    4::265     4e-20  36%  287 aa  GLCU_STAAR RecName: Full=Probable glucose uptake protein glcU;
    4::265     4e-20  36%  287 aa  GLCU_STAAN RecName: Full=Probable glucose uptake protein glcU;
    4::265     4e-20  36%  287 aa  GLCU_STAAM RecName: Full=Probable glucose uptake protein glcU;
    4::265     4e-20  36%  287 aa  GLCU_STAAC RecName: Full=Probable glucose uptake protein glcU;
   19::273     5e-20  36%  294 aa  RBSU_LACPL RecName: Full=Putative ribose uptake protein rbsU;
   19::275     1e-19  35%  296 aa  RBSU_LACJO RecName: Full=Putative ribose uptake protein rbsU;
    2::198     1e-19  29%  286 aa  GLCU_BACCR RecName: Full=Probable glucose uptake protein glcU;
    1::197     2e-19  27%  285 aa  GLCU_BACC1 RecName: Full=Probable glucose uptake protein glcU;
    1::262     9e-19  34%  288 aa  GLCU_STAXY RecName: Full=Glucose uptake protein glcU;
    1::197     9e-19  28%  285 aa  GLCU_BACAN RecName: Full=Probable glucose uptake protein glcU;
    4::198     6e-18  29%  288 aa  Y2157_STRA5 RecName: Full=Putative sugar uptake protein SAG2157;
    4::198     6e-18  29%  288 aa  Y2116_STRA3 RecName: Full=Putative sugar uptake protein gbs2116;
   35::159     8e-17  46%  176 aa  YSUP_LACDL RecName: Full=Putative sugar uptake protein;Flags:
    4::264     5e-16  25%  287 aa  Y2243_STRP8 RecName: Full=Putative sugar uptake protein
    4::264     5e-16  25%  287 aa  Y2205_STRP1 RecName: Full=Putative sugar uptake protein
    4::264     5e-16  25%  287 aa  Y1874_STRP6 RecName: Full=Putative sugar uptake protein M6_Spy1874;
    4::264     5e-16  25%  287 aa  Y1856_STRP3 RecName: Full=Putative sugar uptake protein
    5::263     1e-13  32%  285 aa  Y444_LISIN RecName: Full=Putative sugar uptake protein lin0444;
    5::263     1e-13  32%  285 aa  Y424_LISMO RecName: Full=Putative sugar uptake protein lmo0424;
    1::288

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAFMAGACWTI
YSUP_LACHE      MNILIALIPALGWGIFSLIAGKIKNSPANELMXXXXXXXXXXXXXXXXHPASSNITIFSLSLISGMFCAL
Y2594_LACPL     MIFLIAIIPALCWGINPLLVGKINGHSENEMFGMGIGDGLIALIFWLFSQPTVTISGFGLAMISGAAWAI
Y170_LACJO      MKYVYLFLPAIGWGLMPLIASVKNSTVYNQIVGTVAASFIFGAIVMAIMHPAMSWSLFLLSALGGACWVI
Y169_LISMO      MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGVFIFTNPEYTATIIIASFVSGAFWSL
Y212_LISIN      MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGVFIFTNPEYTATIIIASFISGAFWSL
Y928_ENTFA      MSLLIALVPMIAWGSIGLVSGKIGGSANQQTLGMTIGALLFSIVVFFVIQPTLTTATLIVGFISGLFWSL
Y2503_LACPL     MGILIALIPAIAWGSIGLISGRMGGTARQQTLGMTMGALVFGLALWAVEQPTLTSKIWLIGIVSGLFWSI
RBSU_STAES      ---------------FPTIASKFGGRPVNQIFGATVGTLI-----FAIVLALFKGMALVFSLISGAGWAF
RBSU_STAEQ      ---------------FPTIASKFGGRPVNQIFGATVGTLI-----FAIVLALFKGMALVFSLISGAGWAF
RBSU_ENTFA      ---------------FPTIASKIGGRPVNQILGTSLGTLI-----FAAIFSMINGLAFFFSILSGVGWAC
GLCU_BACME      MDIFLAVLPAIFWGSIVLFNVKLGGGPYSQTLGTTLGALIFSIGIYIFVHPTFTPLIFGVGVVSGLFWAV
