[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD98951.1

[Show Plain Result]


## Summary of Sequence Search
    1::214
    3::209     3e-43  42%  209 aa  YDGI_BACSU RecName: Full=Putative NAD(P)H nitroreductase ydgI;     
    7::183     2e-27  39%  202 aa  YODC_BACSU RecName: Full=Putative NAD(P)H nitroreductase yodC;     
    3::205     2e-20  29%  206 aa  MHQN_BACSU RecName: Full=Putative NAD(P)H nitroreductase mhqN;     
   10::177     5e-16  31%  210 aa  DRGA_SYNY3 RecName: Full=Protein drgA;
   15::218     2e-13  27%  220 aa  Y2086_STAEQ RecName: Full=Putative NAD(P)H nitroreductase SERP2086;
   10::198     2e-13  29%  200 aa  Y809_STRP6 RecName: Full=Putative NAD(P)H nitroreductase Spy0809;  
   15::218     2e-13  27%  220 aa  Y2073_STAES RecName: Full=Putative NAD(P)H nitroreductase SE_2073; 
   15::217     3e-13  28%  218 aa  Y546_STAHJ RecName: Full=Putative NAD(P)H nitroreductase SH0546;   
    2::192     3e-13  33%  217 aa  NFNB_ENTCL RecName: Full=Oxygen-insensitive NAD(P)H nitroreductase;
    2::192     6e-12  30%  217 aa  NFNB_SALTY RecName: Full=Oxygen-insensitive NAD(P)H nitroreductase;
   15::171     8e-12  30%  221 aa  YFKO_BACSU RecName: Full=Putative NAD(P)H nitroreductase yfkO;     
   15::217     1e-11  24%  219 aa  Y379_STAS1 RecName: Full=Putative NAD(P)H nitroreductase SSP0379;  
   16::207     1e-10  26%  210 aa  RDXA_HELPJ RecName: Full=Oxygen-insensitive NADPH nitroreductase;  
   15::218     3e-10  28%  223 aa  Y2829_STAA8 RecName: Full=Putative NAD(P)H nitroreductase
   15::218     3e-10  28%  223 aa  Y2534_STAAC RecName: Full=Putative NAD(P)H nitroreductase
   15::218     3e-10  28%  223 aa  Y2462_STAA3 RecName: Full=Putative NAD(P)H nitroreductase
   15::218     4e-10  28%  223 aa  Y2523_STAAM RecName: Full=Putative NAD(P)H nitroreductase SAV2523; 
   15::218     4e-10  28%  223 aa  Y2443_STAAW RecName: Full=Putative NAD(P)H nitroreductase MW2443;  
   15::218     4e-10  28%  223 aa  Y2409_STAAS RecName: Full=Putative NAD(P)H nitroreductase SAS2409; 
   15::218     4e-10  28%  223 aa  Y2397_STAAB RecName: Full=Putative NAD(P)H nitroreductase SAB2397c;
   15::218     4e-10  28%  223 aa  Y2311_STAAN RecName: Full=Putative NAD(P)H nitroreductase SA2311;  
   16::207     6e-10  25%  210 aa  RDXA_HELPH RecName: Full=Oxygen-insensitive NADPH nitroreductase;  
   16::207     7e-10  25%  210 aa  RDXA_HELPY RecName: Full=Oxygen-insensitive NADPH nitroreductase;  
    1::218     1e-09  27%  220 aa  Y1278_HAEIN RecName: Full=Putative NAD(P)H nitroreductase;       
   12::215     2e-09  23%  218 aa  FRA1_VIBFI RecName: Full=Major NAD(P)H-flavin oxidoreductase;      
    2::192     6e-09  28%  217 aa  NFNB_ECOLI RecName: Full=Oxygen-insensitive NAD(P)H nitroreductase;
    3::190     1e-08  27%  210 aa  RDXA_HELAH RecName: Full=Oxygen-insensitive NADPH nitroreductase;  
    2::164     5e-08  29%  249 aa  NFRA_BACSU RecName: Full=Nitro/flavin reductase;       
   31::191     3e-07  25%  196 aa  RUTE_ECOSM RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   28::152     8e-07  33%  196 aa  Y3601_PSEU5 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_SHIDS RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECOLC RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     1e-06  27%  196 aa  RUTE_ECOL5 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECOHS RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     1e-06  27%  196 aa  RUTE_ECO81 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECO5E RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECO57 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECOLU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     1e-06  24%  196 aa  RUTE_ECO7I RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   27::149     2e-06  32%  195 aa  Y018_CAUSK RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     2e-06  24%  196 aa  RUTE_SHIFL RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     2e-06  24%  196 aa  RUTE_SHIF8 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     2e-06  27%  196 aa  RUTE_ECOL6 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     2e-06  24%  196 aa  RUTE_ECO8A RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   85::146     2e-06  35%  285 aa  IYD1_MOUSE RecName: Full=Iodotyrosine dehalogenase 1;       
