[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD98850.1

[Show Plain Result]


## Summary of Sequence Search
    1::380
    5::379     e-121  57%  380 aa  METC_LACLM RecName: Full=Cystathionine beta-lyase;       
    5::379     e-121  57%  380 aa  METC_LACLA RecName: Full=Cystathionine beta-lyase;       
    5::379     e-120  57%  380 aa  METC_LACLC RecName: Full=Cystathionine beta-lyase;       
    1::379     e-113  53%  380 aa  METB_HELPJ RecName: Full=Cystathionine gamma-synthase;       
    1::380     e-112  53%  380 aa  METB_HELPY RecName: Full=Cystathionine gamma-synthase;       
    1::379     e-106  52%  379 aa  MCCB_BACSU RecName: Full=Cystathionine gamma-lyase;       
    8::386     9e-91  46%  387 aa  CGL_DICDI RecName: Full=Cystathionine gamma-lyase;       
    9::384     2e-88  44%  390 aa  METC_BACSU RecName: Full=Cystathionine beta-lyase metC;       
   16::388     3e-88  49%  388 aa  METB_MYCLE RecName: Full=Cystathionine gamma-synthase;       
   12::387     9e-88  51%  387 aa  METC_COXBU RecName: Full=Cystathionine beta-lyase;       
   16::387     2e-83  47%  388 aa  METB_MYCTU RecName: Full=Cystathionine gamma-synthase;       
   16::387     2e-83  47%  388 aa  METB_MYCBO RecName: Full=Cystathionine gamma-synthase;       
    6::365     8e-81  44%  373 aa  METB_BACSU RecName: Full=Cystathionine gamma-synthase;       
   18::394     2e-78  44%  405 aa  CGL_PIG RecName: Full=Cystathionine gamma-lyase;       
    7::372     1e-77  44%  392 aa  CGL_CAEEL RecName: Full=Putative cystathionine gamma-lyase;        
    8::364     4e-75  42%  369 aa  METB_HAEIN RecName: Full=Cystathionine gamma-synthase;       
    5::308     9e-75  46%  319 aa  METB_HERAU RecName: Full=Probable cystathionine gamma-synthase;    
   18::379     6e-74  43%  405 aa  CGL_MACFA RecName: Full=Cystathionine gamma-lyase;       
   18::381     2e-73  43%  405 aa  CGL_BOVIN RecName: Full=Cystathionine gamma-lyase;       
   17::378     1e-72  43%  398 aa  CGL_MOUSE RecName: Full=Cystathionine gamma-lyase;       
    8::389     2e-72  44%  394 aa  CYS3_YEAST RecName: Full=Cystathionine gamma-lyase;       
   17::378     2e-71  42%  398 aa  CGL_RAT RecName: Full=Cystathionine gamma-lyase;       
   18::394     4e-71  41%  405 aa  CGL_HUMAN RecName: Full=Cystathionine gamma-lyase;       
  103::455     1e-67  39%  464 aa  METC_ARATH RecName: Full=Cystathionine beta-lyase, chloroplastic;  
  224::563     3e-66  39%  563 aa  METB_ARATH RecName: Full=Cystathionine gamma-synthase,
   10::394     3e-66  43%  398 aa  MEGL_PSEPU RecName: Full=Methionine gamma-lyase;       
    4::377     8e-65  38%  386 aa  METB_ECOLI RecName: Full=Cystathionine gamma-synthase;       
   67::400     1e-55  36%  403 aa  METZ_PSEAE RecName: Full=O-succinylhomoserine sulfhydrylase;       
   10::382     1e-54  34%  390 aa  CBL_SCHPO RecName: Full=Cystathionine beta-lyase;       
    5::404     1e-45  34%  465 aa  STR3_YEAST RecName: Full=Cystathionine beta-lyase;       
   64::379     2e-44  35%  396 aa  METC_BORAV RecName: Full=Cystathionine beta-lyase;       
   55::388     6e-41  32%  396 aa  METC_RHIL3 RecName: Full=Putative cystathionine beta-lyase;        
    8::427     3e-39  35%  429 aa  CYSD_SCHPO RecName: Full=O-acetylhomoserine (thiol)-lyase;       
    5::394     1e-37  28%  395 aa  METC_ECOLI RecName: Full=Cystathionine beta-lyase metC;       
    8::426     7e-35  34%  437 aa  CYSD_EMENI RecName: Full=O-acetylhomoserine (thiol)-lyase;       
    5::394     2e-34  28%  395 aa  METC_SALTY RecName: Full=Cystathionine beta-lyase;       
    9::395     4e-34  27%  396 aa  METC_HAEIN RecName: Full=Cystathionine beta-lyase;       