RBSU_LACSS      VNILIGLMPMIGWGIFPVIVGKIGGKPASQILGTTFGTLILAIVV-AIFRPIPETKTFIFCLISGACWAL
GLCU_BACSU      ------------WGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQPVLSLRIFIVGIVSGLFWSL
RBSU_STAAN      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
RBSU_STAAM      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
RBSU_STAAW      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
RBSU_STAAS      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
RBSU_STAAR      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
RBSU_STAAC      ------------------VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFLFALLSGAGWGF
Y220_BACC1      MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIVGFISGLFWAL
Y219_BACCR      MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIVGFISGLFWAL
Y200_BACAN      MGILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIVGFISGLFWAL
Y215_LISIN      MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIVFFFTDPVYTLKTVGISFITGCLWTV
Y176_LISMO      MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIVFFFTDPVYTLKTVGISFITGCLWTV
GLCU_STAES      VDFLIALLPALFWGSVVIINVFVGGGPYNQIRGTTLGTLFIGFSLLATGHAAFNLTVIIVGLVSGALWAF
GLCU_STAEQ      VDFLIALLPALFWGSVVIINVFVGGGPYNQIRGTTLGTLFIGFSLLATGHAAFNLTVIIVGLVSGALWAF
YXFA_LACLA      --VLLALVPMFAWGSIGFVANKFGGDAKQQTLGMTLGAFVFALIVFLFRMPTLTWQIFLIGFIGGLLWAI
GLCU_STAAW      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
GLCU_STAAS      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
GLCU_STAAR      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
GLCU_STAAN      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
GLCU_STAAM      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
GLCU_STAAC      LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXFAFNNPTV----IIVGLISGALWAF
RBSU_LACPL      ---------------YPTIASKIGGRPVNQILGSTIGTLI-----FALIYAWVQGIAFLWSILSGIGWAS
RBSU_LACJO      ---------------FPTIASKIGGKPVNQIIGTTFGTFI-----FALVYNLVQGIALXXXXXXXXXXXX
GLCU_BACCR      MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGVGVVSGLFWAL
GLCU_BACC1      MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGVGIVSGLFWAL
GLCU_STAXY      MDLLIALLPALFWGSVVLINVLVGGGPYNQIRXXXXXXXXXXXXXXXXXNAKFDLTIIIVGLISGAFWAL
GLCU_BACAN      MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGVGIVSGLFWAL
Y2157_STRA5     --LLIALIPMFAWGSIGFVSNKIGGRPNQQTFGMTLGALLFAIIVWLFKQPEMTASLWIFGILGGILWSV
Y2116_STRA3     --LLIALIPMFAWGSIGFVSNKIGGRPNQQTFGMTLGALLFAIIVWLFKQPEMTASLWIFGILGGILWSV
YSUP_LACDL      ----------------------------------------------------------------------
Y2243_STRP8     --IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGILGGFIWSI
Y2205_STRP1     --IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGILGGFIWSI
Y1874_STRP6     --IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGILGGFIWSI
Y1856_STRP3     --IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGILGGFIWSI
Y444_LISIN      ---LIALLPVLGWGFMPIIANLRKSTPEEQLLGTXXXXXXXXXXXXXXXXPEITVLSFIVSFVSGIFWSF
Y424_LISMO      ---LIALLPVLGWGFMPIIANLRKSTPEEQLLGTXXXXXXXXXXXXXXXXPEITVLSFIVSFISGIFWSF


                         .         .         *         .         .         .         .:140
query           GQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXXXXXXXXDD
YSUP_LACHE      GQSGQFISMR--NIGISKTMPLSTGFQLIGNTLIGAIIFGEWTSSSQYLIGTLALILIIVGVSLTAISKD
Y2594_LACPL     GQLGQYISYR--LLGVSKTMPISTALQLVGTSLIGVLMFGEWGSSNQKILGLLAIMLIVAGSALSAGTSD
Y170_LACJO      GQVGQYISY--EKIGVSETMPISTGLQLIGVPLVGVLAFGEWSSPQAKLYXXXXXXXXXXXXXXTSFTDR
Y169_LISMO      GQMNQFRAF--TQVGVSKTMPLSTGMQLVGTSLFGVFAFHEW-GTTSKLVLGFSALALIIIGIFLTSYQQ
Y212_LISIN      GQMNQFRAF--TQVGVSKTMPLSTGMQLVGTSLFGVFAFHEW-GTTSKLILGFSALALIIIGIFLTSYQQ
Y928_ENTFA      GQNQQFHSMK--YMGVSVGLPISTGMQLVVNTVAGAVFFHEWTKTKDFVVGFIALAFLVFGVYLTARQDD
Y2503_LACPL     GQGQQFTSMKA--VGISRTTPISTGMQLVANALAGVLLFNEWHGNMYWIGSASVIVLIAGAVLTSLTDKT
RBSU_STAES      GQIITFKAF--ELVGSSRAMPITTAFQLLGASLWGVFALGNWPGITNKIIGFLALLVILIGARMTVWTET
RBSU_STAEQ      GQIITFKAF--ELVGSSRAMPITTAFQLLGASLWGVFALGNWPGITNKIIGFLALLVILIGARMTVWTET
RBSU_ENTFA      AQIITFKCFT--MIGSSRAMPVTTAFQLLGASLWGVFFLGNWPGATAKLLGAFALVLIMIGAKMTVWSET
GLCU_BACME      GQSNQLKSI--DLIGVSKTMPISTGLQLVSTSLFGVIVFHEWSTKTSLALIFIIVGIVLASLQSXXXXXX
RBSU_LACSS      AQIITFHVF--ETMGVSRTMPITTGFQLVGASLWGVFVLGNWSSSQSKLIGFTAIALIIIGVYLTAWSED
GLCU_BACSU      GQANQLKSI--QLMGVSKTMPISTGMQLVSTSLFGVIVFREWSTPIAITLGVLALIFIIVGIILTSLEDK
RBSU_STAAN      GQIITFKAF--ELIGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
RBSU_STAAM      GQIITFKAF--ELIGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
RBSU_STAAW      GQIITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
RBSU_STAAS      GQIITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
RBSU_STAAR      GQIITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
RBSU_STAAC      GQIITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSER
Y220_BACC1      GQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXXXXXXXXXXXXXXXFTSLDDK
Y219_BACCR      GQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXXXXXXXXXXXXXXXFTSLDDK
Y200_BACAN      GQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXXXXXXXXXXXXXXXFTSLDDK
Y215_LISIN      GQMFQLRAFK--IIGVSKAMPISTGMQLVGTTLCGVILFHEWDTTLRIILGFIALALIVGGIFLTSYAEK
Y176_LISMO      GQMFQLQAFK--IIGVSKAMPISTGMQLVGTTLCGVILFHEWDTTLRIILGFIALALIVGGIFLTSYAEK
GLCU_STAES      GQGNQLKSV--HLIGVSKTMPISTGMQLVGTTLFSAIFLGEWSTQVVMGLIAMILLVVGISLTSLKAKSE
GLCU_STAEQ      GQGNQLKSV--HLIGVSKTMPISTGMQLVGTTLFSAIFLGEWSTQVVMGLIAMILLVVGISLTSLKAKSE
YXFA_LACLA      GQFGQFNSMK--YMGVSVASPLSSGSQLVIGGLIGVFAFHEWTGFIAMAVLVVGFYFSAKRDPENAVVEE
GLCU_STAAW      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
GLCU_STAAS      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
GLCU_STAAR      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