   44::193     2e-06  25%  196 aa  Y2476_STRGG RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     2e-06  27%  196 aa  RUTE_ECOSE RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     2e-06  27%  196 aa  RUTE_ECO55 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     2e-06  27%  196 aa  RUTE_ECO27 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     2e-06  27%  196 aa  RUTE_ECO24 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   89::150     2e-06  34%  289 aa  IYD1_HUMAN RecName: Full=Iodotyrosine dehalogenase 1;       
   43::195     3e-06  32%  195 aa  Y1060_BURS3 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   44::161     3e-06  27%  196 aa  Y1008_KLEP7 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     3e-06  27%  196 aa  RUTE_ECOUT RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     3e-06  24%  196 aa  RUTE_ECOLI RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     3e-06  27%  196 aa  RUTE_ECOK1 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     3e-06  24%  196 aa  RUTE_ECODH RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     3e-06  24%  196 aa  RUTE_ECOBW RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::150     3e-06  27%  196 aa  RUTE_ECO45 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   85::146     3e-06  34%  285 aa  IYD1_RAT RecName: Full=Iodotyrosine dehalogenase 1;       
   31::157     4e-06  26%  196 aa  Y1521_ENT38 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   31::191     5e-06  24%  196 aa  RUTE_SHISS RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   28::196     1e-05  25%  196 aa  Y587_XANC5 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   30::198     1e-05  25%  198 aa  Y554_XANAC RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   28::157     2e-05  29%  196 aa  Y585_XANCB RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   28::157     2e-05  29%  196 aa  Y568_XANC8 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   44::192     2e-05  25%  197 aa  Y3612_PARL1 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   28::157     2e-05  29%  196 aa  Y3605_XANCP RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   43::190     3e-05  25%  195 aa  Y870_RALPJ RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   43::191     4e-05  24%  196 aa  Y4764_RHOPT RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   11::93      4e-05  33%  174 aa  Y2267_ARCFU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   89::146     5e-05  33%  289 aa  IYD1_PIG RecName: Full=Iodotyrosine dehalogenase 1;       
   30::198     7e-05  25%  198 aa  Y4267_XANOR RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   44::161     7e-05  26%  196 aa  Y3524_KLEP3 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
    9::184     7e-05  25%  205 aa  NOX_THET8 RecName: Full=NADH dehydrogenase;       
   89::144     7e-05  32%  289 aa  IYD1_PONAB RecName: Full=Iodotyrosine dehalogenase 1;       
   28::196     2e-04  24%  196 aa  Y4023_XANOM RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   43::152     2e-04  26%  195 aa  Y1004_RALSO RecName: Full=Putative NADH dehydrogenase/NAD(P)H
  121::191     2e-04  35%  196 aa  Y932_POLSQ RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   32::191     2e-04  25%  196 aa  Y2366_ENTS8 RecName: Full=Putative NADH dehydrogenase/NAD(P)H
    6::65      2e-04  38%  172 aa  Y226_ARCFU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   32::81      3e-04  36%  191 aa  Y120_METTH RecName: Full=Putative NADH dehydrogenase/NAD(P)H
    3::160     4e-04  29%  243 aa  CHRR_PSEUG RecName: Full=CR(VI) reductase;         EC=1.-.-.-;
