[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99160.1

[Show Plain Result]


## Summary of Sequence Search
    1::82
    1::82      8e-47 100%   82 aa  RL31B_LACS1 RecName: Full=50S ribosomal protein L31 type B;
    1::82      3e-42  88%   87 aa  RL31B_LACSS RecName: Full=50S ribosomal protein L31 type B;
    1::79      8e-40  86%   83 aa  RL31B_LACCB RecName: Full=50S ribosomal protein L31 type B;
    1::79      8e-40  86%   83 aa  RL31B_LACC3 RecName: Full=50S ribosomal protein L31 type B;
    1::82      1e-39  83%   83 aa  RL31B_LACBA RecName: Full=50S ribosomal protein L31 type B;
    1::80      6e-39  82%   81 aa  RL31B_LACF3 RecName: Full=50S ribosomal protein L31 type B;
    1::79      8e-39  85%   89 aa  RL31B_ENTFA RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  82%   81 aa  RL31B_LACRJ RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  82%   81 aa  RL31B_LACRD RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACHK RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACCZ RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACCR RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACC4 RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACC3 RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACC2 RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACC0 RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACAN RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACAC RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-38  84%   81 aa  RL31B_BACAA RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-37  82%   81 aa  RL31B_BACC7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-37  82%   81 aa  RL31B_BACC1 RecName: Full=50S ribosomal protein L31 type B;
    1::79      4e-37  81%   81 aa  RL31B_LACPL RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-36  81%   81 aa  RL31B_EXIS2 RecName: Full=50S ribosomal protein L31 type B;
    1::80      2e-36  76%   85 aa  RL31B_MACCJ RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-36  81%   81 aa  RL31B_LACLS RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-36  81%   81 aa  RL31B_LACLM RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-36  82%   81 aa  RL31B_PEDPA RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-36  75%   85 aa  RL31B_STAHJ RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-36  80%   81 aa  RL31B_LACLA RecName: Full=50S ribosomal protein L31 type B;
    1::79      9e-36  75%   85 aa  RL31B_STAES RecName: Full=50S ribosomal protein L31 type B;
    1::79      9e-36  75%   85 aa  RL31B_STAEQ RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-35  75%   87 aa  RL31B_STACT RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-35  85%   86 aa  RL31B_STRU0 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-35  85%   80 aa  RL31B_STRTD RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-35  85%   80 aa  RL31B_STRT2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-35  85%   80 aa  RL31B_STRT1 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-35  81%   81 aa  RL31B_BACHD RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-35  83%   86 aa  RL31B_STRA5 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-35  83%   86 aa  RL31B_STRA3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-35  83%   86 aa  RL31B_STRA1 RecName: Full=50S ribosomal protein L31 type B;
    1::80      3e-35  74%   85 aa  RL31B_STAS1 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-35  83%   86 aa  RL31B_STREM RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-35  83%   86 aa  RL31B_STRE4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-35  83%   80 aa  RL31B_STRMU RecName: Full=50S ribosomal protein L31 type B;
    1::78      6e-35  83%   86 aa  RL31B_STRS7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      6e-35  77%   87 aa  RL31B_LISW6 RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRZT RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRZP RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRZJ RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRR6 RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRPN RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRPJ RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRPI RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRP7 RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRP4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-35  83%   80 aa  RL31B_STRP2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-34  82%   80 aa  RL31B_STRSV RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAW RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAT RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAS RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAR RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAN RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAM RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAE RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAC RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAAB RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAA9 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAA8 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAA3 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAA2 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  73%   84 aa  RL31B_STAA1 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  77%   81 aa  RL31B_LISMO RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  77%   81 aa  RL31B_LISMH RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  77%   81 aa  RL31B_LISMF RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  77%   81 aa  RL31B_LISMC RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-34  77%   81 aa  RL31B_LISIN RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPZ RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPM RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPG RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPF RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPD RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPC RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRPB RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRP8 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRP6 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRP3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-34  82%   86 aa  RL31B_STRP1 RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-34  78%   83 aa  RL31B_LACDB RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-34  78%   83 aa  RL31B_LACDA RecName: Full=50S ribosomal protein L31 type B;
    1::81      1e-33  75%   83 aa  RL31B_LACJO RecName: Full=50S ribosomal protein L31 type B;
    1::81      1e-33  75%   83 aa  RL31B_LACGA RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-33  77%   81 aa  RL31B_LACAC RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-33  76%   81 aa  RL31B_LACH4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-33  76%   80 aa  RL31B_BACSK RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-33  74%   80 aa  RL31B_EXISA RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-33  74%   81 aa  RL31B_OCEIH RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-31  71%   82 aa  RL31B_BACA2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-30  67%   82 aa  RL31B_BACSU RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-29  68%   80 aa  RL31B_OENOB RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-28  62%   88 aa  RL31B_NOCFA RecName: Full=50S ribosomal protein L31 type B;
    1::78      9e-28  62%   81 aa  RL31B_BACLD RecName: Full=50S ribosomal protein L31 type B;
    1::78      6e-27  62%   82 aa  RL31B_AMOA5 RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-27  61%   89 aa  RL31B_CORU7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-26  57%   87 aa  RL31B_CORK4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-26  63%   83 aa  RL31B_LEIXX RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-26  57%   88 aa  RL31B_CORDI RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-26  56%   87 aa  RL31B_CORJK RecName: Full=50S ribosomal protein L31 type B;
    1::81      4e-26  54%   87 aa  RL31B_HALHL RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-26  57%   84 aa  RL31B_RHOE4 RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-26  56%   89 aa  RL31B_CORA7 RecName: Full=50S ribosomal protein L31 type B;
    1::81      5e-26  57%   84 aa  RL31B_ALHEH RecName: Full=50S ribosomal protein L31 type B;
    1::82      8e-26  56%   82 aa  RL31B_DICNV RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-26  62%   85 aa  RL31B_ARTS2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-26  63%   85 aa  RL31B_ARTCA RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-25  54%   88 aa  RL31B_CORGL RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-25  54%   88 aa  RL31B_CORGB RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-25  62%   84 aa  RL31B_RENSM RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-25  56%   88 aa  RL31B_COREF RecName: Full=50S ribosomal protein L31 type B;
    1::79      4e-25  58%   81 aa  RL31B_PROAC RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-25  59%   85 aa  RL31B_MICLC RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-25  56%   80 aa  RL31B_METFK RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-25  58%   87 aa  RL31B_SALAI RecName: Full=50S ribosomal protein L31 type B;
    1::79      7e-25  54%  115 aa  RL31B_POLSQ RecName: Full=50S ribosomal protein L31 type B;
    1::78      9e-25  56%   80 aa  RL31B_STRM5 RecName: Full=50S ribosomal protein L31 type B;
    1::79      9e-25  56%   90 aa  R31B1_STRCO RecName: Full=50S ribosomal protein L31 type B 1;
    1::79      1e-24  54%  115 aa  RL31B_POLNS RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  54%   86 aa  RL31B_VIBVY RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  54%   86 aa  RL31B_VIBVU RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  56%   80 aa  RL31B_STRMK RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANOR RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANOM RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANCP RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANC8 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANC5 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  55%   80 aa  RL31B_XANAC RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  60%   85 aa  RL31B_CLAM3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURPS RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURP6 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURP1 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURP0 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURMS RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURMA RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURM9 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-24  59%   87 aa  RL31B_BURM7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-24  56%   81 aa  RL31B_BDEBA RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-24  56%   84 aa  R31B2_STRCO RecName: Full=50S ribosomal protein L31 type B 2;
    1::78      2e-24  55%   91 aa  R31B1_STRAW RecName: Full=50S ribosomal protein L31 type B 1;