GLCU_STAAN      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
GLCU_STAAM      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
GLCU_STAAC      GQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSMTQIIFGLIAMILLVTGVALTSLKAK
RBSU_LACPL      AQIVTFKVFT--MVGSSRAMPITTAFQLLGASLWGVFALGDWPGAMDKXXXXXXXXXXXXXXWLTVWSEH
RBSU_LACJO      XQILTFHSFT--LVGSSRAMPITTAFQLLGTSLWGVFALGDWPSTSDKLVGFXXXXXXXXGAWMTTWSEH
GLCU_BACCR      GQANQLKSI--DLMGVSRTMPISTGLQLVATTLFGVIVFHEWSTTISVVLGILALVCIIIGVILTSLQSE
GLCU_BACC1      GQANQLKSI--DLMGVSRTMPISTGLQLVATTLFGVIVFHEWSTTISVVLGVLALVCIIIGVILTSLQSE
GLCU_STAXY      GQGYQLKSVS--LIGVSKTMPISTGLQLVGTTLFSAIFLGEWSGVQVTLGLVAMVLLVIGIALTSIKGKN
GLCU_BACAN      GQANQLKSI--DLMGVSRTMPISTGLQLVSTTLFGVIVFHEWSTSVVLGVLALVCIIIGVILTSLQSEEE
Y2157_STRA5     GQNGQFQAMK--YMGVSVANPLSSGAQLVGGSLVGALVFHEWTKPIQFILGLTALTLLVIGFYFSSKRDV
Y2116_STRA3     GQNGQFQAMK--YMGVSVANPLSSGAQLVGGSLVGALVFHEWTKPIQFILGLTALTLLVIGFYFSSKRDV
YSUP_LACDL      ---------------------------------------------------------------------D
Y2243_STRP8     GQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGSLALLLLIVGFYFSSKQDD
Y2205_STRP1     GQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGSLALLLLIVGFYFSSKQDD
Y1874_STRP6     GQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGSLALLLLIIGFYFSSKQDD
Y1856_STRP3     GQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGSLALLLLIVGFYFSSKQDD
Y444_LISIN      GQLLQFKGIAAS--SVAKAMPISNGTQLVGATLFAVLVFQEWQXXXXXXXXXXXXXXXXXXXXMTGFQKR
Y424_LISMO      GQLLQFKGIAAS--SVAKAMPISNGTQLVGATLFAVLVFREWQXXXXXXXXXXXXXXXXXXXXMTGFQKR


                         +         .         .         .         .         *         .:210
query           NKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFATRETSALTARE
YSUP_LACHE      -KSAKLKMRDIILLLFTSIGYWIYSSFPKAITA---NAQTLFLPQMXXXXXXXXXXXXXXRQTKVLKEKA
Y2594_LACPL     GRKKGFSC--YLPLLMTTIGYWIYSCIPKLV---KVDALQLFLPQMLGILIVAVGWAIYHQPT-VYRDKQ
Y170_LACJO      GTSESNQVSTIILLVLTSLGYITSSS---IPKALHGNSVSIFFGQTFGMLVAVFIYTLVTKNLHVWKEKS
Y169_LISMO      HKDENSGKKGIITLLISSVG---YVGYVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKR--FTKQ
Y212_LISIN      HKDENSGKKGIVTLLISSVG---YVGYVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKR--FTKQ
Y928_ENTFA      DSQPKTSNKGIRALIFSTVGYGVYTIIINATG---LDPWGIILPQSIGMLVGASFFAFKKVKVD----RF
Y2503_LACPL     DPNRSASENGIRALILSTIG---YAGYTIVVHYGNVNAQAVVMPQAVGMLLGALIWSF---KDKPWVVKA
RBSU_STAES      KQQESKNLRSVLLLLVGEIGYWIYSA---APQATDIGGFKAFLPQAIGMVIVAVIYALMNSKGNAFKEKV
RBSU_STAEQ      KQQESKNLRSVILLLVGEIGYWIYSA---APQATDIGGFKAFLPQAIGMVIVAVIYALMNSKGNAFKEKV
RBSU_ENTFA      ESAESAGIKAVLLLAVGEIGYWAYSAAPQATAIDGMH---AFLPQAIGMVIVAVIYTIKGGEISPFIEAV
GLCU_BACME      XXXXXXXXXXIVILLISTVGYLVYVVVARL---FNVDGWSALLPQAIGMVIGGVLLTFKHKPFNKYAIRN
RBSU_LACSS      XXXXXXXXXXXXXXXXXXXXXXXYSAFPQAVSADGFQG---FLPQAIGMTIVGIIFGLTQTKKDYKPFKE
GLCU_BACSU      NDKKSNLKKGILILLVSTLGYLVYVVVARL---FNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRN
RBSU_STAAN      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKSNPFRNKI
RBSU_STAAM      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKSNPFRNKI
RBSU_STAAW      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKANPFRNKI
RBSU_STAAS      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKANPFRNKI
RBSU_STAAR      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKANPFRNKI
RBSU_STAAC      KEASNAKNRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMVIVAVIYGFMNMKANPFRNKI
Y220_BACC1      ENAQPPGKKGLLTLIVSTFGYLVY-----VIIIRNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRN
Y219_BACCR      ENAQPPGKKGLLTLIVSTFGYLVY-----VIIIRNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRN
Y200_BACAN      ENAQPPGKKGLLTLIVSTFGYLVY-----VIIIRNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRN
Y215_LISIN      EEDGTNALKQLITLVISSLG---YVGLVVLIQGFKIDGINAILPQAIGMVLSALIMTHSGGTEKRFNKR-
Y176_LISMO      EEDGTNALKQLITLFISACG---YVGLVVLIQGFKIDGINAILPQAIGMVISALIMTHSGGTEKRFNKR-
GLCU_STAES      GKSDNPEFKKAMILLLSTIG---YVGYVVLGDIFGVSGTDALFFQSIGMAIGGLILSMNHNTSIKSTA--
GLCU_STAEQ      GKSDNPEFKKAMILLLSTIG---YVGYVVLGDIFGVSGTDALFFQSIGMAIGGLILSMNHNTSIKSTA--
YXFA_LACLA      GRNYT---KGLTALTYSTLGYVIYVILFNNLAVLHFDTLTIILPMSVGMIFGALVM----GRFKIKMEKY
GLCU_STAAW      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
GLCU_STAAS      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
GLCU_STAAR      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
GLCU_STAAN      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
GLCU_STAAM      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
GLCU_STAAC      NERQSDNKKAMGILIVSTVG---YVGFVVLGDIFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA--
RBSU_LACPL      KDAGNARTQAVIWLAVGEIGYWAYSAAPQ---ATNIGGEEAFVPQAIGMVIVSIVFLASRGEKLALVEGV
RBSU_LACJO      KTDENSAKKAVIILLVGEIGYWAYSAAPQ---AAKIDGSKAFLPQAIGMCLVAICYAVYLKQRSALAQGV
GLCU_BACCR      NAEQAANFKGIVILLISTVGYLVYVVVIRL---FNVDGWSALLPQAVGMVLGGILLTF------------
GLCU_BACC1      EEKNAEQARGIIILLISTVGYLVYVVVIRL---FNVDGWSALLPQAVGMVLGGILLTF------------
GLCU_STAXY      EASESSKGKAMPILLISTXXXXXXXXXAQIFGVDGMN--ALFF-QSIGMAIGGLI-LSAKHETS---VKS
GLCU_BACAN      KNAEQAGKRGIIILLISTVGYLVYVVVIRL---FNVDGWSALLPQAVGMVLGGILLTF------------
Y2157_STRA5     SEQALATSKGFATIAYSTVGYISYAVLFN--NIMKFDAMAVILPMAVGMCLGAICFM-------------
Y2116_STRA3     SEQALATSKGFATIAYSTVGYISYAVLFN--NIMKFDAMAVILPMAVGMCLGAICFM-------------
YSUP_LACDL      GFTQKTTNKDILFLVLTTXGYLAYXAXPKTITA---DAESMFLPQTLGILLGSVIYLAFSGNKAAFKEKA
Y2243_STRP8     ANAQVNHLKGFRALTYSTIGYVMYAVLFN--NIMKFEVLSVILPMAVGMVLGAITFMSFKISIDQYVIKN
Y2205_STRP1     ANAQVNHLKGFRALTYSTIGYVMYAVLFN--NIMKFEVLSVILPMAVGMVLGAITFMSFKISIDQYVIKN
Y1874_STRP6     ANAQVNHLKGFRALTYSTIGYVMYAVLFN--NIMKFEVLSVILPMAVGMVLGAITFMSFKISIDQYVIKN
Y1856_STRP3     ANAQVNHLKGFRALTYSTIGYVMYAVLFN--NIMKFEVLSVILPMAVGMVLGAITFMSFKISIDQYVIKN