  147::204     6e-04  36%  344 aa  YKH5_CAEEL RecName: Full=Uncharacterized protein C02C2.5;
   28::196     6e-04  24%  196 aa  Y3909_XANOP RecName: Full=Putative NADH dehydrogenase/NAD(P)H
    1::214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTNFKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
YDGI_BACSU      ----KTNDFMEIMKGRRSIRNYDPAVKISKEEMTEILEEATTAPSSVNAQPWRFLVIDSPEGKEKLAPL-
YODC_BACSU      -----------VLKARASVKEYDTNAPISKEELTELLDLATKAPSAWNLQHWHFTVFHSDESKAELLP--
MHQN_BACSU      -------EFTHLVNERRSASNFLSGHPITKEDLNEMFELVALAPSAFNLQHTKYVTVLDQDVKEKLKQ--
DRGA_SYNY3      ---------------RRSVKHFDPDHRLTAEEERKLHEAAIQAPTSFNIQLWRFLIIRDPQLRQTIREKY
Y2086_STAEQ     ---------------RHATKEFDPTKKISDEDFNTILETGRLSPSSLGLEPWHFVVVQNKELREKLKAYS
Y809_STRP6      ---------------RHAIKTFNDQ-PVDYEDLRTAIEIATLAPSANNIQPWKFVVVQ--EKKAELAKGL
Y2073_STAES     ---------------RHATKEFDPTKKISDEDFNTILETGRLSPSSLGLEPWHFVVVQNKELREKLKAYS
Y546_STAHJ      ---------------RHATKEFDPEKKVSESDFHTILETGRLSPSSLGLEPWRFVVIENEDLKEKLKPYS
NFNB_ENTCL      -------DIISVALKRHSTKAFDASKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIVASTEEGKAKSAAGT
NFNB_SALTY      -------DIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
YFKO_BACSU      ---------------RHATKEFDPNKKVSDSDFEFILETGRLSPSSLGLEPWKFVVVQNPEFREKLREYT
Y379_STAS1      ---------------RHATKRFDANKKISESDFNTILETGRLSPSSLGLEPWRFVVIQNREIRDKLKAIS
RDXA_HELPJ      ---------------RHSCKMFDSHYEFSSTELEEIAEIARLSPSSYNTQPWHFVMVTNKDLKKQIAA-H
Y2829_STAA8     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2534_STAAC     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2462_STAA3     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2523_STAAM     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2443_STAAW     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2409_STAAS     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2397_STAAB     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
Y2311_STAAN     ---------------RHATKQFDPQKKVSKEDFETILESGRLSPSSLGLEPWKFVVIQDQALRDELKAHS
RDXA_HELPH      ---------------RHSCKMFDSHYEFSSTELEEIAEIARLSPSSYNTQPWHFVMVTNKDLKKQIAA-H
RDXA_HELPY      ---------------RHSCKMFDSHYEFSSTELEEIAEIARLSPSSYNTQPWHFVMVTDKDLKKQIAA-H
Y1278_HAEIN     MTQLTREQVLELFHQRSSTRYYDPTKKISDEDFECILECGRLSPSSVGSEPWKFLVIQNKTLREKMKPFS
FRA1_VIBFI      ---------------RYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFIVIESDAAKQRMHDSF
NFNB_ECOLI      -------DIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSA
RDXA_HELAH      ---FLNQEKRKQLLNRHSCKMFDKHYTFSXXXXXXXXXXXXXXPSSYNTQPWHFVMVTNKDLKNQIAA-H
NFRA_BACSU      -----NNTIETI-LNHRSIRSF-TDQLLTAEEIDTLVKSAQAASTSSYVQAYSIIGVSDPEKKRELS--V
RUTE_ECOSM      ------------------------------ETLRELYALMKWGPTSANCSPARFVFIRTAEGKERLRPAL
Y3601_PSEU5     ---------------------------VPDALLEQLYEHVRLGPTAVNSCPARFVFVRSAEGKQKLAPCL
RUTE_SHIDS      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOLC      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOL5      ------------------------------ETLREIYAQMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOHS      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECO81      ------------------------------ETLREIYAQMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECO5E      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECO57      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOLU      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECO7I      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
Y018_CAUSK      ---------------------------IPEAVLRELYDLVKFGPTAANTTPARFVFVQSPEAKARLAALS
RUTE_SHIFL      ------------------------------ETLQELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_SHIF8      ------------------------------ETLQELYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOL6      ------------------------------ETLREIYALMKWGPTSANCSPTRIVFIRTAEGKERLRPAL
RUTE_ECO8A      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
IYD1_MOUSE      ----RSQEFYELLNKRRSVR-FISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