    1::79      3e-24  54%   84 aa  RL31B_RHOSR RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-24  56%   88 aa  RL31B_JANMA RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-24  59%   81 aa  RL31B_BORGA RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-24  53%   86 aa  RL31B_VIBPA RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-24  57%   84 aa  RL31B_STRGG RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-24  59%   87 aa  RL31B_BURTA RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-24  59%   81 aa  RL31B_BORAP RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-24  56%   87 aa  RL31B_BURP8 RecName: Full=50S ribosomal protein L31 type B;
    1::79      6e-24  52%   86 aa  RL31B_VIBHB RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-24  56%   80 aa  RL31B_XYLFM RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-24  56%   80 aa  RL31B_XYLFA RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-24  55%   86 aa  RL31B_SALTO RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-23  54%   86 aa  RL31B_SACEN RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-23  56%   85 aa  RL31B_KOCRD RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-23  54%   86 aa  RL31B_VIBSL RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  59%   81 aa  RL31B_BORBZ RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  56%   80 aa  RL31B_XYLFT RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  56%   80 aa  RL31B_XYLF2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  58%   87 aa  RL31B_BURM1 RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  58%   88 aa  RL31B_BURCH RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  58%   88 aa  RL31B_BURCC RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  58%   88 aa  RL31B_BURCA RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-23  58%   81 aa  RL31B_BORBU RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-23  55%   85 aa  RL31B_VIBCM RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-23  55%   85 aa  RL31B_VIBCH RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-23  55%   85 aa  RL31B_VIBC3 RecName: Full=50S ribosomal protein L31 type B;
    1::71      3e-23  65%   88 aa  RL31B_LEUMM RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-23  54%   82 aa  R31B2_STRAW RecName: Full=50S ribosomal protein L31 type B 2;
    1::78      4e-23  55%   88 aa  RL31B_HERAR RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-23  55%   88 aa  RL31B_BURXL RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-23  55%   88 aa  RL31B_BURPP RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-23  56%   87 aa  RL31B_BURVG RecName: Full=50S ribosomal protein L31 type B;
    1::71      7e-23  65%   88 aa  RL31B_LEUCK RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-23  58%   85 aa  RL31B_CLAMS RecName: Full=50S ribosomal protein L31 type B;
    1::78      7e-23  56%   86 aa  RL31B_BURCJ RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-23  54%   80 aa  RL31B_MYCA9 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-22  55%   86 aa  RL31B_BURS3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-22  55%   87 aa  RL31B_BURCM RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-22  55%   87 aa  RL31B_BURA4 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-22  49%   87 aa  RL31B_RALSO RecName: Full=50S ribosomal protein L31 type B;
    1::82      1e-22  54%   91 aa  RL31B_MYCVP RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-22  49%   85 aa  RL31B_ALISL RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-22  54%   86 aa  RL31B_RALME RecName: Full=50S ribosomal protein L31 type B;
    1::80      2e-21  56%   83 aa  RL31B_THICR RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-21  53%   86 aa  RL31B_RALPJ RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-21  51%   86 aa  RL31B_CUPTR RecName: Full=50S ribosomal protein L31 type B;
    1::63      3e-21  62%   89 aa  RL31B_RUBXD RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-21  54%   83 aa  RL31B_TROWT RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-21  54%   83 aa  RL31B_TROW8 RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-21  51%   86 aa  RL31B_RALEJ RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-21  54%   90 aa  RL31B_PSEFS RecName: Full=50S ribosomal protein L31 type B;
    1::80      4e-21  52%   88 aa  RL31B_BORPA RecName: Full=50S ribosomal protein L31 type B;
    1::80      4e-21  52%   88 aa  RL31B_BORBR RecName: Full=50S ribosomal protein L31 type B;
    1::79      4e-21  58%   84 aa  RL31B_BACV8 RecName: Full=50S ribosomal protein L31 type B;
    1::77      6e-21  53%  108 aa  RL31B_CHLTB RecName: Full=50S ribosomal protein L31 type B;
    1::77      6e-21  53%  108 aa  RL31B_CHLT2 RecName: Full=50S ribosomal protein L31 type B;
    1::83      6e-21  54%   85 aa  RL31B_BIFLI RecName: Full=50S ribosomal protein L31 type B;
    1::80      8e-21  52%   88 aa  RL31B_BORPE RecName: Full=50S ribosomal protein L31 type B;
    1::79      8e-21  48%   89 aa  RL31B_AERS4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-20  50%   86 aa  RL31B_RALEH RecName: Full=50S ribosomal protein L31 type B;
    1::77      2e-20  52%  108 aa  RL31B_CHLAB RecName: Full=50S ribosomal protein L31 type B;
    1::79      2e-20  48%   89 aa  RL31B_AERHH RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-20  51%   85 aa  RL31B_PSEU5 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-20  49%   89 aa  RL31B_PSEF5 RecName: Full=50S ribosomal protein L31 type B;
    1::82      3e-20  56%   84 aa  RL31B_PARD8 RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-20  55%   84 aa  RL31B_BACTN RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-20  55%   83 aa  RL31B_BACFR RecName: Full=50S ribosomal protein L31 type B;
    1::79      3e-20  55%   83 aa  RL31B_BACFN RecName: Full=50S ribosomal protein L31 type B;
    1::76      5e-20  58%   81 aa  RL31_FUSNN RecName: Full=50S ribosomal protein L31;
    1::80      5e-20  53%   86 aa  RL31B_CHLT3 RecName: Full=50S ribosomal protein L31 type B;
    1::82      9e-20  51%   97 aa  RL31B_MYCPA RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-19  47%   84 aa  RL31B_RHOOB RecName: Full=50S ribosomal protein L31 type B;
    1::77      3e-19  51%  109 aa  RL31B_CHLPN RecName: Full=50S ribosomal protein L31 type B;
    1::82      4e-19  54%   85 aa  RL31B_PORGI RecName: Full=50S ribosomal protein L31 type B;
    1::82      4e-19  54%   85 aa  RL31B_PORG3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      6e-19  49%   82 aa  RL31B_PROMH RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-18  49%   85 aa  RL31B_PSEE4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      6e-18  46%   93 aa  RL31B_PSESM RecName: Full=50S ribosomal protein L31 type B;
    1::77      6e-18  47%  108 aa  RL31B_CHLTA RecName: Full=50S ribosomal protein L31 type B;
    1::77      6e-18  47%  108 aa  RL31B_CHLCV RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-18  50%   86 aa  RL31B_YERE8 RecName: Full=50S ribosomal protein L31 type B;
    1::77      8e-18  47%  108 aa  RL31B_CHLTR RecName: Full=50S ribosomal protein L31 type B;
    1::77      8e-18  47%  108 aa  RL31B_CHLMU RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-17  46%   82 aa  RL31B_PECCP RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-17  45%   93 aa  RL31B_PSEU2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-17  47%   82 aa  RL31B_ERWCT RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-17  49%   93 aa  RL31B_PSYA2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-17  49%   84 aa  RL31B_PHOLL RecName: Full=50S ribosomal protein L31 type B;
    1::78      4e-17  49%   92 aa  RL31B_PSYWF RecName: Full=50S ribosomal protein L31 type B;
    1::77      4e-17  47%   82 aa  RL31B_ACIAD RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPY RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPS RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPP RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPN RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPE RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPB RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERPA RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-17  49%   86 aa  RL31B_YERP3 RecName: Full=50S ribosomal protein L31 type B;
    1::77      5e-17  47%  106 aa  RL31B_CHLFF RecName: Full=50S ribosomal protein L31 type B;
    1::64      9e-17  62%   66 aa  RL31_BACP2 RecName: Full=50S ribosomal protein L31;
    1::78      9e-17  49%   86 aa  RL31B_CITK8 RecName: Full=50S ribosomal protein L31 type B;
    1::64      2e-16  62%   66 aa  RL31_GEOKA RecName: Full=50S ribosomal protein L31;
    1::64      2e-16  62%   66 aa  RL31_BACLD RecName: Full=50S ribosomal protein L31;
    1::64      2e-16  62%   66 aa  RL31_BACSU RecName: Full=50S ribosomal protein L31;
    1::64      2e-16  62%   66 aa  RL31_BACA2 RecName: Full=50S ribosomal protein L31;
    1::64      3e-16  62%   66 aa  RL31_GEOSW RecName: Full=50S ribosomal protein L31;
    1::64      3e-16  64%   66 aa  RL31_BACME RecName: Full=50S ribosomal protein L31;
    1::78      3e-16  45%   87 aa  RL31B_SHIBS RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOUT RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOSM RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOSE RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOLU RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOLI RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECOL6 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECODH RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECO8A RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECO7I RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECO45 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECO27 RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  R31B2_ECO57 RecName: Full=50S ribosomal protein L31 type B 2;
    1::78      3e-16  45%   87 aa  R31B1_ECO57 RecName: Full=50S ribosomal protein L31 type B 1;
    1::64      3e-16  62%   66 aa  RL31_GEOTN RecName: Full=50S ribosomal protein L31;
    1::64      3e-16  64%   66 aa  RL31_ANOFW RecName: Full=50S ribosomal protein L31;
    1::78      3e-16  45%   87 aa  RL31B_ECOHS RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-16  45%   87 aa  RL31B_ECO55 RecName: Full=50S ribosomal protein L31 type B;
    1::67      8e-16  60%   69 aa  RL31_CLOCE RecName: Full=50S ribosomal protein L31;
    1::78      8e-16  47%   86 aa  RL31B_SALTY RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALTI RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALSV RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALPC RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALPB RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALNS RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALHS RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALG2 RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALEP RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALDC RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALCH RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  47%   86 aa  RL31B_SALA4 RecName: Full=50S ribosomal protein L31 type B;
    1::78      8e-16  44%   87 aa  RL31B_KLEP3 RecName: Full=50S ribosomal protein L31 type B;
    1::78      1e-15  44%   87 aa  RL31B_PSEA7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      1e-15  41%   88 aa  RL31B_HAEPS RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIBY RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIBT RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIBS RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIBC RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIB5 RecName: Full=50S ribosomal protein L31 type B;