Y444_LISIN      GNHITESVSFHVYGIVILSSFFL-TLYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKK--TAISRKN
Y424_LISMO      GNHITESVSFHVYGIVILSSFFL-TLYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKK--TAISRKN


                         .         .         .         +         .         .         .:280
query           SWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRExxxxxxxxxxxxx
YSUP_LACHE      TWLNIFSGFSYGIAAFSYIFSAQLNGVITAFIYSQLCVIISTLGGIFFIGENKTKSE-------------
Y2594_LACPL     SWQNTLPGILYGIAAFMYILSARSIGVTNAYIIGQLSVVISTLSGLFFLHER------------------
Y170_LACJO      TVQSXXXXXXXXXXXXXXXXSVQDNGVNMAFVISQLCVVISTLGGLIFLHEKKTRK--------------
Y169_LISMO      TWLNMIPGVMWATGNLALLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKE-------------
Y212_LISIN      TWLNMIPGVMWATGNLALLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKE-------------
Y928_ENTFA      VWMNMTTGLLWGLGNICMLLTMREIGLAISFSLSQMGIIISTLGGIFLLGERKSKKE-------------
Y2503_LACPL     TYRNIVTGLVWGIGNLFMFMAMAQIGQAVAYSLSQMGIVISTFGSIYLLGEHKTKRE-------------
RBSU_STAES      SWQQIISGFFFAFAALTYLISAQPNGLATGFVLSQTSVVLATLTGIFFLNQKKTSKE-------------
RBSU_STAEQ      SWQQTISGFFFAFAALTYLISAQPNGLATGFVLSQTSVVLATLTGIFFLNQKKTSKE-------------
RBSU_ENTFA      SYKQIFSGFFFAFAALTYLISAQPNGLATGFILSQTSVVLATLTGIWFLGQKKTAKE-------------
GLCU_BACME      ----IIPGLIWAAGNMFLFISQPKVGVATSFSLSQMGIVISTLGGIIILGEKKTKRQ-------------
RBSU_LACSS      SYKNIFSGFFFAFAALTYLISAQPNGLATGFVLSQTSVIFATIGGIYILKEKKSKKE-------------
GLCU_BACSU      ----ILPGLIWAGGNMFLFISQPRVGVATSFSLSQMGIVISTLGGIFILREKKTKRQ-------------
RBSU_STAAN      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
RBSU_STAAM      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
RBSU_STAAW      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
RBSU_STAAS      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
RBSU_STAAR      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
RBSU_STAAC      TWLQIISGFFFAFGALTYLISAQPNGLATGFILSQTSVVLATLTGIYFLKQHKTSKE-------------
Y220_BACC1      A----LSXXXXXXXXXXXXXXXPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQ-------------
Y219_BACCR      A----LSXXXXXXXXXXXXXXXPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQ-------------
Y200_BACAN      A----LSXXXXXXXXXXXXXXXPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQ-------------
Y215_LISIN      TLLLIIPGMIWAAGNVAMVHANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTQKE-------------
Y176_LISMO      TLLLTIPGVIWAAGNVAMVHANQLVGVATGFSLSQLGVVISTIGGIILLKEKKTQKE-------------
GLCU_STAES      --LNLIPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGEKKDRRQ-------------
GLCU_STAEQ      --LNLIPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGEKKDRRQ-------------
YXFA_LACLA      VYQNMIVGAMWGVGNIFMLMXXXXXXXXXXXXXXQLGVIVSTIGGILFLGEKKTKKE-------------
GLCU_STAAW      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
GLCU_STAAS      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