Y2476_STRGG     -------------------------------------------PTAFNQSPLRVVLVRSAEGRERLVQHM
RUTE_ECOSE      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTVEGKERLRPAL
RUTE_ECO55      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTVEGKERLRPAL
RUTE_ECO27      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECO24      ------------------------------ETLRELYALMKWGPTSANCSPARIVFIRTVEGKERLRPAL
IYD1_HUMAN      ----RSQEFYELLNKRRSVR-FISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIR---
Y1060_BURS3     -------------------------------------------PTSANASPARFVFVKSPEAKARLKPAL
Y1008_KLEP7     -------------------------------------------PTSANCSPARIVFVRSAEGKEKLRPTL
RUTE_ECOUT      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECOLI      ------------------------------ETLREIYALMKWGPTSANCSPARIVFTRTAEGKERLRPAL
RUTE_ECOK1      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
RUTE_ECODH      ------------------------------ETLREIYALMKWGPTSANCSPARIVFTRTAEGKERLRPAL
RUTE_ECOBW      ------------------------------ETLREIYALMKWGPTSANCSPARIVFTRTAEGKERLRPAL
RUTE_ECO45      ------------------------------ETLREIYALMKWGPTSANCSPARIVFIRTAEGKERLRPAL
IYD1_RAT        ----RSQEFYELLSKRRSIR-FISSEPVPMEVIDNVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIR---
Y1521_ENT38     ------------------------------ETLREIYDLMKWGPTSANCSPARIVFVRTPEGKEKLRPSL
RUTE_SHISS      ------------------------------ETLRELYAPIKWGPTSANCSPARIVFIRTVEGKERLHPAL
Y587_XANC5      ---------------------------VSHEVLRELYELVKWGPTAANSGPARFVFVTSAEGKAKLKPAL
Y554_XANAC      ---------------------------VSHEVLRELYELVKWGPTAANSCPARFVFVTSAEGKAKLKPAL
Y585_XANCB      ---------------------------VSEDLLRELYDLVKWGPTAANGSPARFVFVTTAEGKEKLK---
Y568_XANC8      ---------------------------VSEDLLRELYDLVKWGPTAANGSPARFVFVTTAEGKEKLK---
Y3612_PARL1     -------------------------------------------PTSANCSPARIIFVKSKEAKEKLAPAL
Y3605_XANCP     ---------------------------VSEDLLRELYDLVKWGPTAANGSPARFVFVTTAEGKEKLK---
Y870_RALPJ      -------------------------------------------PTAANSTPARFVFVKSAAAKERLIPCM
Y4764_RHOPT     ------------------------------------------APTAANSNPGRFVFVRSAEAKARLLKSV
Y2267_ARCFU     ---------------RRSIRVYSDR-QISDEDIEKILKAAMLAPSAGNEQPWHFIVVRDREMLKKMSEAF
IYD1_PIG        ----RSQEFYELLNKRRSVR-FISNERVPMEVIDNVIKAAGTAPSGAHTEPWTFVVVKDPDVK-------
Y4267_XANOR     ---------------------------VSQEVLRELYELVKWGPTAANSGPARFVFVTSADGKAKLKPAL
Y3524_KLEP3     -------------------------------------------PTSANCSPARIVFVRSAEGKEKLGPTL
NOX_THET8       -------DAKTAALKRRSIRRYRKD-PVPEGXXXXXXXXXXXXPSAWNLQPWRIVVVRDPATKRALRE--
IYD1_PONAB      ----RSREFYELLNKRRSVR-FISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPD---------
Y4023_XANOM     ---------------------------VSQEVLRELYELVKWGPTAANSGPARFVFVTSADGKARLKPAL
Y1004_RALSO     -------------------------------------------PTAANSTPARFVFVKSAAAKEQLVPCM
Y932_POLSQ      ----------------------------------------------------------------------
Y2366_ENTS8     -------------------------------QLRDLYEMVRLGPTSANCSPGRLLFVTTPQAKARLKPAL
Y226_ARCFU      -----------LLFRRVSIRKF-TQDDVDDEILMKILEAGNAAPSAGNLQARDFVVIRNPETKKRLAMAA
Y120_METTH      ---------------RRSIRKYQDR-EVPEELIDKILDAAMCGPSAVDERPWHFIVVRNREMLEKI----
CHRR_PSEUG      ---------KELLRNHSSVRIYDGN-PISKEIIEELIATAQMAATSHFVQAYSVIWVTDEEKKEKLG--M
YKH5_CAEEL      --------FYEEMKMRRSCRQF-SSRDVPLKVIQNLLKTAGTSPSVGNLQPWTFCVVSSDSIKTMIR---
Y3909_XANOP     ---------------------------VSQEVLRELYELVKWGSTAANSGPARFVFVTSADGKAKLKPAL


                         .         .         *         .         .         .         .:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
YDGI_BACSU      ASFNQTQVTTSSAVIAVFADMNNADYLEEIYSKAVELGYMPQEVKDRQIAALTAHFEKLPAQVNRETILI
YODC_BACSU      VAYNQKQIVESSAVVAILGDLKANENGEEVYAELASQGYITDEIKQTLLGQINGAYQS--EQFARDSAFL
MHQN_BACSU      AANGQYKXXXXXXXXXXXGDKQAYQQAADIYEGLKVLGILNKQEYDHMVQDTVSFYENRGEQFKRDEAIR
DRGA_SYNY3      --GNQAQMTDASLLILVAADVNAWDKDPAYWRN-------APREVANYLVGAIASFYGGKPQLQRDEAQR
Y2086_STAEQ     WGAQ-KQLDTASHFVLIFANVTAHTDYQHLLRGVKKYEESTIPAVENKFDDFQESFHIADNERTLYDASK