    1::81      2e-15  43%   84 aa  RL31B_ACIB3 RecName: Full=50S ribosomal protein L31 type B;
    1::74      2e-15  49%   93 aa  RL31B_PSYCK RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-15  42%   87 aa  RL31B_PSEAE RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-15  42%   87 aa  RL31B_PSEAB RecName: Full=50S ribosomal protein L31 type B;
    1::78      2e-15  42%   87 aa  RL31B_PSEA8 RecName: Full=50S ribosomal protein L31 type B;
    1::80      4e-15  43%   88 aa  RL31B_PASMU RecName: Full=50S ribosomal protein L31 type B;
    1::67      5e-15  54%   68 aa  RL31_EUBE2 RecName: Full=50S ribosomal protein L31;
    1::78      5e-15  46%   86 aa  RL31B_SALPK RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-15  46%   86 aa  RL31B_SALPA RecName: Full=50S ribosomal protein L31 type B;
    1::78      5e-15  45%   86 aa  RL31B_SALAR RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-15  40%   89 aa  RL31B_ACTPJ RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-15  40%   89 aa  RL31B_ACTP7 RecName: Full=50S ribosomal protein L31 type B;
    1::79      5e-15  40%   89 aa  RL31B_ACTP2 RecName: Full=50S ribosomal protein L31 type B;
    1::65      1e-14  55%   69 aa  RL31_ANATD RecName: Full=50S ribosomal protein L31;
    1::79      1e-14  38%   89 aa  RL31B_HAEDU RecName: Full=50S ribosomal protein L31 type B;
    1::80      2e-14  42%   91 aa  RL31B_NEIG2 RecName: Full=50S ribosomal protein L31 type B;
    1::64      3e-14  52%   68 aa  RL31_CLOPS RecName: Full=50S ribosomal protein L31;
    1::64      3e-14  52%   68 aa  RL31_CLOPE RecName: Full=50S ribosomal protein L31;
    1::64      3e-14  52%   68 aa  RL31_CLOP1 RecName: Full=50S ribosomal protein L31;
    1::68      3e-14  49%   85 aa  RL31B_SERP5 RecName: Full=50S ribosomal protein L31 type B;
    1::80      3e-14  42%   91 aa  RL31B_NEIMF RecName: Full=50S ribosomal protein L31 type B;
    1::80      3e-14  42%   91 aa  RL31B_NEIMB RecName: Full=50S ribosomal protein L31 type B;
    1::78      3e-14  40%   86 aa  RL31B_ERWT9 RecName: Full=50S ribosomal protein L31 type B;
    1::64      6e-14  52%   67 aa  RL31_FINM2 RecName: Full=50S ribosomal protein L31;
    1::63      6e-14  59%   65 aa  RL31_BREBN RecName: Full=50S ribosomal protein L31;
    1::80      6e-14  41%   91 aa  RL31B_NEIM0 RecName: Full=50S ribosomal protein L31 type B;
    1::68      7e-14  49%   72 aa  RL31_CLOBM RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOBL RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOBK RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOBJ RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOBH RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOB6 RecName: Full=50S ribosomal protein L31;
    1::68      9e-14  49%   72 aa  RL31_CLOB1 RecName: Full=50S ribosomal protein L31;
    1::63      1e-13  57%   76 aa  RL31_SYNFM RecName: Full=50S ribosomal protein L31;
    1::64      1e-13  50%   69 aa  RL31_CLOBB RecName: Full=50S ribosomal protein L31;
    1::64      1e-13  50%   69 aa  RL31_CLOBA RecName: Full=50S ribosomal protein L31;
    1::80      1e-13  41%   91 aa  RL31B_NEIMA RecName: Full=50S ribosomal protein L31 type B;
    1::68      2e-13  50%   70 aa  RL31_CLOK5 RecName: Full=50S ribosomal protein L31;
    1::68      2e-13  50%   70 aa  RL31_CLOK1 RecName: Full=50S ribosomal protein L31;
    1::65      2e-13  54%   69 aa  RL31_CALS8 RecName: Full=50S ribosomal protein L31;
    1::64      2e-13  48%   69 aa  RL31_CLOB8 RecName: Full=50S ribosomal protein L31;
    1::80      3e-13  41%   91 aa  RL31B_NEIG1 RecName: Full=50S ribosomal protein L31 type B;
    1::64      4e-13  50%   69 aa  RL31_CLONN RecName: Full=50S ribosomal protein L31;
    1::66      4e-13  53%   70 aa  RL31_BIFAA RecName: Full=50S ribosomal protein L31;
    1::64      6e-13  52%   69 aa  RL31_THETN RecName: Full=50S ribosomal protein L31;
    1::66      8e-13  53%   71 aa  RL31_NEIMB RecName: Full=50S ribosomal protein L31;
    1::66      8e-13  53%   71 aa  RL31_NEIMA RecName: Full=50S ribosomal protein L31;
    1::66      8e-13  56%   70 aa  RL31_MYCGI RecName: Full=50S ribosomal protein L31;
    1::63      8e-13  54%   73 aa  RL31_DESOH RecName: Full=50S ribosomal protein L31;
    1::66      1e-12  53%   74 aa  RL31_MYCVP RecName: Full=50S ribosomal protein L31;
    1::65      2e-12  48%   74 aa  RL31_NITEU RecName: Full=50S ribosomal protein L31;
    1::64      2e-12  48%   70 aa  RL31_CHLCH RecName: Full=50S ribosomal protein L31;
    1::64      2e-12  52%   75 aa  RL31_PROVI RecName: Full=50S ribosomal protein L31;
    1::64      2e-12  52%   65 aa  RL31_ALKMQ RecName: Full=50S ribosomal protein L31;
    1::70      2e-12  40%  117 aa  RL31B_PARUW RecName: Full=50S ribosomal protein L31 type B;
    1::63      3e-12  48%   70 aa  RL31_TOLAT RecName: Full=50S ribosomal protein L31;
    1::66      4e-12  48%   68 aa  RL31_THIDA RecName: Full=50S ribosomal protein L31;
    1::63      4e-12  52%   66 aa  RL31_THEYD RecName: Full=50S ribosomal protein L31;
    1::64      4e-12  50%   69 aa  RL31_THEPX RecName: Full=50S ribosomal protein L31;
    1::64      4e-12  50%   69 aa  RL31_THEP3 RecName: Full=50S ribosomal protein L31;
    1::66      4e-12  52%   71 aa  RL31_NEIG1 RecName: Full=50S ribosomal protein L31;
    1::66      5e-12  55%   81 aa  RL31_MYCSS RecName: Full=50S ribosomal protein L31;
    1::66      5e-12  55%   81 aa  RL31_MYCSK RecName: Full=50S ribosomal protein L31;
    1::66      5e-12  55%   81 aa  RL31_MYCSJ RecName: Full=50S ribosomal protein L31;
    1::69      5e-12  48%   75 aa  RL31_MYCS2 RecName: Full=50S ribosomal protein L31;
    1::66      7e-12  52%   69 aa  RL31_THEFY RecName: Full=50S ribosomal protein L31;
    1::64      7e-12  48%   75 aa  RL31_PELPB RecName: Full=50S ribosomal protein L31;
    1::64      7e-12  53%   65 aa  RL31_GEOSL RecName: Full=50S ribosomal protein L31;
    1::64      7e-12  53%   66 aa  RL31_GEOMG RecName: Full=50S ribosomal protein L31;
    1::64      7e-12  55%   65 aa  RL31_CARHZ RecName: Full=50S ribosomal protein L31;
    1::64      9e-12  52%   65 aa  RL31_GEOSF RecName: Full=50S ribosomal protein L31;
    1::64      9e-12  53%   66 aa  RL31_GEOLS RecName: Full=50S ribosomal protein L31;
    1::69      1e-11  48%   69 aa  RL31_PROAC RecName: Full=50S ribosomal protein L31;
    1::64      1e-11  48%   75 aa  RL31_PELLD RecName: Full=50S ribosomal protein L31;
    1::65      2e-11  54%   71 aa  RL31_PSEHT RecName: Full=50S ribosomal protein L31;
    1::64      2e-11  52%   65 aa  RL31_GEOUR RecName: Full=50S ribosomal protein L31;
    1::64      2e-11  52%   66 aa  RL31_DESRM RecName: Full=50S ribosomal protein L31;
    1::67      2e-11  43%   70 aa  RL31_CLOAB RecName: Full=50S ribosomal protein L31;
    1::66      2e-11  48%   67 aa  RL31_THISH RecName: Full=50S ribosomal protein L31;
    1::64      2e-11  50%   76 aa  RL31_SOLUE RecName: Full=50S ribosomal protein L31;
    1::64      2e-11  53%   65 aa  RL31_DESHY RecName: Full=50S ribosomal protein L31;
    1::64      2e-11  53%   65 aa  RL31_DESHD RecName: Full=50S ribosomal protein L31;
    1::64      3e-11  48%   66 aa  RL31_NATTJ RecName: Full=50S ribosomal protein L31;
    1::63      3e-11  51%   72 aa  RL31_GEOSM RecName: Full=50S ribosomal protein L31;
    1::65      3e-11  43%   72 aa  RL31_IDILO RecName: Full=50S ribosomal protein L31;
    1::65      3e-11  45%   68 aa  RL31_DEHE1 RecName: Full=50S ribosomal protein L31;
    1::64      3e-11  52%   65 aa  RL31_ALKOO RecName: Full=50S ribosomal protein L31;
    1::66      4e-11  45%   73 aa  RL31_VIBVU RecName: Full=50S ribosomal protein L31;
    1::65      4e-11  46%   70 aa  RL31_PHOPR RecName: Full=50S ribosomal protein L31;
    1::67      6e-11  49%   71 aa  RL31_SYNAS RecName: Full=50S ribosomal protein L31;
    1::64      6e-11  50%   67 aa  RL31_PELTS RecName: Full=50S ribosomal protein L31;
    1::66      6e-11  47%   68 aa  RL31_HALOH RecName: Full=50S ribosomal protein L31;
    1::63      6e-11  51%   73 aa  RL31_GEOBB RecName: Full=50S ribosomal protein L31;
    1::68      7e-11  49%   69 aa  RL31_PELCD RecName: Full=50S ribosomal protein L31;
    1::64      7e-11  50%   71 aa  RL31_DESVM RecName: Full=50S ribosomal protein L31;
    1::66      7e-11  45%   71 aa  RL31_CHRVO RecName: Full=50S ribosomal protein L31;
    1::64      7e-11  47%   75 aa  RL31_CHLL2 RecName: Full=50S ribosomal protein L31;
    1::66      7e-11  47%   70 aa  RL31_BIFLO RecName: Full=50S ribosomal protein L31;
    1::66      7e-11  47%   70 aa  RL31_BIFLI RecName: Full=50S ribosomal protein L31;
    1::66      7e-11  47%   70 aa  RL31_BIFLD RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  44%   73 aa  RL31_VIBVY RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  42%   84 aa  RL31_SALRD RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  45%   71 aa  RL31_FRATT RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  45%   71 aa  RL31_FRATM RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  45%   72 aa  RL31_FRATH RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  45%   71 aa  RL31_FRAT1 RecName: Full=50S ribosomal protein L31;
    1::65      1e-10  49%   71 aa  RL31_CHRSD RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  48%   70 aa  RL31_SACEN RecName: Full=50S ribosomal protein L31;
    1::64      1e-10  47%   65 aa  RL31_HELMI RecName: Full=50S ribosomal protein L31;
    1::66      1e-10  45%   71 aa  RL31_FRATN RecName: Full=50S ribosomal protein L31;
    1::65      1e-10  48%   75 aa  RL31_CHLTE RecName: Full=50S ribosomal protein L31;
    1::63      1e-10  51%   66 aa  RL31_CAMFF RecName: Full=50S ribosomal protein L31;
    1::66      2e-10  45%   73 aa  RL31_VIBPA RecName: Full=50S ribosomal protein L31;
    1::66      2e-10  45%   72 aa  RL31_VIBHB RecName: Full=50S ribosomal protein L31;
    1::63      2e-10  48%   67 aa  RL31_TREPS RecName: Full=50S ribosomal protein L31;
    1::63      2e-10  48%   67 aa  RL31_TREPA RecName: Full=50S ribosomal protein L31;
    1::66      2e-10  48%   74 aa  RL31_MYCA9 RecName: Full=50S ribosomal protein L31;
    1::68      2e-10  49%   76 aa  RL31_GLUDA RecName: Full=50S ribosomal protein L31;
    1::65      2e-10  43%   68 aa  RL31_DEHSC RecName: Full=50S ribosomal protein L31;
   27::66      2e-10  58%   82 aa  RL31_CYAP8 RecName: Full=50S ribosomal protein L31;
    1::64      2e-10  45%   75 aa  RL31_CHLPD RecName: Full=50S ribosomal protein L31;
   27::66      2e-10  62%   81 aa  RL31_SYNY3 RecName: Full=50S ribosomal protein L31;
    1::67      2e-10  53%   67 aa  RL31_SYNWW RecName: Full=50S ribosomal protein L31;
   27::66      2e-10  62%   76 aa  RL31_SYNP2 RecName: Full=50S ribosomal protein L31;
    1::64      2e-10  48%   71 aa  RL31_DESVV RecName: Full=50S ribosomal protein L31;
    1::64      2e-10  48%   71 aa  RL31_DESVH RecName: Full=50S ribosomal protein L31;
    1::64      2e-10  48%   66 aa  RL31_CAMHC RecName: Full=50S ribosomal protein L31;
    1::66      3e-10  42%   72 aa  RL31_VIBSL RecName: Full=50S ribosomal protein L31;
   27::69      3e-10  53%   94 aa  RL31_PROMA RecName: Full=50S ribosomal protein L31;
    1::64      3e-10  47%   72 aa  RL31_PROA2 RecName: Full=50S ribosomal protein L31;
    1::65      3e-10  49%   67 aa  RL31_METCA RecName: Full=50S ribosomal protein L31;
    1::65      3e-10  43%   69 aa  RL31_MAGSM RecName: Full=50S ribosomal protein L31;