   51::374     1e-33  32%  392 aa  CYSA_STRCO RecName: Full=Putative cystathionine gamma-lyase;       
    5::438     2e-33  34%  444 aa  MET17_YEAST RecName: Full=Protein MET17;Includes:  RecName:
    5::431     4e-30  30%  444 aa  MET17_KLULA RecName: Full=Protein MET17;Includes:  RecName:
    6::374     6e-29  30%  378 aa  YHR2_YEAST RecName: Full=Uncharacterized trans-sulfuration enzyme
   14::340     4e-28  31%  340 aa  METC_YEAST RecName: Full=Putative cystathionine beta-lyase;        
  121::392     1e-25  36%  398 aa  YFHE_SCHPO RecName: Full=Uncharacterized trans-sulfuration enzyme
  265::611     3e-17  27%  621 aa  MET7_NEUCR RecName: Full=Cystathionine gamma-synthase;       
  366::609     6e-13  26%  610 aa  MET7_SCHPO RecName: Full=Probable cystathionine gamma-synthase;    
  303::567     2e-12  28%  575 aa  METW_YEAST RecName: Full=Putative cystathionine gamma-synthase
  367::635     4e-12  27%  639 aa  MET7_YEAST RecName: Full=Cystathionine gamma-synthase;       
  390::645     3e-11  25%  649 aa  METX_YEAST RecName: Full=Putative cystathionine gamma-synthase
    1::380

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVXXXX
METC_LACLM      ---KTKVIHGGISTDKTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGVQGFA
METC_LACLA      ---KTKVIHGGISTDKTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGVQGFA
METC_LACLC      ---KTKVIHGGISTDRTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGVQGFA
METB_HELPJ      MRMQTKLIHGGINEDATTGAVSVPIYQTSTYRQDAIGRHKGYEYSRSGNPTRFALEELIADLEGGVKGFA
METB_HELPY      MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGRHKGYEYSRSGNPTRFALEELIADLEGGVKGFA
MCCB_BACSU      MKKKTLMIHGGITGDEKTGAVSVPIYQVSTYKQPKAGQHTGYEYSRTANPTRTALEALVTELESGEAGYA
CGL_DICDI       -KIGTNVIHAGQSADKNTGAVIVPISLSTTFLQPSPGVHSEYDYSRSGNPTRKAFEECIAACENAKYALS
METC_BACSU      ---ETQLVHNPFKTDGGTGAVSVPIQHASTFHQSSFEEFGAYDYSRSGTPTRTALEETIAALEGGTRGFA
METB_MYCLE      ----TKAIHAGYRPDPATGAVNVPIYASSTFAQDGVGERGGFEYARTGNPMRAALEASLATVEEGVFARA
METC_COXBU      ---DTRVIHAGQKPDPLTGAVMTPIYTASTYAQKSPGVHQGYEYSRSQNPTRFAYERCVADLESGQHGFA
METB_MYCTU      ----TRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGRGGFEYARTGNPTRXXXXXXXXXXXXXXFARA
METB_MYCBO      ----TRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGRGGFEYARTGNPTRXXXXXXXXXXXXXXFARA
METB_BACSU      ---ETKLAQIGNRSDEVTGTVSAPIYLSTAYRHRGIGESTGFDYVRTKNPTRQLVEDAIANLENGARGLA
CGL_PIG         --FATQAIHAGQEPEQASKAVVPPISLSTTFKQEAPGQHSGFEYSRSGNPTXNCLEKAVAVLDGAKYSLA
CGL_CAEEL       --FGTAAIHVGQEPEQDMNQVVPPISLSSTYKQDNPGEPKGHDYSRAGNPTRDVLQKNLAALEDAKHCQV
METB_HAEIN      ---DTLLAQAGNRSDERTGAVSAPIFLSTAYGHCGIGESTGFDYTRTKNPTRTVLEETIAKLENGDRGFA
METB_HERAU      --FATRAIHAGQDPESVTGAVIVPIYQTSTYAQRGVGDHTGYEYSRTDNPTRTALQTCLAALEEAKHALV
CGL_MACFA       --FATQAIHVGQEPEQWTSAVVPLISLSTTFKQAAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
CGL_BOVIN       --FATQAIHVGQEPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYSLA
CGL_MOUSE       --FATQAIHVGQEPEQWNSAVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCLEKAVAALDGAKHSLA
CYS3_YEAST      -KFATKAIHAGEHVD-VHGSVIEPISLSTTFKQSS-PANPTYEYSRSQNPNRENLERAVAALENAQYGLA
CGL_RAT         --FATQAIHVGPEPEQSSRAVVLPISLATTFKQDSPGQSSGFVYSRSGNPTRNCLEKAVAALDGAKHCLT
CGL_HUMAN       --FATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
METC_ARATH      -------------------AMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFC
METB_ARATH      -----------------------------------------FEYGRYGNPTTVVLEDKISALEGAESTLV
MEGL_PSEPU      --FATRAIHHGYDPQDHGGALVPPVYQTATFTEYGAGEQAGHFYSRISNPTLNLLEARXXXXXXXXXXXX
METB_ECOLI      -KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRXXXXXXXXXXXVL
METZ_PSEAE      -------------------------------------------YSRYTNPTVRTFEERIAALEGAEQAVA
CBL_SCHPO       ---DTELVHVEGNEDQYH-ASSVPIYQSATFKQPCLEHMGKFDYTRSGNPTRSVLQVHLAKLMKAKHAFV
STR3_YEAST      -RLDTVVVNTGSQNDQHSASVP-PVYLSTTF-KVDLNNEDNYDYSRSGNPTRSVLQHQIGKLENVLAVSS
METC_BORAV      -------------------------------------------YGRMGMDTHAALEQVFAELEGGTHCYL
METC_RHIL3      ----------------------------------------KYTYGTRGTPTTDALCEAIDALEGSAGTIL
CYSD_SCHPO      --FETLQLHAGQEPDAATSSRAVPIYATTSFRDCDHGGRPGYIYSRMMNPTADVFEKRIXXXXXXXXXXX
METC_ECOLI      -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
CYSD_EMENI      -RFETLQLHAGQEPDPATNSRAVPIYATTSYHGARLFGLKEFGYSRIMNPTVDVFEKRIAALEGXXXXXX
METC_SALTY      -QLDTKLVNAGRSKKYTLGSVNSVIQRASSLHATRNLANGELFYGRRGTLTHFSLQEAMCELEGGAGCAL
METC_HAEIN      ----TMFIHSGRQKRFSQGSVNPVLQRASSLHATQRRAKGELFYGRRGTLTHFALQDLMCEMEGGAGCYL
CYSA_STRCO      ---------------------------------FHLPGDPTYTYGRDENPTWTRLESAIGELEAGVETLV
MET17_YEAST     --FDTVQLHAGQENDNAHRSRAVPIYATTSYHGSQLFGLPGYVYSRFQNPTSNVLEERIXXXXXXXXXXX
MET17_KLULA     --FDTLQLHAGQEKTDAHNPRAVPIYATTSYHGAQLFGTPGYIYSRIMNPTLDVLEKXXXXXXXXXXXXT
YHR2_YEAST      ----TALIHGDDKDNRVTD-VAPPINVSTTF-RYDDDDLIPWTYSRLAHPNSTRLESIFSEILDGYAVIY
METC_YEAST      ----TQLSVIGRNPDEQSGFVNPPLYKGSTIILKKLSDLEQRKYGTAGSPTIDNLENAWTHLTGGAGTVX
YFHE_SCHPO      ----------------------------------------------------------------------
MET7_NEUCR      ---------------------------------HDLGGSPSLSEKQMSSNTRG-----IANLREEDIYLF
MET7_SCHPO      ----------------------------------------------------------------------
METW_YEAST      ----------------------------------------------------------------------
MET7_YEAST      ----------------------------------------------------------------------
METX_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
METC_LACLM      FSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLMDKVLTKTGIIYDLVDLSNLDDLKAAFKEETKAIYF
METC_LACLA      FSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLMDKVLTKTGIIYDLVDLSNLDDLKAAFKEETKAIYF
METC_LACLC      FSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLVDKVLTKTGIIYDLVDLSNLEDLKAAFKAETKAVYF
METB_HELPJ      FASGLAGIHAVFSLLQSGDHVLLGDDVYGGNFRLFNKVLVKNGLSCTIIDTSDLSQIKKAIKPNTKALYL
METB_HELPY      FASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNQVLVKNGLSCTIIDTSDISQIKKAIKPNTKALYL
MCCB_BACSU      FSSGMAAITAVMMLFNSGDHVVLTDDVYGGTYRVMTKVLNRLGIESTFVDTSSREEVEKAIRPNTKAIYI
CGL_DICDI       FASGLATLTTITHLLKSGDEVISIDDVYGGTRRYFTRVAANFDLKFSFVDLSTLDDLKNAFTDKTRLVWI
METC_BACSU      FSSGMAAISTAFLLLSQGDHVLVTEDVYGGTFRMVTEVLTRFGIEHTFVDMTDRNEVARSIKPNTKVIYM
METB_MYCLE      FSSGMAASDCALRMLRPGDHVIIPDDVYGGTFRLIDKVFTQWNVDYTPVPLSDLDAVRAAITSRTRLIWV
METC_COXBU      FASGMAATATILELLQPGDHVVVMDDVYGGSYRLFENVRKRSGLSFSFVDFTDENKVREAVTAKTKMLWV
METB_MYCTU      FSSGMAATDCALAMLRPGDHVVIPDDAYGGTFRLIDKVFTRWDVQYTPVRLADLDAVGAAITPRTRLIWV
METB_MYCBO      FSSGMAATDCALAMLRPGDHVVIPDDAYGGTFRLIDKVFTRWDVQYTPVRLADLDAVGAAITPRTRLIWV
METB_BACSU      FSSGMAAIQTIMALFKSGDELIVSSDLYGGTYRLFENEWKKYGLTFHYDDFSDEDCLRSKITPNTKAVFV
CGL_PIG         FASGLAATVTITHLLKAGXQIISMDDVYGGTNRYFRQVAAEFGLKISFVDCSKSKLLEAAITPETKLVWI
CGL_CAEEL       FSSGLAATSAIINLLKYGDHIVCSDDVYGGTQRYIRRVVPNHGLEVDSVDLTDVQNLEKAIKPNTKMVWF
METB_HAEIN      FSSGMAAIQVLMTLFTAPDEWIVSSDVYGGTYRLLDFSYKNNNVKPVYVNTASASAIEAAINPNTKAIFI
METB_HERAU      FASGLGASTTLMLMLKAGDHVICGDDVYGGTYRLFQRVMTEHGLSFDFIDMADPEAVRAAIKPNTRLIWL
CGL_MACFA       FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
CGL_BOVIN       FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVATEFGLKISFVDCSKPKLLEAAITPETKLVWI
CGL_MOUSE       FASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWI
CYS3_YEAST      FSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVEFTNDLLNDLPQL---IKENTKLVWI
CGL_RAT         FARGLAATTTITHLLKAGDEVICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWI
CGL_HUMAN       FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
METC_ARATH      FTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQXXXXXXXXXXXXNTTKLDEVAAAIGPQTKLVWL
METB_ARATH      MASGMCASTVMLALVPAGGHIVTTTDCYRKTRIFMENFLPKLGITVTVIDPADIAGLEAAVNEFKVSLFF
MEGL_PSEPU      XXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYF
METB_ECOLI      TNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLV
METZ_PSEAE      TASGMSAILAVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQVDYPPLSDLAAWEAACKPNTKLFFV
CBL_SCHPO       TSNGMSALDMILRCCKSNSHVVAGHDLYGGSDRLLSFNQRQYGFKVDNVDTSDLAAFEAALRPDTNLVLI
STR3_YEAST      GMTALDVILRGLVLLNGTDNIIAGDDLYGGTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQDKVDCVLL
METC_BORAV      ASSGLAGISMVFSLLSAGEHALVADCAYGPVHELHEAVLSRLGIDVTFFDAKDLASL---VRPTTRLIFA
METC_RHIL3      VPSGLAAVTIPFGFVAAGDHALVVDSVYGPTRHFCDTMLKRLGVEVEYYHPEIGAGIETLFRSNTKLVHT
CYSD_SCHPO      XXXXXXXLFALTTLAKAGDNIVSTSYLYGGTYNLFKVTLPRLGITTKFVNGDDPNDLAAQIDENTKAVYV
METC_ECOLI      FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
CYSD_EMENI      XXXXXXXXFMAISALAAGDNIVSTSNLYGGTYNQFKVLFPRLGITTKFVQGXXXXXXXXXXXXRTKAVYV
METC_SALTY      FPCGAAAVANTILAFVEQDHILMTNTAYEPSQDFCSKILGKLGVTTSWFDPLIGADITQHIQPNTKVVFL
METC_HAEIN      YPCGTAAVNSILSFVKTGDHVLMSGAAYEPTQYFCNIVLKKMQIDITYYDPLIGEDIATLIQPNTKVLFL
CYSA_STRCO      FASGMAAISSVFSQLRAGDTAVLPDDGYQA-LPLVRAQLEAYGIEVRTAPTGRDAQLD--VLDGAKLLWI
MET17_YEAST     XXXXXXXXTAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYL
MET17_KLULA     SSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYL
YHR2_YEAST      SSGLAA-FYAAMVHYNPKKIFIGQS--YHGVRAIANILTRNYGIEQHPLEDIEKCASEGDI------VHL
METC_YEAST      XXXXXXXXXXXXXXXXXXDHILMTDSVYVPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFL
YFHE_SCHPO      ---------------------------YSGTIQIIARINRLTGLETSFIDGKCDAIGEGDV------IWL
MET7_NEUCR      PCGMNAIFHAHRALYSIRTKSVNFGFPYVDTLKILEKFNPSGALFYGHGSKSDLDDLETRLEERYLALFC
MET7_SCHPO      --------------------------------------------------------------EKVMALFC
METW_YEAST      -------------------------------------------------DVVELQKFLETSKQRILAVFV
MET7_YEAST      -------------------------------------------------DSTSMNALKNILHEQILAVFI
METX_YEAST      --------------------------------------------------------------EQILAVFI


                         +         .         .         .         .         *         .:210
query           ETPTNPLLQXXXXXXXXXXXXXXXXXXXVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
METC_LACLM      ETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTT
METC_LACLA      ETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTT
METC_LACLC      ETPSNPLLKVLDIKEISSIAKAHNALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTT
METB_HELPJ      ETPSNPLLKITDLAQCASVAKEHNLLTIVDNTFATPYCQNPLLLGTDIVAHNGTKYLGGHSDVVAGLVTT
METB_HELPY      ETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLVTT
MCCB_BACSU      ETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQPLTLGADIVLHSATKYLGGHSDVVGGLVVT
CGL_DICDI       ETPTNPLLKVADIKAVADYVHSRGATLVVDNTFMSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVLAT
METC_BACSU      ETPSNPTLGITDIKAVVQLAKENGCLTFLDNTFMTPALQRPLDLGVDIVLHSATKFLSGHSDVLSGLAAV
METB_MYCLE      ETPTNPLLSIADITSIGELGKKHSVKVLVDNTFASPALQQPLMLGADVVLHSTTKYIGGHSDVVGGALVT
METC_COXBU      ESPSNPRLKIVDLXXXXXXXXXXXXXXVADNTFATPIIQRPLELGFDIVTHSATKYLNGHSDIIGGVAVV
METB_MYCTU      ETPTNPLLSIADITAIAELGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVT
METB_MYCBO      ETPTNPLLSIADITAIAELGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVT
METB_BACSU      ETPTNPLMQEADIEHIARITKEHGLLLIVDNTFYTPVLQRPLELGADIVIHSATKYLGGHNDLLAGLVVV
CGL_PIG         ETPTNPILKMIDIEACAQIVHKHGDIILVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSL
CGL_CAEEL       ESPSNPLLKVVDIAAVVQTAKKANPEIVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAVIT
METB_HAEIN      ETPSNPLMEECDVVEIAKLAKKHNLMLIVDNTFLTPVLSRPLDLGADVVIHSGTKYIAGHNDALVGLIVA
METB_HERAU      ETPTNPLLKLAPIAAITRVAREHGIWTIVDNTFASPYNQRPITLGADMVLHSTTKYIGGHSDVVGGAIMT
CGL_MACFA       ETPTNPVLKMIDIEACAHIVHKRGDIILVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGLVSV
CGL_BOVIN       ETPTNPSLKMIDIEACAHTVHKHGDIILVDNTFMSAYFQRPLSLGADICMYSATKYMNGYSDVVMGLVSL
CGL_MOUSE       ETPTNPTLKLADIGACAQIVHKRGDIILVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSV
CYS3_YEAST      ETPTNPTLKVTDIQKVADLIKKHAAGQDVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLAT
CGL_RAT         ETPTNPTLKLADIKACAQIVHKHKDIILVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSV
CGL_HUMAN       ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
METC_ARATH      ESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAV
METB_ARATH      ESPTNPFLRCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAG-CIC
MEGL_PSEPU      ESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIVVG
METB_ECOLI      ESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIA
METZ_PSEAE      ESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDXXXXXXXXXXXX
CBL_SCHPO       ESPTNPRISICDIRAIVKITRSKAKDALLDNTMLSPVLCNPLDFGYDIVYESATKYLSGHHDLMGGVIAT
STR3_YEAST      ESPTNPLCKVVDIPRILRFVKCISPDTTVDNTMMSGLNCNPLQLGCDVVYESATKYLNGHHDLMGGVIIS
METC_BORAV      EAPGSLLFEMLDMPALARFAKQHDLILATDNTWGSGYIYRPLTLGAQVSVIAGTKYVGGHSDLMLGAVVT
METC_RHIL3      EAPGSNTFEMQDIPAISAVAHRHGAVVMMDNTWATPVYFRPLDHGVDISIHASTKYPSGHSDILLG-TVS
CYSD_SCHPO      ESIGNPMYNVPDFERIAEVAHAAGVPLMVDNTFGGGYLVRPIDHGADIVTHSATKWXGYHGMVFTETFGN
METC_ECOLI      ESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVC
CYSD_EMENI      ETIGNPRYNVPDFEVIAKVAHEKGIPLVVDNTFAGGYFVRPIEHGADIVVHSATKWXXXXXXXXXXXXXD
METC_SALTY      ESPGSITMEVHDIPSIVSAVRRVAPEAVIDNTWAAGVLFKALEFDIDISIQAGTKYLIGHSDAMVGTAV-
METC_HAEIN      EAPSSITMEIPDIPTIVKAARKVNPNIVIDNTWSAGVLFKALEHDIDISIQAGTKYLVGHSDIMIGTAV-
CYSA_STRCO      ETPSNPGLDVCDVRRLVEAAHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYVAG
MET17_YEAST     ETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFAGGYFCQPIKYGADIVTHSATKWXXXXXXXXXXXXVD
MET17_KLULA     ESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFAGGFFCQPIKYGADIVTHSATKWXXGYHGLIFNDAFG
YHR2_YEAST      ESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVV
METC_YEAST      ESPGSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLA-S
YFHE_SCHPO      ETPLNPLGIAFDIPFYKELAKKKGAILVVDSTFAPPPIQDALVLGADYVVHSATKYLAGHSDVLAGVTAS
MET7_NEUCR      EFPGNPLLTCPDLVRIRELADKYEFAVVVDETIGTFANVNVLQF-ADIVVSSLTKIFSGDCNVMGGGAIF
MET7_SCHPO      EFPSNPLLNSPDLVRIRKLADSYDFAVVVDETIGNFVNVEVLPL-ADVVVSSLTKIFSGDSNVMGGSMVL
METW_YEAST      ETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGLPY--------ADIVSTSLTKLFNGASNVMGGSVVL
MET7_YEAST      EAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIFSGDSNVIAGSLVL
METX_YEAST      ETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTFSGDSNVIGGSMVL


                         .         .         .         +         .         .         .:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
METC_LACLM      NSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSH
METC_LACLA      NSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSH
METC_LACLC      NSNELAIEIGFLQNSIGAVLGPQDSWLVQRGIKTLAPRMEAHSANAQKIAEFLEASQAVSKVYYPGLVNH