Y809_STRP6      PLANKVQVEQAQYVVALFSDTLALRSRKIARIGV---KSLPDDLIGYYMETLPPRFAAFNEVQTGEYLAI
Y2073_STAES     WGAQ-KQLDTASHFVLIFANVTAHTDYQHLLRGVKKYEESTIPAFENKFDDFQESFHIADNERTLYDASK
Y546_STAHJ      WGAQ-KQLNTASRFVII----LARKNVTADSEYVYEESTIPAVE-DKFNNFQTNFHINDNERTLLDWASK
NFNB_ENTCL      YVFNERKMLDASHVVVFCAKT--------AMDDAWLERVVDQEEADGRFNT--PEAKAANHKGRTVDLKD
NFNB_SALTY      YTFNERKMLDASHVVVFCAKT--------AMDDAWLERVVDQEDADGRFATPEAKAANDKGRRFFADSLK
YFKO_BACSU      WGAQ-KQLPTASHFVLILARTAKDIKYNAIKRHLKEVKQMPQDVYEGYLSKTEEFQKN-DLHLLESDASK
Y379_STAS1      WGAQ-GQLDTASHFVLILARTSQSDYVQHMIRNVKKYSEASIPATEKKFDDFQTNFHNDNDQSLLDWARK
RDXA_HELPJ      SYFNEEMIKSASALMVV----CSLKPSELLPTSHYMQNLYPESYKVRVIPSFLGVRFNHSMQKLESYILE
Y2829_STAA8     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2534_STAAC     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2462_STAA3     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2523_STAAM     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2443_STAAW     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2409_STAAS     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2397_STAAB     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
Y2311_STAAN     WG-AAKQLDTASHFVLIFARKNVIKKYEAQTIPAVEQKFDAFQADFHISDNDQALYDWSSKQ--------
RDXA_HELPH      SYFNEEMIKSASALMVV----CSLRPSELLPHGHYMQNLYPESYKVRVIPSFLGVRFNHSMQRLESYILE
RDXA_HELPY      SYFNEEMIKSASALMVV----CSLRPSELLPHGHYMQNLYPESYKVRVIPSFLGVRFNHSMQRLESYILE
Y1278_HAEIN     WGM-INQLDNCSHLVVI----LAKKNARPFFVDVMARKGLNAEQQQAALTKYKALQEE-DMKLLENDRTL
FRA1_VIBFI      AQFNQPHIKACSHVI-LFANKLSYTRYDVVLSKAVADKRITEEQKEAAFASFLNCDENGEHKAWTKP---
NFNB_ECOLI      YVFNERKMLDASHVVVFCAKT--------AMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADLHD
RDXA_HELAH      SYFNKDMIESASALVVV----CSLKPVELLPNGHYMQNLYDEPYRSRTLLSFLDLRFNHSMQKLESYILE
NFRA_BACSU      LAGNQPYVEKNGHFFVFCAD-------------LYRHQQLAEEKGEHISE----LLENTEMFMV---SLI
RUTE_ECOSM      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARS-----------------WFTSSPQLAEETAFR
Y3601_PSEU5     SKGNLDKTLAAPVTVVVAYD-------------------------EDFPETLPELFPHADARLITENALR
RUTE_SHIDS      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOLC      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOL5      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOHS      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO81      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO5E      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO57      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOLU      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO7I      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
Y018_CAUSK      SGSNGPKI-LQAPVTVIVGYDLDFP-----------------ETLDKLFPN-APGAKNGDPVAKEVGALR
RUTE_SHIFL      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_SHIF8      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOL6      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO8A      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
IYD1_MOUSE      ----------------------------------------------------------------------
Y2476_STRGG     AEGNRPKTATAPLVAILAADNEFHEELPALLPHFPQAKDLFFSE----------------RPVRESXXXX
RUTE_ECOSE      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO55      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO27      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO24      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
IYD1_HUMAN      ----------------------------------------------------------------------
Y1060_BURS3     SEGNLAKT-MAAPVTVIVGMDMAFH-----------------EHLPR-------LFPHADARLIETTAFR
Y1008_KLEP7     SSGNLQKTMQAPVTAIVAWDSAFYDRLPTLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOUT      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOLI      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOK1      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECODH      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECOBW      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