    1::64      3e-10  42%   70 aa  RL31_HAEDU RecName: Full=50S ribosomal protein L31;
    1::66      3e-10  44%   74 aa  RL31_DECAR RecName: Full=50S ribosomal protein L31;
   27::66      3e-10  60%   83 aa  RL31_CYAP7 RecName: Full=50S ribosomal protein L31;
    1::65      4e-10  46%   75 aa  RL31_NITMU RecName: Full=50S ribosomal protein L31;
    1::66      4e-10  47%   80 aa  RL31_MYCPA RecName: Full=50S ribosomal protein L31;
    1::66      4e-10  47%   80 aa  RL31_MYCA1 RecName: Full=50S ribosomal protein L31;
    1::65      4e-10  46%   71 aa  RL31_MARMS RecName: Full=50S ribosomal protein L31;
    1::68      4e-10  46%   75 aa  RL31_CHLPB RecName: Full=50S ribosomal protein L31;
    1::66      4e-10  48%   72 aa  RL31_AZOSB RecName: Full=50S ribosomal protein L31;
    1::63      5e-10  43%   81 aa  RL31_RHOBA RecName: Full=50S ribosomal protein L31;
    1::64      5e-10  47%   66 aa  RL31_NAUPA RecName: Full=50S ribosomal protein L31;
    1::65      5e-10  42%   73 aa  RL31_MARAV RecName: Full=50S ribosomal protein L31;
    3::66      5e-10  50%   74 aa  RL31_GLOVI RecName: Full=50S ribosomal protein L31;
    1::64      5e-10  47%   69 aa  RL31_DESDG RecName: Full=50S ribosomal protein L31;
    1::63      5e-10  48%   66 aa  RL31_CLOD6 RecName: Full=50S ribosomal protein L31;
    1::66      5e-10  47%   72 aa  RL31_AZOSE RecName: Full=50S ribosomal protein L31;
    1::65      5e-10  43%   68 aa  RL31_ACIF5 RecName: Full=50S ribosomal protein L31;
    1::65      5e-10  43%   68 aa  RL31_ACIF2 RecName: Full=50S ribosomal protein L31;
    1::66      5e-10  45%   86 aa  RL31_ACIC1 RecName: Full=50S ribosomal protein L31;
    1::63      6e-10  48%   67 aa  RL31_TREDE RecName: Full=50S ribosomal protein L31;
   27::66      6e-10  58%   86 aa  RL31_SYNPX RecName: Full=50S ribosomal protein L31;
    1::67      6e-10  45%   93 aa  RL31_ONYPE RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  48%   76 aa  RL31_NOCFA RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  47%   80 aa  RL31_MYCTU RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  47%   80 aa  RL31_MYCTA RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  47%   80 aa  RL31_MYCBT RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  47%   80 aa  RL31_MYCBP RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  47%   80 aa  RL31_MYCBO RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  42%   71 aa  RL31_LARHH RecName: Full=50S ribosomal protein L31;
    1::64      6e-10  42%   70 aa  RL31_HAES2 RecName: Full=50S ribosomal protein L31;
    1::67      6e-10  40%   69 aa  RL31_BUCCC RecName: Full=50S ribosomal protein L31;
    1::66      6e-10  45%   72 aa  RL31_ALISL RecName: Full=50S ribosomal protein L31;
    1::63      8e-10  48%   66 aa  RL31_SULNB RecName: Full=50S ribosomal protein L31;
    1::64      8e-10  44%   71 aa  RL31_MANSM RecName: Full=50S ribosomal protein L31;
    1::63      8e-10  49%   66 aa  RL31_CAMLR RecName: Full=50S ribosomal protein L31;
    1::63      8e-10  49%   67 aa  RL31_ARCB4 RecName: Full=50S ribosomal protein L31;
    1::64      8e-10  42%   71 aa  RL31_ACTSZ RecName: Full=50S ribosomal protein L31;
    1::66      1e-09  46%   72 aa  RL31_VIBFM RecName: Full=50S ribosomal protein L31;
    1::66      1e-09  46%   72 aa  RL31_VIBF1 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROMS RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROM9 RecName: Full=50S ribosomal protein L31;
   27::69      1e-09  51%   94 aa  RL31_PROM4 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROM2 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROM0 RecName: Full=50S ribosomal protein L31;
    1::66      1e-09  47%   84 aa  RL31_MYCLE RecName: Full=50S ribosomal protein L31;
    1::66      1e-09  47%   84 aa  RL31_MYCLB RecName: Full=50S ribosomal protein L31;
    1::64      1e-09  42%   71 aa  RL31_ERWCT RecName: Full=50S ribosomal protein L31;
    1::64      1e-09  47%   67 aa  RL31_WOLSU RecName: Full=50S ribosomal protein L31;
   23::64      1e-09  52%   71 aa  RL31_THET8 RecName: Full=50S ribosomal protein L31;
   23::64      1e-09  52%   71 aa  RL31_THET2 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  58%   79 aa  RL31_SYNS9 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   88 aa  RL31_SYNS3 RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   85 aa  RL31_SYNPW RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROMP RecName: Full=50S ribosomal protein L31;
   27::66      1e-09  55%   86 aa  RL31_PROM5 RecName: Full=50S ribosomal protein L31;
    1::64      1e-09  47%   66 aa  RL31_PELPD RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  44%   71 aa  RL31_SERP5 RecName: Full=50S ribosomal protein L31;
    1::69      2e-09  49%   73 aa  RL31_RHILW RecName: Full=50S ribosomal protein L31;
    1::69      2e-09  49%   73 aa  RL31_RHIEC RecName: Full=50S ribosomal protein L31;
    1::69      2e-09  49%   73 aa  RL31_RHIE6 RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   70 aa  RL31_PASMU RecName: Full=50S ribosomal protein L31;
    1::66      2e-09  44%   81 aa  RL31_MYCUA RecName: Full=50S ribosomal protein L31;
    1::66      2e-09  44%   81 aa  RL31_MYCMM RecName: Full=50S ribosomal protein L31;
   26::64      2e-09  59%   77 aa  RL31_MICAN RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  44%   80 aa  RL31_METI4 RecName: Full=50S ribosomal protein L31;
    1::65      2e-09  46%   68 aa  RL31_DICTD RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  45%   67 aa  RL31_DESAP RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  48%   74 aa  RL31_ACIBL RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPY RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPS RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPP RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPN RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPG RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPE RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPB RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERPA RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   71 aa  RL31_YERP3 RecName: Full=50S ribosomal protein L31;
    1::65      2e-09  40%   70 aa  RL31_VESOH RecName: Full=50S ribosomal protein L31;
    1::66      2e-09  45%   74 aa  RL31_STRCO RecName: Full=50S ribosomal protein L31;
    1::65      2e-09  43%   71 aa  RL31_PSEPK RecName: Full=50S ribosomal protein L31;
    1::65      2e-09  43%   71 aa  RL31_PSEPG RecName: Full=50S ribosomal protein L31;
   27::66      2e-09  55%   86 aa  RL31_PROMT RecName: Full=50S ribosomal protein L31;
   27::66      2e-09  52%   93 aa  RL31_PROMM RecName: Full=50S ribosomal protein L31;
   27::66      2e-09  52%   93 aa  RL31_PROM3 RecName: Full=50S ribosomal protein L31;
   27::69      2e-09  49%   80 aa  RL31_NOSP7 RecName: Full=50S ribosomal protein L31;
    2::65      2e-09  45%   68 aa  RL31_HELHP RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  41%   70 aa  RL31_HAEPS RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   70 aa  RL31_HAEI8 RecName: Full=50S ribosomal protein L31;
    1::67      2e-09  45%   75 aa  RL31_GLUOX RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  42%   70 aa  RL31_ERWT9 RecName: Full=50S ribosomal protein L31;
    1::67      2e-09  45%   90 aa  RL31_AYWBP RecName: Full=50S ribosomal protein L31;
   27::69      2e-09  49%   79 aa  RL31_ANAVT RecName: Full=50S ribosomal protein L31;
   27::69      2e-09  49%   79 aa  RL31_ANASP RecName: Full=50S ribosomal protein L31;
    1::65      2e-09  43%   71 aa  RL31_AERS4 RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  41%   70 aa  RL31_ACTPJ RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  41%   70 aa  RL31_ACTP7 RecName: Full=50S ribosomal protein L31;
    1::64      2e-09  41%   70 aa  RL31_ACTP2 RecName: Full=50S ribosomal protein L31;
    1::66      3e-09  39%   72 aa  RL31_VIBCM RecName: Full=50S ribosomal protein L31;
    1::66      3e-09  39%   72 aa  RL31_VIBCH RecName: Full=50S ribosomal protein L31;
    1::66      3e-09  39%   72 aa  RL31_VIBC3 RecName: Full=50S ribosomal protein L31;
   27::68      3e-09  52%   91 aa  RL31_THEEB RecName: Full=50S ribosomal protein L31;
   27::66      3e-09  52%   92 aa  RL31_SYNR3 RecName: Full=50S ribosomal protein L31;
   27::66      3e-09  52%   77 aa  RL31_SYNP6 RecName: Full=50S ribosomal protein L31;
   27::66      3e-09  50%   73 aa  RL31_SYNJA RecName: Full=50S ribosomal protein L31;
   27::66      3e-09  52%   77 aa  RL31_SYNE7 RecName: Full=50S ribosomal protein L31;
    1::66      3e-09  44%   73 aa  RL31_STRAW RecName: Full=50S ribosomal protein L31;
    1::64      3e-09  44%   68 aa  RL31_NITOC RecName: Full=50S ribosomal protein L31;
    1::65      3e-09  52%   66 aa  RL31_MOOTA RecName: Full=50S ribosomal protein L31;
    1::64      3e-09  41%   70 aa  RL31_HAEIN RecName: Full=50S ribosomal protein L31;
    1::64      3e-09  41%   70 aa  RL31_HAEIG RecName: Full=50S ribosomal protein L31;
    1::64      3e-09  41%   70 aa  RL31_HAEIE RecName: Full=50S ribosomal protein L31;
    1::67      3e-09  45%   76 aa  RL31_DESAA RecName: Full=50S ribosomal protein L31;
    1::63      3e-09  48%   66 aa  RL31_CAMJR RecName: Full=50S ribosomal protein L31;
    1::63      3e-09  48%   66 aa  RL31_CAMJJ RecName: Full=50S ribosomal protein L31;
    1::63      3e-09  48%   66 aa  RL31_CAMJE RecName: Full=50S ribosomal protein L31;
    1::63      3e-09  48%   65 aa  RL31_CAMJD RecName: Full=50S ribosomal protein L31;
    1::63      3e-09  48%   66 aa  RL31_CAMJ8 RecName: Full=50S ribosomal protein L31;
    1::65      3e-09  43%   70 aa  RL31_ALTMD RecName: Full=50S ribosomal protein L31;
    1::67      3e-09  45%   75 aa  RL31_ACICJ RecName: Full=50S ribosomal protein L31;
    1::65      3e-09  46%   67 aa  RK31_CYAME RecName: Full=50S ribosomal protein L31,
    1::65      4e-09  46%   68 aa  RL31_DICT6 RecName: Full=50S ribosomal protein L31;
    1::64      4e-09  44%   71 aa  RL31_DESMR RecName: Full=50S ribosomal protein L31;
    1::64      4e-09  45%   76 aa  RL31_DESAD RecName: Full=50S ribosomal protein L31;
    1::60      4e-09  48%   79 aa  RL31_COXBU RecName: Full=50S ribosomal protein L31;
    1::60      4e-09  48%   79 aa  RL31_COXBR RecName: Full=50S ribosomal protein L31;
    1::60      4e-09  48%   79 aa  RL31_COXBN RecName: Full=50S ribosomal protein L31;
    1::60      4e-09  48%   79 aa  RL31_COXB2 RecName: Full=50S ribosomal protein L31;
    1::66      5e-09  45%   74 aa  RL31_STRGG RecName: Full=50S ribosomal protein L31;
    1::65      5e-09  42%   70 aa  RL31_SHEPA RecName: Full=50S ribosomal protein L31;
    1::65      5e-09  42%   70 aa  RL31_SHEHH RecName: Full=50S ribosomal protein L31;
    1::69      5e-09  48%   73 aa  RL31_RHIL3 RecName: Full=50S ribosomal protein L31;
   26::64      5e-09  49%   72 aa  RL31_DEIGD RecName: Full=50S ribosomal protein L31;
    1::64      7e-09  42%   72 aa  RL31_YERE8 RecName: Full=50S ribosomal protein L31;
   27::68      7e-09  45%   74 aa  RL31_SYNJB RecName: Full=50S ribosomal protein L31;
    1::65      7e-09  40%   70 aa  RL31_SHEON RecName: Full=50S ribosomal protein L31;
    1::65      9e-09  40%   70 aa  RL31_SHESR RecName: Full=50S ribosomal protein L31;
    1::65      9e-09  40%   70 aa  RL31_SHESM RecName: Full=50S ribosomal protein L31;
    1::65      9e-09  40%   70 aa  RL31_SHESA RecName: Full=50S ribosomal protein L31;
   32::65      9e-09  53%   70 aa  RL31_SACD2 RecName: Full=50S ribosomal protein L31;