METB_HELPJ      NNEALAQEFDFFQNAIGGVLGLQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTH
METB_HELPY      NNEALAQEIAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTH
MCCB_BACSU      ASKELGEELHFVQNSTGGVLGPQDSWLLMRGIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSSNH
CGL_DICDI       NNDELYAKLKFLQNSIGAVPSPFDCFLALRGLKTLHVRMEAHQKNAFAICNFLEKHPKVERVIYPGLPSH
METC_BACSU      KDEELGKQLYKLQNAFGAVLGVQDCWLVLRGLKTLQVRLEKASQTAQRLAEFFQKHPAVKRVYYPGLADH
METB_MYCLE      NDEELDQAFGFLQNGAGAVPSPFDAYLTMRGLKTLVLRMQRHNENAITVAEFLAGHPSVSAVLYPGLPSH
METC_COXBU      GDNKLAEQLKYLQNAIGAIAAPFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLPSH
METB_MYCTU      NDEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSH
METB_MYCBO      NDEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSH
METB_BACSU      KDERLGEEMFQHQNAIGAVLPPFDSWLLMRGMKTLSLRMRQHXXXXXXXXXXXXXXXXISDVLYPGK---
CGL_PIG         NSETLHSRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYPGLPSH
CGL_CAEEL       DNDEFQQHLFFMQLAVGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSH
METB_HAEIN      KGQELCDRIAYIQNGAGAVLSPFDSWLTIRGMKTLSLRMKRHQENAQAIAEFLKAQPQVESVLYP-----
METB_HERAU      SNDELYEKLKFLQNAAGAVPGPFDCWLVLRGVKTLSIRMRDDERNALAIAQFLTEHPGVEKVIYPGLPSH
CGL_MACFA       NCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPGVEKVIYPGLPSH
CGL_BOVIN       NSESLHDRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESNPQVEKVIYPGLPSH
CGL_MOUSE       NSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYPGLPSH
CYS3_YEAST      NNKPLYERLQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADENVVAVNYPGLKTH
CGL_RAT         TSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSH
CGL_HUMAN       NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
METC_ARATH      KGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGLPDH
METB_ARATH      GSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLPSH
MEGL_PSEPU      SQALVDRRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLASF
METB_ECOLI      KDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPEN
METZ_PSEAE      XXEQMKEVVGFLRTA-GPTLSPFNAWLFLKGLETLRIRMQXXXXXXXXXXEWLERQPGIERVYYAGLPSH
CBL_SCHPO       KSDEIAKSVFFNINAMGAAMAPFECFLLLRGIKTMGLRVERAQQNAIEIAKFLKS--KGLQVNFPGLPDA
STR3_YEAST      KTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSNKATKTRFVGLRSN
METC_BORAV      NDEAIAKRLNRTQYALGYSVSADDAWLALRGVRTMPVRMAQHARHALEVCEFLQNRPEVVRLYHPAWPAD
METC_RHIL3      ANAEHWERLKEANGVLGICGAPDDAYQILRGLRTMGLRLERHYESALDIAKWLEGRDDVARVLHPALPSF
CYSD_SCHPO      LAYAFACRTQTLRD-VGGNANPFGVFLLLQGLETLSLRMERHVQNAFALAKYLEKHPKVNWVSYPGLESH
METC_ECOLI      N-ARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
CYSD_EMENI      SGKNAARFPQFTQPSLGSALNPFAAQQLILGLETLSLRAERHASNALALANWLKKNDHVSWVSYVGLEEH
METC_SALTY      ANARCWEQLRENAYLMGQMLDADTAYMTSRGLRTLGVRLRQHQESSLKIAAWLANHPQVARVNHPALPGS
METC_HAEIN      ANARTWDQLREHSYLMGQMVDADSAYTTARGIRTLGVRLKQHQESSIKVAKWLSEQPEVKTVYHPALPSC
CYSA_STRCO      RDAGAMAAVRRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYPGLPDD
MET17_YEAST     SGEKFPQNLAYLLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASH
MET17_KLULA     PAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYLESSPYVSWVSYPGLPSH
YHR2_YEAST      KEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHDKVLKTIYHS--SL
METC_YEAST      ANEECWPLLRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDC
YFHE_SCHPO      KDRSKILDLKADRAYLGTILHPQQAFLLLRSLRTFPLRIAKHSENGFLVAQHLNTDEQFATSL--GIDSS
MET7_NEUCR      NPNSYSALKSFVQQQLEDTYWPEDVIFMERNSRDFVARIDRVNANAEAICRVLQDHPLVKTLYYPKYNDS
MET7_SCHPO      SSRYYSRIKDAMKXXXXXXXXXXXXXXXXRNSRDFAERSQVINHNAETICNLLYQNPKIKTLYYPKYNTS