RUTE_ECO45      SSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFT-----------------SSPQLAEETAFR
IYD1_RAT        ----------------------------------------------------------------------
Y1521_ENT38     SSGNLAKTLAAPVTAIIAWDSEFYERLPELFPHGDARS-----------------WFTSSPALAEETAFR
RUTE_SHISS      SSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFT-----------------SSPQLAEETAFR
Y587_XANC5      SEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHADAKS-----------------WFDGPREGRTESAFR
Y554_XANAC      SEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHADAKS-----------------WFDGPREGRTESAFR
Y585_XANCB      -----PALSEGNAAKTLAAPVTAIIGFD---EDFHEKLPYLFPHADA------KSWFDGPRTARTESAFR
Y568_XANC8      -----PALSEGNAAKTLAAPVTAIIGFD---EDFHEKLPYLFPHADA------KSWFDGPRTARTESAFR
Y3612_PARL1     SEGNLKKTMAAPVTAIIGYDVEFYERLPELFPHDPTAKN----------------WFNWSKEWAEQTAFR
Y3605_XANCP     -----PALSEGNAAKTLAAPVTAIIGFD---EDFHEKLPYLFPHADA------KSWFDGPRTARTESAFR
Y870_RALPJ      SAGNQEKTRQAPVAVIVAYDTQFHEQLPKLFPH-----------------TDARSWYAGDQAKINAAALM
Y4764_RHOPT     APGNVDKVKAAPCCVIVAYDT----EFHDLLPQLFPARDMRSGFVGK-------------PELITETAKR
Y2267_ARCFU     TFGQM--LPNASAAIVVCADPKLSKYPYDMW---------------------------------------
IYD1_PIG        ----------------------------------------------------------------------
Y4267_XANOR     SEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHADAKSWFDGPREGRAESAFR-----------------
Y3524_KLEP3     SSGNLQKTMQAPVTAIVAWDRAFYDRLPTLFPHGDARSWFT-----------------SSPQLAEETAFR
NOX_THET8       AAFGQAHVEEAPVVLVLYADLEDALAH--LDEVIHPGVQGERREAQKIQRAFAAMGQEARK----AWASG
IYD1_PONAB      ----------------------------------------------------------------------
Y4023_XANOM     SEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHADAKSWFDGPREGRAESAFR-----------------
Y1004_RALSO     SAGNQEKTRQAPVTVIVAYDTQFHEQLPKLFPHVDARSWYA-----------------GDQARINAAALM
Y932_POLSQ      -------------------------------------------------------------------AFR
Y2366_ENTS8     SSGNVEKTMQAPVTAIVAWDS----------------------EFYEALPTLFP-YADARAWFTSSPAVA
Y226_ARCFU      LK--------------------------------------------------------------------
Y120_METTH      ----------------------------------------------------------------------
CHRR_PSEUG      LSGNPRQYETSGGAFVFCVD---FKRLQSAGK--LEGVDIVADSAENVL-----------------VGVA
YKH5_CAEEL      ----------------------------------------------------------------------
Y3909_XANOP     SEGNAAKTLAAPVTVIVAHDEDFHEKLPYLFPHADAKSWFDGPREGRAESAFR-----------------


                         +         .         .         .         .         *         .:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
YDGI_BACSU      DGGLVSMQLMLTARAHGYDTNPIGGYDKENIAETFGLDKERYVPVMLLSIGKAADEG--YASYRLPIDTI
YODC_BACSU      NASLAAMQLMIAAKAKGYDTCAIGGFNKEQFQKQFDIS-ERYVPVMLISIGKA-----------------
MHQN_BACSU      NASLSAMMFMLSAKEKGWDTCPMIGFDAEAVKRILNID-DQFEVVMMITIGKEKTESRRPRGYRKPVNEF
DRGA_SYNY3      SIGMAMQNLMLAAKAMGYDSCPMIGFDLQKVAELVKL-PADYAIGPMVAIGK------------------
Y2086_STAEQ     QTYIALANMMTSAALLGIDSCPIEGFDLDKVTEILSLDTEQFGISVMVGFGYR-AQEPKHGKVRQNEDDI
Y809_STRP6      NAGIVAMNLVLSLTDQKIASNIILGFDKSTTNGILDIDP-RFRPELLITVGYSDEKPE--PSYRLPVDEV
Y2073_STAES     QTYIALANMMTSAALLGIDSCPIEGFDLDKVTEILSLDTEQFGISVMVGFGYR-AQEPKHGKVRQNEDDI
Y546_STAHJ      QTYIALANMMTSAALLGIDSCPMEGFDLDKVTEILAVDTEHFAPSVMVAFGYRKEEPKD--KVRQPAEDV
NFNB_ENTCL      DDQWMAKQFLLGVGAMGLDAVPIEGFDAAILDEEFGLKEKGFTSLVVVPVG-------------------
NFNB_SALTY      DDHLNVGNFLLGVAAMGLDAVPIEGFDAEVLDAEFGLKEKGYTSLVVVPVG-------------------
YFKO_BACSU      QTYIALGNMMTAAAQIGVDSCPIEGF--------------------------------------------
Y379_STAS1      QTYIALGNMMTSAALLNIDSCPIEGFDLDAVTQFLTIDEAHFAPSVMVAFGYRETEPKD--KVRQTQDDI
RDXA_HELPJ      QCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEILEERINKPKIVCLIALGKRVAEASK-KSRKSKVDAI
Y2829_STAA8     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYRQQEPPKNK-TRQAYEDV
Y2534_STAAC     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYRQQEPPKNK-TRQAYEDV
Y2462_STAA3     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYRQQEPPKNK-TRQAYEDV