    1::65      1e-08  37%   70 aa  RL31_SHEWM RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  39%   71 aa  RL31_PSEA6 RecName: Full=50S ribosomal protein L31;
   27::65      1e-08  54%   86 aa  RL31_PROM1 RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELPY RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELPS RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELPJ RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELPH RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELPG RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELP2 RecName: Full=50S ribosomal protein L31;
    1::64      1e-08  44%   67 aa  RL31_HELAH RecName: Full=50S ribosomal protein L31;
   23::64      1e-08  48%   73 aa  RL31_DEIRA RecName: Full=50S ribosomal protein L31;
   26::64      1e-08  49%   72 aa  RL31_DEIDV RecName: Full=50S ribosomal protein L31;
    3::66      1e-08  47%   70 aa  RK31_EMIHU RecName: Full=50S ribosomal protein L31,
    1::64      2e-08  41%   69 aa  RL31_TERTT RecName: Full=50S ribosomal protein L31;
    1::63      2e-08  48%   68 aa  RL31_SORC5 RecName: Full=50S ribosomal protein L31;
    1::65      2e-08  42%   70 aa  RL31_SHELP RecName: Full=50S ribosomal protein L31;
    1::65      2e-08  42%   70 aa  RL31_SHEFN RecName: Full=50S ribosomal protein L31;
    1::65      2e-08  43%   71 aa  RL31_PSEE4 RecName: Full=50S ribosomal protein L31;
    1::63      2e-08  43%   66 aa  RL31_NITSB RecName: Full=50S ribosomal protein L31;
    1::64      2e-08  39%   70 aa  RL31_KLEP7 RecName: Full=50S ribosomal protein L31;
    1::69      2e-08  51%   73 aa  RL31_AGRRK RecName: Full=50S ribosomal protein L31;
    1::65      2e-08  38%   72 aa  RL31_RHORT RecName: Full=50S ribosomal protein L31;
   32::64      2e-08  58%   69 aa  RL31_PHYMT RecName: Full=50S ribosomal protein L31;
    1::63      2e-08  40%   70 aa  RL31_MYCMO RecName: Full=50S ribosomal protein L31;
    1::64      2e-08  39%   70 aa  RL31_KLEP3 RecName: Full=50S ribosomal protein L31;
    1::64      2e-08  44%   70 aa  RL31_COLP3 RecName: Full=50S ribosomal protein L31;
    1::63      2e-08  43%   66 aa  RL31_CAMC1 RecName: Full=50S ribosomal protein L31;
   27::66      2e-08  50%   72 aa  RK31_THAPS RecName: Full=50S ribosomal protein L31,
   27::66      2e-08  52%   72 aa  RK31_GUITH RecName: Full=50S ribosomal protein L31,
    1::65      3e-08  38%   70 aa  RL31_SHEAM RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALTY RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALTI RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALSV RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALPK RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALPC RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALPB RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALPA RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALNS RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALHS RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALG2 RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALEP RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALDC RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALCH RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   70 aa  RL31_SALA4 RecName: Full=50S ribosomal protein L31;
    1::68      3e-08  37%   69 aa  RL31_BUCBP RecName: Full=50S ribosomal protein L31;
    1::65      3e-08  40%   70 aa  RL31_AZOVD RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  38%   71 aa  RL31_SODGM RecName: Full=50S ribosomal protein L31;
    1::65      3e-08  37%   70 aa  RL31_SHEDO RecName: Full=50S ribosomal protein L31;
    1::65      3e-08  43%   71 aa  RL31_PSEPW RecName: Full=50S ribosomal protein L31;
    1::65      3e-08  42%   70 aa  RL31_PSEMY RecName: Full=50S ribosomal protein L31;
    1::66      3e-08  38%   78 aa  RL31_FRASN RecName: Full=50S ribosomal protein L31;
    1::63      3e-08  40%   73 aa  RL31_DESPS RecName: Full=50S ribosomal protein L31;
    1::64      3e-08  44%   70 aa  RL31_DESDA RecName: Full=50S ribosomal protein L31;
    1::59      3e-08  46%   75 aa  RL31_DESAH RecName: Full=50S ribosomal protein L31;
   27::65      5e-08  49%   90 aa  RL31_TRIEI RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_SHISS RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_SHIDS RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_SHIBS RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_SHIB3 RecName: Full=50S ribosomal protein L31;
    1::61      5e-08  48%   80 aa  RL31_RHOSR RecName: Full=50S ribosomal protein L31;
    1::68      5e-08  46%   74 aa  RL31_NOVAD RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ESCF3 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOUT RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOSM RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOSE RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOLU RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOLI RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOLC RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOL6 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOL5 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOHS RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECODH RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECOBW RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO8A RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO81 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO7I RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO5E RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO57 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO55 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO45 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO27 RecName: Full=50S ribosomal protein L31;
    1::64      5e-08  39%   70 aa  RL31_ECO24 RecName: Full=50S ribosomal protein L31;
   27::68      5e-08  45%   85 aa  RL31_ACAM1 RecName: Full=50S ribosomal protein L31;
    1::67      6e-08  41%   73 aa  RL31_RHOCS RecName: Full=50S ribosomal protein L31;
   23::64      6e-08  50%   73 aa  RL31_MYXXD RecName: Full=50S ribosomal protein L31;
    3::67      6e-08  38%   92 aa  RL31_MESFL RecName: Full=50S ribosomal protein L31;
    1::63      6e-08  41%   66 aa  RL31_CAMC5 RecName: Full=50S ribosomal protein L31;
    1::63      6e-08  41%  121 aa  RL31_ANADE RecName: Full=50S ribosomal protein L31;
    1::66      8e-08  57%   67 aa  RL31_SYMTH RecName: Full=50S ribosomal protein L31;
    1::64      8e-08  39%   70 aa  RL31_SHIFL RecName: Full=50S ribosomal protein L31;
    1::65      8e-08  42%   72 aa  RL31_PSEPF RecName: Full=50S ribosomal protein L31;
    1::68      8e-08  53%   75 aa  RL31_NITWN RecName: Full=50S ribosomal protein L31;
    1::64      8e-08  41%   75 aa  RL31_LEGPL RecName: Full=50S ribosomal protein L31;
    1::64      8e-08  41%   75 aa  RL31_LEGPH RecName: Full=50S ribosomal protein L31;
    1::64      8e-08  41%   75 aa  RL31_LEGPC RecName: Full=50S ribosomal protein L31;
    1::64      8e-08  41%   75 aa  RL31_LEGPA RecName: Full=50S ribosomal protein L31;
    1::65      8e-08  38%   72 aa  RL31_ALCBS RecName: Full=50S ribosomal protein L31;
    1::69      8e-08  42%   73 aa  RL31_AGRVS RecName: Full=50S ribosomal protein L31;
   27::65      8e-08  49%   70 aa  RK31_PORYE RecName: Full=50S ribosomal protein L31,
   27::65      8e-08  49%   70 aa  RK31_PORPU RecName: Full=50S ribosomal protein L31,
   27::65      8e-08  49%   73 aa  RK31_PALPL RecName: Full=50S ribosomal protein L31,
    1::64      1e-07  42%   71 aa  RL31_PHOLL RecName: Full=50S ribosomal protein L31;
    1::68      1e-07  52%   75 aa  RL31_NITHX RecName: Full=50S ribosomal protein L31;
    1::63      1e-07  48%   66 aa  RL31_LEPBP RecName: Full=50S ribosomal protein L31;
    1::63      1e-07  48%   66 aa  RL31_LEPBA RecName: Full=50S ribosomal protein L31;
    1::64      1e-07  38%   70 aa  RL31_SHEB9 RecName: Full=50S ribosomal protein L31;
    1::64      1e-07  38%   70 aa  RL31_SHEB8 RecName: Full=50S ribosomal protein L31;
    1::64      1e-07  38%   70 aa  RL31_SHEB5 RecName: Full=50S ribosomal protein L31;
    1::64      1e-07  38%   70 aa  RL31_SHEB2 RecName: Full=50S ribosomal protein L31;
    1::62      1e-07  42%   71 aa  RL31_MYCA5 RecName: Full=50S ribosomal protein L31;
    1::67      1e-07  39%   77 aa  RL31_MAGSA RecName: Full=50S ribosomal protein L31;
    1::68      2e-07  48%   73 aa  RL31_RHISN RecName: Full=50S ribosomal protein L31;
    1::65      2e-07  38%   70 aa  RL31_PSYIN RecName: Full=50S ribosomal protein L31;
    1::65      2e-07  38%   71 aa  RL31_PSEAE RecName: Full=50S ribosomal protein L31;
    1::65      2e-07  38%   71 aa  RL31_PSEAB RecName: Full=50S ribosomal protein L31;
    1::65      2e-07  38%   71 aa  RL31_PSEA8 RecName: Full=50S ribosomal protein L31;
    1::64      2e-07  41%   67 aa  RL31_LEPIN RecName: Full=50S ribosomal protein L31;
    1::64      2e-07  41%   67 aa  RL31_LEPIC RecName: Full=50S ribosomal protein L31;
    1::64      2e-07  41%   67 aa  RL31_LEPBL RecName: Full=50S ribosomal protein L31;
    1::64      2e-07  41%   67 aa  RL31_LEPBJ RecName: Full=50S ribosomal protein L31;
    1::58      2e-07  43%   72 aa  RL31_HAHCH RecName: Full=50S ribosomal protein L31;
    1::64      2e-07  36%   70 aa  RL31_ENTS8 RecName: Full=50S ribosomal protein L31;
    1::69      2e-07  44%   75 aa  RL31_ZYMMO RecName: Full=50S ribosomal protein L31;
    1::68      2e-07  42%   75 aa  RL31_RHOPB RecName: Full=50S ribosomal protein L31;
   32::65      2e-07  47%   71 aa  RL31_PSEA7 RecName: Full=50S ribosomal protein L31;
    1::67      2e-07  39%   76 aa  RL31_PELUB RecName: Full=50S ribosomal protein L31;
    1::70      2e-07  49%   73 aa  RL31_PARL1 RecName: Full=50S ribosomal protein L31;
    1::68      2e-07  49%   74 aa  RL31_OLICO RecName: Full=50S ribosomal protein L31;
    1::69      3e-07  37%   76 aa  RL31_SPHWW RecName: Full=50S ribosomal protein L31;
    1::65      3e-07  38%   70 aa  RL31_SHESH RecName: Full=50S ribosomal protein L31;
    1::67      3e-07  40%   72 aa  RL31_BUCAT RecName: Full=50S ribosomal protein L31;
    1::69      3e-07  45%   73 aa  RL31_AGRT5 RecName: Full=50S ribosomal protein L31;
   27::61      4e-07  54%   83 aa  RL31_SYNSC RecName: Full=50S ribosomal protein L31;
    1::69      4e-07  38%   75 aa  RL31_SPHAL RecName: Full=50S ribosomal protein L31;
    1::58      4e-07  45%   74 aa  RL31_CHLP8 RecName: Full=50S ribosomal protein L31;
    1::67      4e-07  36%   75 aa  RL31_BAUCH RecName: Full=50S ribosomal protein L31;
    1::65      5e-07  38%   73 aa  RL31_PSEF5 RecName: Full=50S ribosomal protein L31;
    1::64      5e-07  34%   70 aa  RL31_PROMH RecName: Full=50S ribosomal protein L31;
    1::64      5e-07  38%   70 aa  RL31_ENT38 RecName: Full=50S ribosomal protein L31;
    1::67      5e-07  39%   72 aa  RL31_BUCAI RecName: Full=50S ribosomal protein L31;
    1::67      5e-07  39%   72 aa  RL31_BUCA5 RecName: Full=50S ribosomal protein L31;
    1::63      7e-07  38%   66 aa  RL31_SULDN RecName: Full=50S ribosomal protein L31;
    1::65      7e-07  40%   77 aa  RL31_PSEFS RecName: Full=50S ribosomal protein L31;
    1::69      7e-07  45%   74 aa  RL31_PHEZH RecName: Full=50S ribosomal protein L31;
    3::69      7e-07  39%   75 aa  RK31_CYACA RecName: Full=50S ribosomal protein L31,
    1::65      9e-07  38%   75 aa  RL31_PSESM RecName: Full=50S ribosomal protein L31;
    1::66      9e-07  38%   73 aa  RL31_HAMD5 RecName: Full=50S ribosomal protein L31;