METW_YEAST      NPKSSLYPYAFRSANFEDLLWCEDAIVLERNSRDFEDRTLRANANTGILLNDLEEGKICKKIYYPTVTSF
MET7_YEAST      NPREFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVNTNTDILLKRVQVGKLFKKIYYPSLTS-
METX_YEAST      NPQEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARIRINYSTEYLLDKILKENKLFKKIYYPNLTSL


                         .         *         .         .         .         .         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
METC_LACLM      PGHEIAKKQMSAFGGMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIG
METC_LACLA      PGHEIAKKQMSAFGGMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIG
METC_LACLC      EGHEIAKKQMTAFGGMISFELTDENAVKNFVENLRYFTLAESLGGVESLIEVPAVMTHASIPKELREEIG
METB_HELPJ      PNHELAKAQMRGFSGMFSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPALMTHACIPKAQREAAG
METB_HELPY      PNYELAKKQMRGFSGMLSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREAAG
MCCB_BACSU      PGHELAKTQGAGFGGMISFDIGSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRERRLELG
CGL_DICDI       PQHEICKRQMKGYGGMVVFFVKGSIDSRSFLENIKLFALAESLGGVESLIELPSVMTHASVPAEERAKLG
METC_BACSU      PGAETHKSQSTGAGAVLSFELESKEAVKKLVENVSLPVFAVSLGAVESILSYPATMSHAAMPKEEREKRG
METB_MYCLE      PGHEVAARQMRGFGGMVSLRMRAGLAAQDLCARTKVFTLAESLGGVESLIEQPSAMTHASTTGS-QLE--
METC_COXBU      PQHSIAKKQMRYFGGMISVELKCDLETKKVLERCQLFTLAESLGGVESLIEHPAIMTHASIPQAERQKLG
METB_MYCTU      PGHEIAARQMRGFGGMVSVRMRAGRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGS-QLE--
METB_MYCBO      PGHEIAARQMRGFGGMVSVRMRAGRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGS-QLE--
METB_BACSU      -------------GGMLSFRLQKEEWVNPFLKALKTICFAESLGGVESFITYPATQTHMDIPEEIRIANG
CGL_PIG         PQHELAKRQCTGCPGMISFYIKGSLHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLG
CGL_CAEEL       PQHEVHEKQTKGMSGMISFYLKGELESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLG
METB_HAEIN      -----------NKGGMLSFRLQDEAWVNTFLKSIKLITFAESLGGTESFITYPATQTHMDIPESERVARG
METB_HERAU      PQHNLAREQMRGFGGMISILLKGGAE--------------------------------------------
CGL_MACFA       PQHELAKRQCTGCTGMITFYIKGTLQAEIFLKNLKLFTLAESLGGFESLVELPAIMTHASVPKNDRDVLG
CGL_BOVIN       PQHELAKRQCTGCPGMVTFYIKGSLQAETFLQNLKLFTLAESLGGYESLAELPAIMTHASVPKSDREVLG
CGL_MOUSE       PQHELAKRQCSGCPGMVSFYIKGALQAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPEKDRATLG
CYS3_YEAST      PNYDVVLKQHRDAGGMISFRIKGGAEASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASG
CGL_RAT         PQHELAKRQCTGCPGMVSFYIKGTLQAQVFLKNIKLFALAESLGGYESLAELPAIMTHASVPEKDRATLG
CGL_HUMAN       PQHELVKRQCTGCTGMVTFYIKGTLQAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLG
METC_ARATH      PGHHLHFSQAKGAGSVFSFITGSVALSKHLVETTKYFSIAVSFGSVKSLISMPCFMSHASIPAEVREARG
METB_ARATH      PEHELAKRQMTGFGGVVSFEIDGDIETTKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYG
MEGL_PSEPU      PQYTLARQQMSQPGGMIAFELKGGIGARRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYG
METB_ECOLI      QGHEIAARQQKGFGAMLSFELDGDEQTRRFLGGLSLFTLAESLGGVESLISHAATMTHXXXXXXXXXXXG
METZ_PSEAE      PQHELARRQQSGFGAVVSFDVKGGRDAARFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAG
CBL_SCHPO       KSTAIFYSFARGPGAVMSVFTGDVEVSKTIVNTTKLFEISVSFGAVNSLISMPAYMSHASIKKEVRDARG
STR3_YEAST      PDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERD
METC_BORAV      PGHALWQRDCSGSNGMLAVQL--GLSARDFVNALTLFGIGFSWGGFESLVQ---LVTPGELARHQYWQGG
METC_RHIL3      PSHHLWKRDFKGASGIFSFVLAADGPEKSFLDALRIFGLGYSWGGFESL------ALHAYLNDRTVAKAP
CYSD_SCHPO      VSHKLAKKYLKNYGAVLSFGAKGGPDSRKVVNALKLASQLANVGDAKTLVIAPAYTTHLQLTDEEQISAG
METC_ECOLI      KGHEFWKRDFTGSSGLFSFVLKKKLNNEEYLDNFSLFSMAYSWGGYESLIHIAAIRPQGEI--------D
CYSD_EMENI      SSHEVAKKYLKRFGGVLSFGVKEAAVGSQVVDNFKLISNLANVGDSKTLAIHPWSTTHEQLTDQERIDSG