Y2523_STAAM     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYR-QQDPPKNKTRQAYEDV
Y2443_STAAW     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYR-QQDPPKNKTRQAYEDV
Y2409_STAAS     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYR-QQDPPKNKTRQAYEDV
Y2397_STAAB     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYR-QQDPPKNKTRQAYEDV
Y2311_STAAN     -TYIALGNMMTTAALLGIDSCPMEGFSLDTVTDILALDTEQFGLSVMVAFGYR-QQDPPKNKTRQAYEDV
RDXA_HELPH      QCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEVLEERINKPKIACLIALGKRVAEASQ-KSRKSKVDAI
RDXA_HELPY      QCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEVLEERINKPKIACLIALGKRVAEASQ-KSRKSKVDAI
Y1278_HAEIN     QTYIALANMLTGASALGIDSCPIEGFHYDKMNECLAFDPQEYAVSVAATFG---YRSRDIKKSRKGLDEV
FRA1_VIBFI      QAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELKGYECHVALAIGPSEDYNASLPKSRKAFEDV
NFNB_ECOLI      DAEWMAKQFXXXXXXXXXXXXPIEGFDAAILDAEFGLKEKGYTSLVVVPVG-------------------
RDXA_HELAH      QCYIAVGQICLGVSLMGLDSCIIGGFDALKVGEVLSQRINDPKIACLIALGK------------------
NFRA_BACSU      DAALAAQNMSIAAESMGLGICYIGGINELDKVTEVLQTPDHVLPLFGLAVG-------------------
RUTE_ECOSM      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
Y3601_PSEU5     NSSLQAGYLILAARALGLDCGPMSGFDGK-----------------------------------------
RUTE_SHIDS      NSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAF-FAVSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECOLC      NSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECOL5      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECOHS      NSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECO81      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECO5E      NSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECO57      NSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECOLU      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FTGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
RUTE_ECO7I      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FTGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
Y018_CAUSK      NSSLQGGYFILAARALGLDVGPMSGFD-------------------------------------------
RUTE_SHIFL      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_SHIF8      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
RUTE_ECOL6      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECO8A      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
IYD1_MOUSE      ----------------------------------------------------------------------
Y2476_STRGG     XXXXXXXYFIIGVRAAGLAAGPMTGYDAAGIQKEF-LDDD-HTPLMVVNIGKPGDDAWFPRSPRLSFDEV
RUTE_ECOSE      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECO55      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECO27      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECO24      NSSMQAAYLIVACRALGLDTGPMSGFD-------------------------------------------
IYD1_HUMAN      ----------------------------------------------------------------------
Y1060_BURS3     NSSLQGAYLILAARALGLDAGPMSGFDGAKAGTAIRSN-------FLVNLGYGDPAGLFPRSPRFDFDDI
Y1008_KLEP7     NSSLQAAYLIFACRARGLDTGPMSGFDREKVDAAFFAD--------------------------------
RUTE_ECOUT      NSSMQAAYLIFACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECOLI      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FTGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
RUTE_ECOK1      NSSMQAAYLIFACRALGLDTGPMSGFD-------------------------------------------
RUTE_ECODH      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FTGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
RUTE_ECOBW      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FTGSTLKSNLLINIGYGDSSKLYARLPRLSFEE-
RUTE_ECO45      NSSMQAAYLIFACRALGLDTGPMSGFD-------------------------------------------
IYD1_RAT        ----------------------------------------------------------------------
Y1521_ENT38     NSAMQAAYLIFACRALGLDTGPMSGFDRQKVDEA------------------------------------
RUTE_SHISS      NSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAF-FAGSTLKSNLLINIGYGDSSKLFARLPRLSFEE-
