[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD98845.1

[Show Plain Result]


## Summary of Sequence Search
    1::448
   17::249     8e-06  24%  256 aa  YJJP_SHIFL RecName: Full=Inner membrane protein yjjP;
   17::249     8e-06  24%  256 aa  YJJP_ECOLI RecName: Full=Inner membrane protein yjjP;
    1::448

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIMLLSYGTGAWRVRDSMNA
YJJP_SHIFL      --------------------------------------------------GLFLLQHGAESALVDELSSR
YJJP_ECOLI      --------------------------------------------------GLFLLQHGAESALVDELSSR


                         .         .         *         .         .         .         .:140
query           IARELNISCSADVGLVSIEYTCVDEEGHGYTQALSLASTGVNTDKLSEMEQFVMDFNKGGSDLSSEQIHE
YJJP_SHIFL      LGRALGMSVESSISSNAIVLTTI-KDGQCLTSTRKNHDRGINMHVVTEVQHIVILAEHHLLDYKG--VEK
YJJP_ECOLI      LGRALGMSVESSISSNAIVLTTI-KDGQCLTSTRKNHDRGINMHVVTEVQHIVILAEHHLLDYKG--VEK


                         +         .         .         .         .         *         .:210
query           ILDEIERKPGHYTXXXXXXXXXXXXXXFVFLLGGGLVEMLCSFVGAGFGNYIRRKMIERRITLLXXXXXX
YJJP_SHIFL      RFSQIQ--PLRYPRWLVALMVGLSCACFCKLNNGGWDGAVITFFASTTAMYIRQLLAQRHL---------
YJJP_ECOLI      RFSQIQ--PLRYPRWLVALMVGLSCACFCKLNNGGWDGAVITFFASTTAMYIRQLLAQRHL---------


                         .         .         .         +         .         .         .:280
query           XXXXXIFYLIAFKSLVAIMHVSLQHEAGYIGAMLFVIPGFPFITSGLDIAKLDMRSGLERMMYAIMIITV
YJJP_SHIFL      -HPQINFCLTAFAALLQLPTFSNTPTIAMAASVLLLVPGFPLINAVADMFKGHINTGLARWAIA-SLLTL
YJJP_ECOLI      -HPQINFCLTAFAALLQLPTFSNTPTIAMAASVLLLVPGFPLINAVADMFKGHINTGLARWAIA-SLLTL


                         .         *         .         .         .         .         +:350
query           ATLVGWVVAMAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJJP_SHIFL      ATCVGVVMALTI----------------------------------------------------------
YJJP_ECOLI      ATCVGVVMALTI----------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJJP_SHIFL      ----------------------------------------------------------------------
YJJP_ECOLI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
YJJP_SHIFL      ----------------------------
YJJP_ECOLI      ----------------------------