METC_SALTY      KGHAFWKRDFTGSSGLFSFVLNKKLELSAYLDNFSLFSMAYSWGGYESLI----IANQPEQIAAIRPAGG
METC_HAEIN      PGHEXXXXXXXXXXXXXXXELTQRLTSEKFMDHFQLFAMAYSWGGFESLINQPEEIAH----IRPNIKRN
CYSA_STRCO      PSHKVASQQMLRYGCVVSFTLPSXXXXXXXXXXXXXVEGATSFGGVRSTAERRGRWGGDAVP--------
MET17_YEAST     SHHENAKKYLSNFGGVLSFGVKDKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASG
MET17_KLULA     SHHENAKKYLENFGGVLSFGVKDKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASG
YHR2_YEAST      QTEEFVKKQLGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAM-----------TDPY
METC_YEAST      PGHEYWVRDYKGSSGLFSIVLKNGFGLEKMVEGMKVLQLGFSWGG-------------------------
YFHE_SCHPO      LILEVAKNLTGGHASCFSVLLKSDTVAKHLCCELKYFHHATSLGSVESLIEWRRM-----------TDSK
MET7_NEUCR      ANYEAVKLPQGGYGGLISVVLKGKKQAVAFYDAIET-AKGPSLGTNFTLTS-PYVLLAHYQELDWAEQYG
MET7_SCHPO      KEHEACRRENGGYGGLLSVVFHNPEDARQFYDKIQVAK-GPSLGTNFTLASPYAILAHYQ-ELDWAGENG
METW_YEAST      ENYESVRNERGGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSN--GTNFTLACPYVLAHHSELEEVS-KFG
MET7_YEAST      ---EDTKRNYDSYGGLFSLTFFNIEEAKKFFNNLELCK-GPSLGTNFTLACPYAIIAHYQELDEVA-QYG
METX_YEAST      TNYDMVRKKEGGYGGLFSLTFHDEDHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYH-ELDMAEKFG


                         .         .         .         .         *         .         .:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIG
METC_LACLM      IKDGLIRLSVGVEAIEDLLTDIKEALEK--
METC_LACLA      IKDGLIRLSVGVEAIEDLLTDIKEALEK--
METC_LACLC      IKDGLIRLSVGVEALEDLLTDLKEALEK--
METB_HELPJ      IRDGLVRLSVGIEHEQDLLEDLDQAFAKI-
METB_HELPY      IRDGLVRLSVGIEHXXXXXXXXXXAFAKIG
MCCB_BACSU      ITDGLIRISVGIEDAEDLLEDIGQALENI-
CGL_DICDI       ISDTLIRLSVGIEDINDLLADISQALDK--
METC_BACSU      ITDGLLRLSVGVEHADDLEHDFEQALKEI-
METB_MYCLE      VPDDLVRLSVGIEDVGDLLCDLKQALN---
METC_COXBU      ITDGFIRLSVGIEAITDLRHDLEAAL----
METB_MYCTU      VPDDLVRLSVGIEDIADLLGDLEQAL----
METB_MYCBO      VPDDLVRLSVGIEDIADLLGDLEQAL----
METB_BACSU      VCNRLLRFSVGIEHAEDLKEDLKQALCQV-
CGL_PIG         IRDTLIRLSVGLEDKQDLMDDLDQAL----
CGL_CAEEL       ITDNLIRISVGIE-----------------
METB_HAEIN      ITNTLLRFSVGIEDVEDIKADLLQA-----
METB_HERAU      ------------------------------
CGL_MACFA       ISDTLIRLSVG-------------------
CGL_BOVIN       ISDTLIRLSVGLE-----------------
CGL_MOUSE       INDTLIRLSVG-------------------
CYS3_YEAST      VFDDLVRISVGIEDTDDLLEDIKQAL----
CGL_RAT         ISDTLIRLSVG-------------------
CGL_HUMAN       ISDTLIRLSVGXXXXXXXXXXXXQAL----
METC_ARATH      LTEDLVRISAGIEDVDDLISDL--------
METB_ARATH      IKDNLVRFSFGVEDFEDVKADILQALEAI-
MEGL_PSEPU      ISEGLVRLSVGLEDIDDLLADVQQAL----
METB_ECOLI      ISETLLRISTGIEDGEDLIADLE-------
METZ_PSEAE      IGDSLIRVAVGLEDLDDLKADMARGL----
CBL_SCHPO       LSEDLIRICVGIENVDDLKADLENAL----
STR3_YEAST      FPEDLVRLCCGIENIVDLKKDLLAAM----
METC_BORAV      -SDALVRLHIGLE-----------------
METC_RHIL3      TDGPVIRLQIGIEDVADLKADIER------
CYSD_SCHPO      VTKDLIRVAVGIEHIDDIIADFAQALE---
METC_ECOLI      FSGTLIRLHIGLEDVDDLIADLDAGFARI-
CYSD_EMENI      VTEDAIRISVGTEHIDDIIADFEQS-----
METC_SALTY      VTGTLVRVHIGLESVDDLIADLAAGFARI-
METC_HAEIN      LTGSLIRVHIGFENVDELIADLKAGFERI-
CYSA_STRCO      --EGFIRLSVGAE-----------------
MET17_YEAST     VTKDLIRVSVGIEFIDDIIADFQQSFETV-
MET17_KLULA     VTKDLIRVSVGTEFIDDIIADFE-------
YHR2_YEAST      IDQTLIRVSVGCESANDLIKDLASALKEL-
METC_YEAST      ------------------------------
YFHE_SCHPO      IDPRLVRLSIGIEDAADLIADLNR------
MET7_NEUCR      VDRNLIRISVGLEGTDELINVFTRAL----
MET7_SCHPO      IDRNLVRVSVGMEPSEHLKNVFINAL----
METW_YEAST      ADPNIIRVSVGLEDIQWLLKVFSSALDVV-
MET7_YEAST      VETNLVRVSVGLENSDVLCNVFQRAIEK--
METX_YEAST      VERNLLRISVGLESQSILGKIFQEAIDK--