GLCU_STAAR      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
GLCU_STAAN      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
GLCU_STAAM      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
GLCU_STAAC      --LNLLPGVIWGIGNLFMFYSQPKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ-------------
RBSU_LACPL      SYTHIISGFFFAFAALTYLISAQPNGLATGFILSQTSVVLATLTGIWFLGQKKTTKE-------------
RBSU_LACJO      SYKQIISGFFFAFAALTYLISAQPNGLATGFILSQTSVVLATLTGIWFLHEKKTKKE-------------
GLCU_BACCR      ----------------------------------------------------------------------
GLCU_BACC1      ----------------------------------------------------------------------
GLCU_STAXY      TLWNLIPGIVWGIGNLFMFYSQPKVGVATSFSFSQLLVIVSTLGGIFLLGEKKDKRQ-------------
GLCU_BACAN      ----------------------------------------------------------------------
Y2157_STRA5     ----------------------------------------------------------------------
Y2116_STRA3     ----------------------------------------------------------------------
YSUP_LACDL      SYLDLXXXXXXXXXXXXXXXXXQVNGVTNAFIYGQLSVIISTIGGMTLLGERKQGKE-------------
Y2243_STRP8     S----VVGLLWGIGNIFMLLAASKAGLAIAFSFSQLGAIISIVGGILFLGETKTKKE-------------
Y2205_STRP1     S----VVGLLWGIGNIFMLLAASKAGLAIAFSFSQLGAIISIVGGILFLGETKTKKE-------------
Y1874_STRP6     S----VVGLLWGIGNIFMLLAASKAGLAIAFSFSQLGAIISIVGGILFLGETKTKKE-------------
Y1856_STRP3     S----VVGLLWGIGNIFMLLAASKAGLAIAFSFSQLGAIISIVGGILFLGETKTKKE-------------
Y444_LISIN      VTFNLMTGLSWSIANLGMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLE-------------
Y424_LISMO      VTFNLMTGLSWSIANLGMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLE-------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxx
YSUP_LACHE      --------
Y2594_LACPL     --------
Y170_LACJO      --------
Y169_LISMO      --------
Y212_LISIN      --------
Y928_ENTFA      --------
Y2503_LACPL     --------
RBSU_STAES      --------
RBSU_STAEQ      --------
RBSU_ENTFA      --------
GLCU_BACME      --------
RBSU_LACSS      --------
GLCU_BACSU      --------
RBSU_STAAN      --------
RBSU_STAAM      --------
RBSU_STAAW      --------
RBSU_STAAS      --------
RBSU_STAAR      --------
RBSU_STAAC      --------
Y220_BACC1      --------
Y219_BACCR      --------
Y200_BACAN      --------
Y215_LISIN      --------
Y176_LISMO      --------
GLCU_STAES      --------
GLCU_STAEQ      --------
YXFA_LACLA      --------
GLCU_STAAW      --------
GLCU_STAAS      --------
GLCU_STAAR      --------
GLCU_STAAN      --------
GLCU_STAAM      --------
GLCU_STAAC      --------
RBSU_LACPL      --------
RBSU_LACJO      --------
GLCU_BACCR      --------
GLCU_BACC1      --------
GLCU_STAXY      --------
GLCU_BACAN      --------
Y2157_STRA5     --------
Y2116_STRA3     --------
YSUP_LACDL      --------
Y2243_STRP8     --------
Y2205_STRP1     --------
Y1874_STRP6     --------
Y1856_STRP3     --------
Y444_LISIN      --------
Y424_LISMO      --------