Y587_XANC5      NGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG----TPIKSVNLGYGDPAGLFPRSPRLSFDEA
Y554_XANAC      NGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG----TPIKSVNLGYGDPAGLFPRSPRLSFDEA
Y585_XANCB      NSSLQGAYLILAARALGLDAGPMSGFDNAKVDAA------------------------------------
Y568_XANC8      NSSLQGAYLILAARALGLDAGPMSGFDNAKVDAA------------------------------------
Y3612_PARL1     NGSLQGAYFMIAARSLGLDCGPMSGFDMRKVDDAFFAGTTVKVNFLC-NIGHGDPSALFARSPRLSFED-
Y3605_XANCP     NSSLQGAYLILAARALGLDAGPMSGFDNAKVDAA------------------------------------
Y870_RALPJ      NGSLQGGYLVLAARALGLDCGPMAGFDANKVNETFFPDGQWKVNFI-MNIGYGDAEKLHPRNPRLSFEE-
Y4764_RHOPT     NSALQGAYLILAARALGLDAGPMSGFD-HVALDAEFFPDGRWKSNFLCNIGYGDAEKLFPRNPRLAFED-
Y2267_ARCFU     ----------------------------------------------------------------------
IYD1_PIG        ----------------------------------------------------------------------
Y4267_XANOR     NGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG----TPIKSVNLGYGDPAGLFPRSPRLSFDEA
Y3524_KLEP3     NSSLQAAYLIFACRALGLDTGPMSGFDREKVDAAFFAD--------------------------------
NOX_THET8       QSXXXXXXXXXXXXXXXXXSVPMLGFDPERVRAILGLPSHAAIPAL-VALG-------------------
IYD1_PONAB      ----------------------------------------------------------------------
Y4023_XANOM     NGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG----TPIKSVNLGYGDPAGLFPRSPRLSFDEA
Y1004_RALSO     NSSLQGGYLVIAARALGLDCGPMGGFDADK----------------------------------------
Y932_POLSQ      NSSLQGAYLILAARAIGLDCGPMSGFDADKVNAAFFPDGRVKVNFL-VNIGYGDESSLMPRQPRPSFDE-
Y2366_ENTS8     ESSLQAGYLIMACRALGLDTGPMSGFD-RAAVDAEFFSGTPWKSNLLINIGYGDSEKLHPRLPRLAFED-
Y226_ARCFU      ----------------------------------------------------------------------
Y120_METTH      ----------------------------------------------------------------------
CHRR_PSEUG      DVSLFAQNFVVAAESMGYGICYIGGVRNKEEISELFNLPEYVFPLFGLTIG-------------------
YKH5_CAEEL      ----------------------------------------------------------------------
Y3909_XANOP     NGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAG----TPIKSVNLGYGDPAGLFPRSPRLSFDEA


                         .         .         .         +         .         .         .:280
query           IEFQ
YDGI_BACSU      AEWK
YODC_BACSU      ----
MHQN_BACSU      VEY-
DRGA_SYNY3      ----
Y2086_STAEQ     ISW-
Y809_STRP6      IE--
Y2073_STAES     ISW-
Y546_STAHJ      IEW-
NFNB_ENTCL      ----
NFNB_SALTY      ----
YFKO_BACSU      ----
Y379_STAS1      VEW-
RDXA_HELPJ      ----
Y2829_STAA8     IEW-
Y2534_STAAC     IEW-
Y2462_STAA3     IEW-
Y2523_STAAM     IEW-
Y2443_STAAW     IEW-
Y2409_STAAS     IEW-
Y2397_STAAB     IEW-
Y2311_STAAN     IEW-
RDXA_HELPH      ----
RDXA_HELPY      ----
Y1278_HAEIN     VKW-
FRA1_VIBFI      I---
NFNB_ECOLI      ----
RDXA_HELAH      ----
NFRA_BACSU      ----
RUTE_ECOSM      ----
Y3601_PSEU5     ----
RUTE_SHIDS      ----
RUTE_ECOLC      ----
RUTE_ECOL5      ----
RUTE_ECOHS      ----
RUTE_ECO81      ----
RUTE_ECO5E      ----
RUTE_ECO57      ----
RUTE_ECOLU      ----
RUTE_ECO7I      ----
Y018_CAUSK      ----
RUTE_SHIFL      ----
RUTE_SHIF8      ----
RUTE_ECOL6      ----
RUTE_ECO8A      ----
IYD1_MOUSE      ----
Y2476_STRGG     I---
RUTE_ECOSE      ----
RUTE_ECO55      ----
RUTE_ECO27      ----
RUTE_ECO24      ----
IYD1_HUMAN      ----
Y1060_BURS3     ARIE
Y1008_KLEP7     ----
RUTE_ECOUT      ----
RUTE_ECOLI      ----
RUTE_ECOK1      ----
RUTE_ECODH      ----
RUTE_ECOBW      ----
RUTE_ECO45      ----
IYD1_RAT        ----
Y1521_ENT38     ----
RUTE_SHISS      ----
Y587_XANC5      ARFE
Y554_XANAC      ARFE
Y585_XANCB      ----
Y568_XANC8      ----
Y3612_PARL1     ----
Y3605_XANCP     ----
Y870_RALPJ      ----
Y4764_RHOPT     ----
Y2267_ARCFU     ----
IYD1_PIG        ----
Y4267_XANOR     ARFE
Y3524_KLEP3     ----
NOX_THET8       ----
IYD1_PONAB      ----
Y4023_XANOM     ARFE
Y1004_RALSO     ----
Y932_POLSQ      ----
Y2366_ENTS8     ----
Y226_ARCFU      ----
Y120_METTH      ----
CHRR_PSEUG      ----
YKH5_CAEEL      ----
Y3909_XANOP     ARFE