    1::67      9e-07  34%   82 aa  RL31_BLOPB RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIBY RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIBT RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIBS RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIBC RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIB5 RecName: Full=50S ribosomal protein L31;
    1::65      9e-07  35%   74 aa  RL31_ACIB3 RecName: Full=50S ribosomal protein L31;
   27::69      9e-07  44%   72 aa  RK31_ODOSI RecName: Full=50S ribosomal protein L31,
    1::65      1e-06  42%   74 aa  RL31_SALAI RecName: Full=50S ribosomal protein L31;
    1::65      1e-06  37%   73 aa  RL31_PSEU2 RecName: Full=50S ribosomal protein L31;
   27::65      1e-06  44%   79 aa  RK31_GRATL RecName: Full=50S ribosomal protein L31,
    1::69      1e-06  45%   74 aa  RL31_XANP2 RecName: Full=50S ribosomal protein L31;
    1::68      1e-06  42%   73 aa  RL31_SILPO RecName: Full=50S ribosomal protein L31;
    1::68      1e-06  42%   75 aa  RL31_RHOPT RecName: Full=50S ribosomal protein L31;
    1::68      1e-06  42%   75 aa  RL31_RHOPA RecName: Full=50S ribosomal protein L31;AltName:
    1::68      1e-06  42%   75 aa  RL31_RHOP2 RecName: Full=50S ribosomal protein L31;
    1::50      1e-06  50%   78 aa  RL31_FRAAA RecName: Full=50S ribosomal protein L31;
    1::72      1e-06  41%   76 aa  RL31_CAUCR RecName: Full=50S ribosomal protein L31;
    1::72      1e-06  41%   76 aa  RL31_CAUCN RecName: Full=50S ribosomal protein L31;
    1::64      1e-06  38%   72 aa  RL31_BUCAP RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_SILST RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_RHOSK RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_RHOS4 RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_RHOS1 RecName: Full=50S ribosomal protein L31;
    1::65      2e-06  37%   73 aa  RL31_PSE14 RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  43%   73 aa  RL31_MESSB RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  48%   75 aa  RL31_BRAJA RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  41%   71 aa  RL31_THEP1 RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  41%   71 aa  RL31_THEMA RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_SINMW RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_RHOS5 RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  40%   73 aa  RL31_RHOP5 RecName: Full=50S ribosomal protein L31;
    1::68      2e-06  42%   73 aa  RL31_RHIME RecName: Full=50S ribosomal protein L31;
   33::66      2e-06  50%   72 aa  RL31_BEUC1 RecName: Full=50S ribosomal protein L31;
    1::69      2e-06  34%   73 aa  RL31_BARBK RecName: Full=50S ribosomal protein L31;
    1::65      2e-06  34%   74 aa  RL31_ACIAD RecName: Full=50S ribosomal protein L31;
    1::68      3e-06  43%   72 aa  RL31_MARMM RecName: Full=50S ribosomal protein L31;
    1::68      3e-06  41%   75 aa  RL31_BRASB RecName: Full=50S ribosomal protein L31;
    1::69      3e-06  45%   74 aa  RL31_AZOC5 RecName: Full=50S ribosomal protein L31;
    1::68      4e-06  41%   71 aa  RL31_THESQ RecName: Full=50S ribosomal protein L31;
    1::68      6e-06  41%   75 aa  RL31_RHOPS RecName: Full=50S ribosomal protein L31;
    1::68      6e-06  46%   73 aa  RL31_PARDP RecName: Full=50S ribosomal protein L31;
    1::65      7e-06  42%   74 aa  RL31_SALTO RecName: Full=50S ribosomal protein L31;
   33::65      7e-06  48%   75 aa  RL31_NOCSJ RecName: Full=50S ribosomal protein L31;
    1::69      7e-06  44%   76 aa  RL31_BEII9 RecName: Full=50S ribosomal protein L31;
    1::63      9e-06  30%   71 aa  RL31_MYCS5 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_OCHA4 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUSU RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUSI RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUO2 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUME RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUMB RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUC2 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUAB RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUA2 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  42%   73 aa  RL31_BRUA1 RecName: Full=50S ribosomal protein L31;
    1::69      1e-05  32%   73 aa  RL31_BARHE RecName: Full=50S ribosomal protein L31;
    1::65      2e-05  38%   71 aa  RL31_PETMO RecName: Full=50S ribosomal protein L31;
    1::66      2e-05  37%   69 aa  RL31_THEAB RecName: Full=50S ribosomal protein L31;
    1::68      2e-05  40%   73 aa  RL31_RHILO RecName: Full=50S ribosomal protein L31;
    1::68      2e-05  45%   76 aa  RL31_METSB RecName: Full=50S ribosomal protein L31;
    1::66      4e-05  37%   69 aa  RL31_THEM4 RecName: Full=50S ribosomal protein L31;
   27::65      4e-05  38%   72 aa  RK31_PHATR RecName: Full=50S ribosomal protein L31,
   32::63      5e-05  44%   69 aa  RL31_MYCPU RecName: Full=50S ribosomal protein L31;
    1::69      6e-05  29%   73 aa  RL31_BART1 RecName: Full=50S ribosomal protein L31;
    1::69      6e-05  34%   73 aa  RL31_BARQU RecName: Full=50S ribosomal protein L31;
    1::64      8e-05  36%   71 aa  RL31_WIGBR RecName: Full=50S ribosomal protein L31;
    1::66      2e-04  34%   69 aa  RL31_KOSOT RecName: Full=50S ribosomal protein L31;
    1::68      3e-04  36%   73 aa  RL31_DINSH RecName: Full=50S ribosomal protein L31;
    1::68      4e-04  34%   73 aa  RL31_ROSDO RecName: Full=50S ribosomal protein L31;
    1::68      5e-04  34%   73 aa  RL31_JANSC RecName: Full=50S ribosomal protein L31;
    1::50      5e-04  36%   78 aa  RL31_FRASC RecName: Full=50S ribosomal protein L31;
  249::306     5e-04  36%  429 aa  ENO_THEM4 RecName: Full=Enolase;         EC=4.2.1.11;AltName:
    1::82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_LACS1     MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_LACSS     MKQGIHPDYHKVVFMDSSTGFKFISGSTANSAETVEWEDGNTYPLIRVEISSDSHPFYTGKQKFTQADGR
RL31B_LACCB     MKQGIHPDYHPVVFMDSATGFKFISGSTKTSKETVKWEDGKEYPLVRVEISSDSHPFYTGKQKFTQADGR
RL31B_LACC3     MKQGIHPDYHPVVFMDSATGFKFISGSTKTSKETVKWEDGKEYPLVRVEISSDSHPFYTGKQKFTQADGR
RL31B_LACBA     MKQGIHPDYREVVFQDSSTGFQFLSGSTATSDETVEWEDGNTYPLIRVEITSDSHPFYTGKQKFTQADGA
RL31B_LACF3     MKQGIHPDYHLVVFEDSATGYKFISGSTATSKETVEWEDGNEYPLVRVEVTSDSHPFYTGKQKFTQADGA
RL31B_ENTFA     MKQDIHPNYQPVVFMDSTTGFKFLSGSTKGSSETVEWEDGNTYPLLRVEVTSDSHPFYTGRQKFTQADGR
RL31B_LACRJ     MKQGIHPDYHPVVFEDSSTGYKFLSGSTATSSETVKWEDGNEYPLIRVEVTSDSHPFYTGKQKFTQADGA
RL31B_LACRD     MKQGIHPDYHPVVFEDSSTGYKFLSGSTATSSETVKWEDGNEYPLIRVEVTSDSHPFYTGKQKFTQADGA
RL31B_BACHK     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACCZ     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACCR     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC4     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC3     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC2     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSSETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC0     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACAN     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACAC     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACAA     MKAGIHPDYKKVVFMDTNTGFKFLSGSTKGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC7     MKAGIHPDYKKVVFMDTNTGFKFLSGSTRGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_BACC1     MKAGIHPDYKKVVFMDTNTGFKFLSGSTRGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGR
RL31B_LACPL     MQKGIHPDYHLVVFQDSTTGFKFISGSTATSAETVEWEDGNTYPLIRVEITSDSHPFYTGKQKFTKADGA
RL31B_EXIS2     MKQGIHPNYNKVVFMDSTTEYKFLTGSTRSSNETITWEDGNEYPLIRVDVSSDSHPFYTGRQKFNAADGR
RL31B_MACCJ     MKQGIHPDYHKVIFLDSTTDFKFLSGSTRTSSETMTWEDGNEYPVIRLDISSDSHPFYTGRQKFASADGR
RL31B_LACLS     MKQNIHPNYQPVVFMDTTTGYKFLTGSTKGSKETVEWEDGNTYPLIRVEISSDSHPFYTGRQKFQAADGR
RL31B_LACLM     MKQNIHPNYQPVVFMDTTTGYKFLTGSTKGSKETVEWEDGNTYPLIRVEISSDSHPFYTGRQKFQAADGR
RL31B_PEDPA     MKKGIHPDYHPVVFQDSATGFKFLSGSTVGSAETIKWEDGNEYPLIRVEITSDSHPFYTGRQKFQQADGT
RL31B_STAHJ     MRQGIHPDYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDVSSDSHPFYTGRQKFAAADGR
RL31B_LACLA     MKQNIHPNYQPVVFMDTTTGFKFLTGSTKGSKETVEWEDGNTYPLIRVEISSDSHPFYTGRQKFQAADGR
RL31B_STAES     MKQGIHPEYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDVSSDSHPFYTGRQKFAAADGR
RL31B_STAEQ     MKQGIHPEYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDVSSDSHPFYTGRQKFAAADGR
RL31B_STACT     MRQGIHPEYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STRU0     MRKDIHPDYRPVVFLDTTTGYKFLSGSTKSSKETIEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRTD     MKKDIHPDYRPVVFMDTTTGYQFLSGSTKHSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRT2     MKKDIHPDYRPVVFMDTTTGYQFLSGSTKHSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRT1     MKKDIHPDYRPVVFMDTTTGYQFLSGSTKHSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_BACHD     MKPGIHPDYKKVVFMDTSTGFKFLSGSTKTSNETIEWEDGNTYPLIKVEISSDSHPFYTGKQKLADAGGR
RL31B_STRA5     MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRA3     MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRA1     MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STAS1     MRQNIHPEYHNVIFLDTTTDFKFLSGSTKTSSETMEWEDGNEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STREM     MRKDIHPDYRPVVFLDTTTGYKFLSGSTKTSKETIEFE-GETYPLVRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRE4     MRKDIHPDYRPVVFLDTTTGYKFLSGSTKTSKETIEFE-GETYPLVRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRMU     MKKDIHPEYRPVVFMDTSTGYQFLSGSTKTSKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRS7     MRKDIHPDYRPVVFLDTTTGYKFLSGSTKASKETIEFE-GETYPLVRVEISSDSHPFYTGRQKFTQADGR
RL31B_LISW6     MKTGIHPEYRQVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_STRZT     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRZP     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRZJ     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRR6     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPN     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPJ     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPI     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP7     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP4     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP2     MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRSV     MRKDIHPEYRPVVFMDTSTGYQFLSGSTKRSNETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STAAW     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAT     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAS     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAR     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAN     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAM     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAE     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAC     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAAB     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAA9     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAA8     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAA3     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAA2     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_STAA1     MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGR
RL31B_LISMO     MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_LISMH     MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_LISMF     MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_LISMC     MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_LISIN     MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEISSDSHPFYTGKQKHATADGR
RL31B_STRPZ     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPM     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPG     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPF     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPD     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPC     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRPB     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP8     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP6     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP3     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_STRP1     MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFE-GETYPLIRVEISSDSHPFYTGRQKFTQADGR
RL31B_LACDB     MKKGIHPDYQEVCFMDAATGFKFVAGSTLKSSETVEFE-GNTYPLIRVEISSDSHPFYTGKQKFAAADGR
RL31B_LACDA     MKKGIHPDYQEVCFMDAATGFKFVAGSTLKSSETVEFE-GNTYPLIRVEISSDSHPFYTGKQKFAAADGR
RL31B_LACJO     MRKGIHPDYQEVVFMDSATGAKFVAGSTLKPEETIEFE-GKTYPLVRVEISSDSHPFYTGKQKFAQADGR
RL31B_LACGA     MRKGIHPDYQEVVFMDSATGAKFVAGSTLKPEETIEFE-GKTYPLVRVEISSDSHPFYTGKQKFAQADGR
RL31B_LACAC     MKQGIHPDFQKVVFMDSATGAKFVAGSTMKPEETIEYE-GETYPLVRVEVSSDSHPFYTGKQKFAQADGR
RL31B_LACH4     MKQGIHPDFQKVVFMDSATGAKFLAGSTLKPEETVDYE-GETYPLVRVEVSSDSHPFYTGKQKFAQADGR
RL31B_BACSK     MKPEIHPTYQKVVFMDTSTGFKFLTGSTRGSSETIEWEDGNTYPLIKVEISSDSHPFYTGKQKLADAGGR
RL31B_EXISA     MKQGIHPEYRKVVFMDSTTEFKFITGSTRYSNETITMEDGNEYPLIRVDVSSDSHPFYTGRQKFASADGR
RL31B_OCEIH     MKKDIHPEYKKVVFLDTSTNFKFLSGSTKGSDETIEWEDGNTYPLIKVEISSDSHPFYTGKQKADKVGGR
RL31B_BACA2     MKKDIHPDNHQVIFQDVNSGYRFLSHSTKKSEETAEWEDGKTYPLIKVEVSSDTHPFYTGRQKFNEKGGR
RL31B_BACSU     MKEGIHPKNHKVIFQDVNSGYRFLSTSTKTSNETAEWEDGNTYPVIKVEVSSDTHPFYTGRQKFNEKGGR
RL31B_OENOB     MKADIHPDYRQVVFVDSTTGAKFLSGSTAKAQGEVEYE-GQTYPMVRVEVTSDSHPFYTGKQKINQADGA
RL31B_NOCFA     MKAGIHPDYHPVVFEDSSTGKRFLTRSTATSERTVEWTDGNTYPLLVVDVTADSHPFWTGAQRLLDTQGR
RL31B_BACLD     MKPNIHPKTYQVIFQDVNSGYRFLSRSTKTSDETAEWEDGKTYPVIKVEVSSDTHPFYTGRQKFNERGGR
RL31B_AMOA5     MKKGIHPTYREVVFLDTSSNFKFLTRSTLNSRETIKWEDGQEYPLIKVELSSASHPFYTGKKIFVDTAGR
RL31B_CORU7     MKKDIHPDYHPVVFKDSATGKQFLTRSTATSDRTVEWEDGNEYPLIVVDITSESHPFWTGAQRVMDTAGR
RL31B_CORK4     MKKNIHPDYHPVVFKDASTGHQFLTRSTATSDRTVEWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_LEIXX     MKTGIHPDYAPVVFRDLASGATFLTRSTVSSQKTIEWEDGSTYPVIDVEISSESHPFYTGKQRILDSAGR
RL31B_CORDI     MKKDIHPDYHPVVFQDAGTGHQFLTKSTATSDRTVAWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_CORJK     MKKDIHPDYHPVVFKDASTGHQFITRSTATSDRTVEWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_HALHL     MKKDIHPEYREVVFQDISTDFSFLTRSTVKTDETITWQDGNEYPLVKIEVSSRSHPFFTGKQRVVHSGGQ
RL31B_RHOE4     MKKQMHPDYHPVVFQDASTGKSFLTRSTVTSERTVEWEDGGTYPLLVVDVTSDSHPFWTGAQRVMDTAGR
RL31B_CORA7     MKKDIHPDYHPVVFKDAGTGHSFLTKSTATSDRTVEWEDGNEYPLIVVDVTAESHPFWTGAQRVMDTAGR
RL31B_ALHEH     MKQGIHPKYREVVFQDISSDFAFITRSTVRTNETIQWEDGKEYPLFKVEVSSKSHPFYTGKQRALSSGGR
RL31B_DICNV     MKKDIHPAYRPVVFYDASAEFKILTRSTVETKETIQWEDGNEYPLVRIDVSSKSHPFYTGKQNIVDTAGR
RL31B_ARTS2     MKSNTHPKYEAVVFNDLASGVKFLTKSTVSSKKTIEWEDGNTYPVIDVEISSESHPFYTGKQRIMDSAGR
RL31B_ARTCA     MKSDIHPKYAAVVFNDLASGTKFLTKSTVSSSKTIEWEDGNTYPVIDVEISSESHPFYTGKQRIMDSAGR
RL31B_CORGL     MKKDIHPDYHAVVFQDAGTGFQFLTKSTASSDRTVSWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_CORGB     MKKDIHPDYHAVVFQDAGTGFQFLTKSTASSDRTVSWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_RENSM     MKSDIHPKYEAVVFNDLASGAKFLTRSTVSSDKTIEWEDGKTYPVIDVEISSESHPFYTGKQRIMDSAGR
RL31B_COREF     MKNEIHPDYHPVVFQDAGTGFQFLTRSTATSDRTIAWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGR
RL31B_PROAC     MKQGIHPDYHPVVFRDISADTAFLTRSTVTSSTEIKWQDGNTYPVIDVDITSASHPFYTGKAKIVDTAGR
RL31B_MICLC     MKSEIHPDYHYVIFNDLASGEKILTRTTANSDKTAEWTDGNTYPVIDVEISAASHPFYTGKQRIMDTAGR
RL31B_METFK     MKPGIHPEYREVVFQDIGADFSFLTRSTIAAKETIKWTDGKEYPLVKIEVSSQSHPFYTGKQKILDTAGR
RL31B_SALAI     MRRGIHPEYRPVVYRDRAADFAFLTRSTATSEQTIEWTDGNTYPVVDVQISSASHPFWTGRQRLVDAAGR
RL31B_POLSQ     MKPGIHPEYREIVFVDVSNNFSFKTRSTMSTRETIKWEDGNEYPLAKIETSSESHPFYTGTQKIMDTAGR
RL31B_STRM5     MKADIHPNYRDVVFHDVTSDFKILTRSTMSTKETIKWEDGNDYPLVKVEISSASHPFYTGKHKVIDTSGR
R31B1_STRCO     MQQDKHPDYRPVVFRDRGAGYAFLTRSTATSDQTIVWDDGETYPVVEVEISSESHPFYTGKARTVDSEGR
RL31B_POLNS     MKPGIHPEYREIVFVDVSNNFSFKTRSTMATKETIKWEDGNEYPLAKIETSSESHPFYTGTQKIMDTAGR
RL31B_VIBVY     MKPGIHPEYRKVVFHDTSVDHYFVVGSTLQTDRTIEWEDGQTYPYFTIEVSSESHPFYTGKQRVVQKEGR
RL31B_VIBVU     MKPGIHPEYRKVVFHDTSVDHYFVVGSTLQTDRTIEWEDGQTYPYFTIEVSSESHPFYTGKQRVVQKEGR
RL31B_STRMK     MKADIHPNYRDVVFHDVTSDFKILTRSTMATKETIQWEDGNEYPLVKVEISSASHPFYTGKHKVIDTSGR
RL31B_XANOR     MKDNVHPNYKDVVFHDVTSDFKILTRSTMTSKETVKWEDGQEYPLIKVEISSSSHPFYTGKHKVIDTGGR
RL31B_XANOM     MKDNVHPNYKDVVFHDVTSDFKILTRSTMTSKETVKWEDGQEYPLIKVEISSSSHPFYTGKHKVIDTGGR
RL31B_XANCP     MKDNVHPSYNDVVFHDVTSDFKILTRSTMSSKETVKWEDGQDYPLIKVEISSASHPFYTGKHKVIDTGGR
RL31B_XANC8     MKDNVHPSYNDVVFHDVTSDFKILTRSTMSSKETVKWEDGQDYPLIKVEISSASHPFYTGKHKVIDTGGR
RL31B_XANC5     MKDNVHPNYKDVVFHDVTSDFKILTRSTMTSKETVKWEDGQEYPLIKVEISSSSHPFYTGKHKVIDTGGR
RL31B_XANAC     MKDNVHPNYKDVVFHDVTSDFKILTRSTMTSKETVKWEDGQEYPLIKVEISSSSHPFYTGKHKVIDTGGR
RL31B_CLAM3     MKTDIHPKYAPVVFRDLASGATFLTRSTVSSSKTIEWEDGNTYAVIDVEISSESHPFYTGKQRIMDSAGR
RL31B_BURPS     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURP6     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURP1     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURP0     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURMS     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURMA     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURM9     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURM7     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BDEBA     MKQNLHPKVNTVVFKDISCDFSFLGTSTLHSSETVKWEDGKEYPLIKVEISSASHPFFTGKQRVMDTEGR
R31B2_STRCO     MRKGIHPEYRPVVFRDRAADYAFLTRSTMTSERTVEWEDGRTYPVVDVEVSHVSHPFYTGTARVLDTAGR
R31B1_STRAW     MQQDKQPDYHPVVFRDRAAGYAFLTRSTATSDKTIEWDDGETYPVVDVEISSESHPFYTGKARTVDSEGR
RL31B_RHOSR     MKANIHPDYHPVVFQDASTGTTFLTRSTVTSDRTALWSDGNTYPLVVVDVTSESHPFWTGAQRVMDTAGR
RL31B_JANMA     MKEGIHPDYRDVVFQDMSNDFKFITRSTIQTRETIEFE-GASYPLVKIEVSSESHPFYTGKHKIVDTAGR
RL31B_BORGA     MRKGVHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYTDGKEYPLITVEITSRSHPFYTGQQKFVDAAGR
RL31B_VIBPA     MKPGIHPDYRPVVFHDTSVDEYFVVGSTLKTDRTIEWKDGKTYPYFTLDVSSSSHPFYTGKQRVVQAEGR
RL31B_STRGG     MKPGIHPSYGPVVFRDKAADFAFLTRSTMTSDRTVAWEDGNTYPVVDVEISSASHPFYTGTARVLDTAGR
RL31B_BURTA     MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEL-DGKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BORAP     MRKGVHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGR
RL31B_BURP8     MKEGIHPDYREVLFIDMSNDFKFVTRSTIQTRETAEF-NGKTYPLAKIEVSSESHPFYTGQQKIMDTAGR
RL31B_VIBHB     MKPGIHPEYRPVVFHDTSVDEYFVVGSTLQTDRTIEWKDGKTYPYFTLDVSSESHPFYTGKQRVVQAEGR
RL31B_XYLFM     MKPEIHPIYREVVFHDVTSNFKFLTRSTMSTKETTLWEDGREYPLVKVEISSASHPFYTGKHKLVDTSGR
RL31B_XYLFA     MKPEIHPIYREVVFHDVTSNFKFLTRSTMSTKETTLWEDGREYPLVKVEISSASHPFYTGKHKLVDTSGR
RL31B_SALTO     MKPGIHPEYRPVVYRDKGADFAFLTRSTSTSDQTIEWTDGNTYPVIDVQISSASHPFWTGKQRLLDTAGR
RL31B_SACEN     MKPGIHPEYGPVVFRDRSTGTQFLTRSTATSEERVEWSDGNSYPLIVVDVTSASHPFWTGGRQVLDTQGR
RL31B_KOCRD     MKADIHPDYHPVLFRDLASGKVILTRSTATSSKTETWEDGDEYPIIEVEISSESHPFYTGKQRIMDSAGR
RL31B_VIBSL     MKPNIHPDYRPVVFHDTSVDEYFLIGSTLKTDRTIEWEDGNTYPYFTIEVSSKSHPFYTGKQRVLHKEGR
RL31B_BORBZ     MRKDIHPKNNLVVFKDGSNGAMFLTKSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGR
RL31B_XYLFT     MKPEIHPIYREVVFHDVTSNFKFLTRSTMGTKETTLWEDGLEYPLVKVEISSASHPFYTGKHKLVDTSGR
RL31B_XYLF2     MKPEIHPIYREVVFHDVTSNFKFLTRSTMGTKETTLWEDGLEYPLVKVEISSASHPFYTGKHKLVDTSGR
RL31B_BURM1     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIELE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURCH     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEHE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURCC     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEHE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURCA     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEHE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BORBU     MRKDIHPKNNLVVFKDGSNGAMFLTKSTLNSKETIKYIDGKEYPLVTVEITSKSHPFYTGQQKFVDAAGR
RL31B_VIBCM     MKAGIHPDYRKVVFHDTTVDHYFVVGSTLQTDRTIEWE-GKTYPYITIEVSSESHPFYTGKQRVVQKEGR
RL31B_VIBCH     MKAGIHPDYRKVVFHDTTVDHYFVVGSTLQTDRTIEWE-GKTYPYITIEVSSESHPFYTGKQRVVQKEGR
RL31B_VIBC3     MKAGIHPDYRKVVFHDTTVDHYFVVGSTLQTDRTIEWE-GKTYPYITIEVSSESHPFYTGKQRVVQKEGR
RL31B_LEUMM     MQAEIHPDYRQVVFIDASTGKKFLSASTVTSNDTTDFE-GKEYPAIRMDITSDSHPFYTGKQKFTQADGA
R31B2_STRAW     MREGIHPAYAPVVFRDRAANHAFLTRSTMTSEKTVEWTDGHTYPVVDVEISNVSHPFYTGTARVLDTAGR
RL31B_HERAR     MKAGIHPEYREVLFHDVSNDFKFITRSTINTREKIEFE-GTEYPLVKIEVSSESHPFYTGKHKIVDTAGR
RL31B_BURXL     MKEGIHPDYREVLFIDVSNDFKFVTRSTIQTRETAEFE-GKTYPLAKIEVSSESHPFYTGQQKIMDTAGR
RL31B_BURPP     MKEGIHPDYREVLFIDVSNDFKFVTRSTIQTRETAEFE-GKTYPLAKIEVSSESHPFYTGQQKIMDTAGR
RL31B_BURVG     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIDHE-GKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_LEUCK     MQAEIHPNYRPVVFLDATTGKKFLSASTVTSNDTTEFE-GQEYPVIRMDITSDSHPFYTGKQKFTQADGA
RL31B_CLAMS     MKTDIHPKYAPVVFRDLASGATFLTRSTVSSSKTIVWEDGNEYAVIDVEISSESHPFYTGKQRIMDSAGR
RL31B_BURCJ     MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRENIEL-DGKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_MYCA9     MKPGIHPDYHPVVFQDTTTGKMFLTRSTATSTRTVEWE-GKEYPLITAEVTADSHPFWTGDRRIVDSAGQ
RL31B_BURS3     MKEGIHPNYREVVFQDMSNGFKFITRSTIQTRENIEL-DGKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURCM     MKEGIHPNYREVVFQDMSNGFKFITRSTIQTRENIEL-DGKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_BURA4     MKEGIHPNYREVVFQDMSNGFKFITRSTIQTRENIEL-DGKTYPLAKIEVSSESHSFYTGQQKIMDTAGR
RL31B_RALSO     MKENTHPNYREVVFQDMSSDFSFVTRSTIQTKESIVWKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGR
RL31B_MYCVP     MKPGIHPDYHPVVFQDANTGKQFLTRSTLTSARTVEWETSREYPLVVVEVTSDSHPFWTGSRRIVDAAGQ
RL31B_ALISL     MKEGIHPTYRKVLFHDTSVNKYFLIGSTLQTDRTMKWEDGKEYPYMTLDISSESHPFYTGEQRVVSTEGR
RL31B_RALME     MKEGIHPNYREVLFHDVSNDFKFVTRSTIQTKDTIEHE-GKTYPLAKIEVSSESHPFYTGTQKIMDTAGR
RL31B_THICR     MQAGIHPEYNEVVFQDISTGETFLTRSTKTSGDTITL-DGKEYPLVRIEVSSASHPFFTGKQSLVDTEGR
RL31B_RALPJ     MKEGIHPNYREVVFQDMSSDFKFITRSTIQTKEMITL-DGKEYPLAKIEVSSESHPFYTGQQKVLDTAGR
RL31B_CUPTR     MKEGIHPNYREVVFQDMSSDFSFITRSTIQTKDTIV-KDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGR
RL31B_RUBXD     MKKGIHPEYRPVVFRDAGADFAFLTRSTVETNKTIEWEDGNTYPLVELDISSASHPFYTGRQR-------
RL31B_TROWT     MKSDIHPEYGYVVFKDLASSEMFLTRSVLKPEKQIEWNDGNHYPLFEVEISSASHPFYTGQQRILDSEGR
RL31B_TROW8     MKSDIHPEYGYVVFKDLASSEMFLTRSVLKPEKQIEWNDGNHYPLFEVEISSASHPFYTGQQRILDSEGR
RL31B_RALEJ     MKEGIHPNYREVVFQDMSCDFSFITRSTIQTKDTIV-KDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGR
RL31B_PSEFS     MKAGIHPDYRTVLFHDTAADVFFLIGSTADSDRTHVHSDGNTYPYIPLDVSSASHPIYTGQQRKTQVEGR
RL31B_BORPA     MKEGIHPEYREVVFMDVQTGNKFITRSTIHTRETVEM-DGKTYPLFKCDVTSESHPFYTGAQTRIVETGR
RL31B_BORBR     MKEGIHPEYREVVFMDVQTGNKFITRSTIHTRETVEM-DGKTYPLFKCDVTSESHPFYTGAQTRIVETGR
RL31B_BACV8     MKKGIHPEYRPVVFKDMSNGDVFLSRSTCSTKETIEFE-GETYPLVKLEISNTSHPFYTGKSKLVDTAGR
RL31B_CHLTB     MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKTEVFE-GQEYPVCYVSISSSSHPFFTGSKKLVDAEGR
RL31B_CHLT2     MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKTEVFE-GQEYPVCYVSISSSSHPFFTGSKKLVDAEGR
RL31B_BIFLI     MQEGIHPEYGPVVFYDRSADKYFLTKSTLVAKATIDWEDGNTYPLVNVEVSSYSHPFYTGKNVVIDAAGQ
RL31B_BORPE     MKEGIHPEYREVVFMDVQTGNKFVTRSTIHTRETVE-IDGKTYPLFKCDVTSESHPFYTGAQTRIVETGR
RL31B_AERS4     MRPNIHPEYRQVLFHDLTANTYFLVGSTLKTDRTKQWEDGNTYPYVTLDVSSASHPFYTGKQKQIGKEGQ
RL31B_RALEH     MKEGIHPNYREVVFQDMSSDFSFITRSTIQTKDKIV-KDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGR
RL31B_CHLAB     MKKNTHPNYQQVLFVDSSTGYKFVCGSTYQSDKTEVFE-GQEYPVCYVSVSSASHPFFTGSKRLVDAEGR
RL31B_AERHH     MRPDIHPEYRQVLFHDLTANTYFLVGSTLKTDRTKLWEDGNTYPYVTLDVSSASHPFYTGKQKQVSKEGQ
RL31B_PSEU5     MKPGIHPDYRPVLFHDTAADVYFLIGSTAETTRTHQHTDGNTYPYIALDVSSASHPIYTGKQRKTTTEGR
RL31B_PSEF5     MKPGIHPDYRTVLFHDTAADVYFLIGSTVDTDRSHTYSDGKTYPYVALDVSSASHPVYTGQQRKTQSEGR
RL31B_PARD8     MKKGIHPEYRPVVFKDMSNDDVFITRSTINAKETIEI-DGVTYPLVKVEISNTSHPFYTGKSKLVDTAGR
RL31B_BACTN     MKKGLHPEYRPVVFKDMSNGDMFLSKSTVATKETIEFE-GETYPLLKIEISNTSHPFYTGKSTLVDTAGR
RL31B_BACFR     MKKGLHPEYRPVVFKDMSNGDMFLSKSTVATKETIEFE-GETYPLLKIEISNTSHPFYTGKSTLVDTAGR
RL31B_BACFN     MKKGLHPEYRPVVFKDMSNGDMFLSKSTVATKETIEFE-GETYPLLKIEISNTSHPFYTGKSTLVDTAGR
RL31_FUSNN      MKKGIHPEFDLVVFEDMA-GNQFLTRSTKIPKETTTFE-GKEYPVIKVAVSSKSHPFYTGEQRFVDTAGR
RL31B_CHLT3     MKEGIHPNYRPVVFQDLSNGDKFIVRSCIVTSETIKMEDGHEYPLSKVEITNASHPFFTGQQMLLDTAGR
RL31B_MYCPA     MKSGIHPDYHPVVFQDATTGATFLXXXXXXXXXXXEWETPHTYPLVVVEITSDSHPFWTGSRRIVDTAGQ
RL31B_RHOOB     MKPGIHPDYHPVVFQDAXXXXXXXXXXXXXXXXXAVWEDGNTYPLVVVDVTSESHPFWTGAQRVMDTAGR
RL31B_CHLPN     MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQSEKT-EVFEGKEYPVCYXXXXXXXHPFFTGSKKFVDAEGR
RL31B_PORGI     MKKGIHPEYRPVVFKDMSNEDIFITRSTMEAKETIEI-DGVTYPLIKVEISNTSHPFFTGKAKLVDTAGR
RL31B_PORG3     MKKGIHPEYRPVVFKDMSNEDIFITRSTMEAKETIEI-DGVTYPLIKVEISNTSHPFFTGKAKLVDTAGR
RL31B_PROMH     MKENIHPQYRTVIFHDTSVDAYFKVGSTIQTDKTIEYE-GQRYPYVTLDVSSQSHPFYTGKQKTHSQEGN
RL31B_PSEE4     MKAGIHPAYRPVLFHDTAADVYFLIGSTVDTDRTQVHSDGQTYPYVALDVSSASHPVYTGQQRKTTVEGR
RL31B_PSESM     MKPDIHPAYRTVLFHDTAADAYFLIGSTVDTDRTQQHTDGTTYPYVALDVSSASHPMYTGQQRKTTTEGR
RL31B_CHLTA     MKKNTHPEYRQVLFVDSSTGYKFICGSTYQTDKT-EVFEGQEYPVCYXXXXXXXHPFFTGSKKLVDAEGR
RL31B_CHLCV     MKKNTHPEYNKVLFVDSSTGYKFVCGSTYQSDKT-EVYEGQEYPVCYXXXXXXXHPFFTGSKRLVDAEGR
RL31B_YERE8     MKPGIHPNYRTVVFHDTSADTYFTVGSTIATARTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFSKEGS
RL31B_CHLTR     MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKT-EVFEGQEYPVCYXXXXXXXHPFFTGSKKLVDAEGR
RL31B_CHLMU     MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKT-EVFEGQEYPVCYXXXXXXXHPFFTGSKKLVDAEGR
RL31B_PECCP     MKAGIHPDYRTVVFHDTSADVYYRTGSTIKTDRTIELE-GTSYPYVTIDVSSASHPYYTGKQKEYSKEGS
RL31B_PSEU2     MKPDIHPQYRTVLFHDTAADAYFLIGSTVDTDRTQQHTDGTTYPYVALDVSSASHPMYTGQQRKATTEGR
RL31B_ERWCT     MKAGIHPDYRTVVFHDTSADVYYRTGSTIKTDRTIELE-GTHYPYVIIEVSSASHPYYTGKQKEYSKEGS
RL31B_PSYA2     MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYE-GSEYPYYPLDISSASHPFYTGEQRKTSTEGR
RL31B_PHOLL     MKPDIHPNYRVVVFHDTSANAYFTIGSTIRTERTITL-NGEEYPYVTVDVSSESHPFYTGKQKTLSQEGS
RL31B_PSYWF     MRKDIHPEYQEVLFHDTNADVFFLTRSTAKTKATREYE-GKEYPYYPLDISSASHPFYTGEQRKTSNEGR
RL31B_ACIAD     MRQGIHPEYQQVLFHDTNADAYFIIGSTIQTKQTREYE-GKVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_YERPY     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPS     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPP     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPN     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPE     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPB     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERPA     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_YERP3     MKPNIHPPYRTVVFHDTSADAYFTVGSTIATERTIE-RDGQTYPYVTLDISSASHPYYTGKQKEFAKEGS
RL31B_CHLFF     MKKNTHLDYKQVLFVDSSTGYKFVCGSTYQSDKT-EVFEGQEYPVCYXXXXXXXHPFFTGSKRLVDAEGR
RL31_BACP2      MKTGIHPNYKKAT-VKCACGNEFETGSVKEE--------------VRIEICSECHPFYTGRQKFASADGR
RL31B_CITK8     MKPNIHPAYRTVVFHDTSANEYFKVGSTIKTEREIELE-GVTYPYVTIEVSSKSHPYYTGKQKTFDNEGS
RL31_GEOKA      MKQGIHPEYKKVI-VRCACGNEFESGSVKDE--------------LRVEICSECHPFFTGKQKFVTAAGR
RL31_BACLD      MKAGIHPEFKKAT-VKCACGNEFETGSVKEE--------------VRVEICSECHPFYTGRQKFASADGR
RL31_BACSU      MKAGIHPNFKKAT-VKCACGNEFETGSVKEE--------------VRVEICSECHPFYTGRQKFASADGR
RL31_BACA2      MKAGIHPNFKKAT-VKCACGNEFETGSVKEE--------------VRVEICSECHPFYTGRQKFASADGR
RL31_GEOSW      MKPGIHPEYKKVI-VRCACGNEFESGSVKDE--------------LRVEICSECHPFFTGRQKFVSAAGR
RL31_BACME      MKTGIHPNY-KTVMVKCTCGNEFESGSVKEE--------------IRVETCSECHPFYTGRQKFAEAGGR
RL31B_SHIBS     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOUT     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOSM     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOSE     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOLU     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOLI     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECOL6     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECODH     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECO8A     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECO7I     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECO45     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECO27     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
R31B2_ECO57     MKPNIHPEYRTVVFHDTSIDEYFRIGSTIKTDRVIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
R31B1_ECO57     MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31_GEOTN      MKQGIHPAYKKVI-VRCACGNEFESGSVKDE--------------LRVEICSECHPFFTGKQKFVSAAGR
RL31_ANOFW      MKAGIHPNYKKVM-VKCACGNEFESGSVKDE--------------VRVEICSACHPFYTGRQKFASAAGR
RL31B_ECOHS     MKPNIHPEYRTVVFHDTSIDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31B_ECO55     MKPNIHPEYRTVVFHDTSIDEYFKIGSTIKTDREIEL-DGVTYPYVTIDVSSKSHPFYTGKLRTVASEGN
RL31_CLOCE      MKEGIHPDYSEAV-VKCACGETFTTGSTKKS--------------LHVEICSKCHPFYTGRQKLVDTGGR
RL31B_SALTY     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALTI     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALSV     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALPC     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALPB     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALNS     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALHS     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALG2     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALEP     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALDC     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALCH     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALA4     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-DGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_KLEP3     MKAHIHPPYRTVVFHDTSVNEYFKVGSTIRTDRVIEL-DGETFPYVTIDVSSKSHPYYTGKQKTFASEGS
RL31B_PSEA7     MKPGIHPDYRPVLFHDTSADVFFLIGSTAEXXXXXXXXXXXXYPYVTLDVSSASHPVYTGEQRKTKSEGR
RL31B_HAEPS     MKKGIHPEYREVLFYDGSVQQGWIIRSCAATNKTMVWEDGKEYPLYPLDTSSASHPVYTGKRREANTEGR
RL31B_ACIBY     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_ACIBT     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_ACIBS     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_ACIBC     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_ACIB5     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_ACIB3     MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQ-GQVYPYVTLDISSASHPFYTGEVRQASNEGR
RL31B_PSYCK     MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYE-GSEYPYYPLDISSASHPFYTGEQRKTSTEGR
RL31B_PSEAE     MKPGIHPEYRPVLFHDTSADVYFLIGSTAEXXXXXXXXXXXXYPYVTLDVSSASHPVYTGEQRKTKSEGR
RL31B_PSEAB     MKPGIHPEYRPVLFHDTSADVYFLIGSTAEXXXXXXXXXXXXYPYVTLDVSSASHPVYTGEQRKTKSEGR
RL31B_PSEA8     MKPGIHPEYRPVLFHDTSADVYFLIGSTAEXXXXXXXXXXXXYPYVTLDVSSASHPVYTGEQRKTKSEGR
RL31B_PASMU     MKKGIHPEYRTVLFYDSNAKQGFLIRSCARTTTTMKWEDGHEYPVFMCDTSSASHPYYTGKTRQIANEGR
RL31_EUBE2      MREGIHPDYYQAKVVCNC-GNEFVTGSTKEE--------------IHVEICSKCHPFYTGQQKASSTRGR
RL31B_SALPK     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-GGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALPA     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIEL-GGVTYPYVTIDVSSKSHPFYTGRQKTFDSESS
RL31B_SALAR     MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTKREIEL-DGVTYPYVTIDVSSKSHPFYTGKQKTFDSESS
RL31B_ACTPJ     MKKGIHPEYREVLFYDGSVQMGWIIRSCAATTKTMVWEDGKEYPFYPLDTSSASHPVYTGKRREVNTEGR
RL31B_ACTP7     MKKGIHPEYREVLFYDGSVQMGWIIRSCAATTKTMVWEDGKEYPFYPLDTSSASHPVYTGKRREVNTEGR
RL31B_ACTP2     MKKGIHPEYREVLFYDGSVQMGWIIRSCAATTKTMVWEDGKEYPFYPLDTSSASHPVYTGKRREVNTEGR
RL31_ANATD      MKEGIHPTYYHDAVVRCACGETFITGSTKKE--------------IHVEICSKCHPFFTGKQKFVDTTGR
RL31B_HAEDU     MKKGIHPEYREVLFYDASAQMGWVIRSCVATNKSMMWEDGKEYPFYPLDTSSASHPVYTGKRREANTEGR
RL31B_NEIG2     MKPNIHPDYRTVLFFDSSANEGWLIRSCAGTHKTMVWTDGKEYPLFSLDTSSSSHPVYTGKQRNVNTEGR
RL31_CLOPS      MRQGIHPEYHHDTVVKCACGNTFTTGSVK--------------PELKVEICSKCHPFFTGKQKIVDVGGR
RL31_CLOPE      MRQGIHPEYHHDTVVKCACGNTFTTGSVK--------------PELKVEICSKCHPFFTGKQKIVDVGGR
RL31_CLOP1      MRQGIHPEYHHDTVVKCACGNTFTTGSVK--------------PELKVEICSKCHPFFTGKQKIVDVGGR
RL31B_SERP5     MKAGIHPNYRTVVFHDLSADTYFKVGSTINTDRTIELE-GESWPYVTLDVSSASHPYYTGKQKEFSKEG-
RL31B_NEIMF     MKPNIHPDYRTVLFFDSSANEGWLIRSCAETHKTMVWTDGKEYPLFSLDTSSASHPVYTGKQRNVNTEGR
RL31B_NEIMB     MKPNIHPDYRTVLFFDSSANEGWLIRSCAETHKTMVWTDGKEYPLFSLDTSSASHPVYTGKQRNVNTEGR
RL31B_ERWT9     MKSDIHPAYRQVAFHDTTADAYFIVGSTIKTDRTVQYE-GKELPYVPLDVSSASHVYYTGKQKDFAKEGS
RL31_FINM2      MKKDLHPEYHEATVTCASCGNTFKVGSTKEN--------------INVEVCSQCHPFYTGRQRFVEHGGR
RL31_BREBN      MKQDIHPKYN-VVTVSCACGNEFESGSVKQA--------------LKVEICSNCHPFFTGKQKFVDAGGR
RL31B_NEIM0     MKPNIHPDYRTVLFFDSSANEGWMIRSCAETHKTMVWTDGKEYPLFSLDTSSASHPVYTGKQRNVNTEGR
RL31_CLOBM      MREGIHPEYNHDVLVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOBL      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOBK      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOBJ      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOBH      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOB6      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_CLOB1      MREGIHPEYNHDVVVKCACGNTFTTGSTNKE--------------LKVEICSKCHPFFTGKQKIVDAGGR
RL31_SYNFM      MKEGIHPVYHETVIR-CACGAEIPTGSTKKE--------------IRVEICSKCHPFYTGKQKLVDSAGR
RL31_CLOBB      MKQGIHPEYHTDAVVKCACGNSFTTGSVKEE--------------LKVEICSKCHPFFTGKQKIVDVGGR
RL31_CLOBA      MKQGIHPEYHTDAVVKCACGNSFTTGSVKEE--------------LKVEICSKCHPFFTGKQKIVDVGGR
RL31B_NEIMA     MKPNIHPDYRTVLFFDSSANEGWLIRSCAETHKTMVWTDGKEYPLFSLDTSSASHPVYTGKQRNVNTEGH
RL31_CLOK5      MKKGIHPEYYHDSVVKCACGNTFTTGSTQKE--------------LKVEICSKCHPFFTGKQKLVDAGGR
RL31_CLOK1      MKKGIHPEYYHDSVVKCACGNTFTTGSTQKE--------------LKVEICSKCHPFFTGKQKLVDAGGR
RL31_CALS8      MKEGIHLTYYHDAVVRCACGETFITGSTKKE--------------IHVEICSKCHPFFTGKQKFVDTTGR
RL31_CLOB8      MREGIHPEYHHNTVVKCACGNTFTTGSVKEE--------------LKVEICSKCHPFFTGKQKIVDVGGR
RL31B_NEIG1     MKPNIHPDYRTVLFFDSSANEGWLIRSCAGTHKTMVWTDGKEYLLFSLDTSSSSHPVYTGKQRNVNTEGR
RL31_CLONN      MKQGLHPEYHHDAVVKCACGNTFTTGST-NAE-------------LKVDVCSKCHPFYTGKQKILDTGGR
RL31_BIFAA      MKQGIHPDYHAVQVTCSC-GNTFVTRSTYNGDH------------MTVDVCSNCHPFYTGKQKILDTGGR
RL31_THETN      MKPGIHPTYYHDAVVKCACGNTFITGSTKKE--------------IRVEICSKCHPFFTGQQKIVDTGGR
RL31_NEIMB      MKQGIHPNYHEVNVTCSC-GNKFATKSAMEKEN------------FNIEVCSLCHPFYTGTQKIVDTTGR
RL31_NEIMA      MKQGIHPNYHEVNVTCSC-GNKFATKSAMEKEN------------FNIEVCSLCHPFYTGTQKIVDTTGR
RL31_MYCGI      MKSGIHPDYVETTVL-CGCGASFTTRSTKKS--------GN----ITVEVCSQCHPFYTGKQKILDSGGR
RL31_DESOH      MKQEIHPEYHQATAR-CACGNEFTVGSTKES--------------IKVEICSQCHPFFTGKQKLVDTAGR
RL31_MYCVP      MKSGIHPDYVETTVL-CGCGASFTTRSTKQSGQ------------ITVEVCSQCHPFYTGKQKILDSGGR
RL31_NITEU      MKEGIHPEYHEITVTCSC-GNEFKTRSVLSKP-------------LHIEVCSSCHPFYTGKQKIVDTAGR
RL31_CHLCH      MKQDIHPKYNEVTVVCANCGNSFVTRSTR--------------PSIKVDICNNCHPFYTGKQSIVDTAGR
RL31_PROVI      MKQDIHPKYTEVTVNCANCGNTFVTRSTRDS--------------IKVDICSNCHPFYTGKQTLVDTAGR
RL31_ALKMQ      MKKDIHPAYQQID-VHCVCGNKFKTGSTNKE--------------IRVEVCSDCHPFYTGKQKSVEKGGR
RL31B_PARUW     MKKNTHPQYQKVLFIDSASGHRFVCGSTLKPDATEKFE-GVEYPVXXXXXXXXXHPFFTGSKQLVDSEGR
RL31_TOLAT      MKEGIHPDYHEITAKCSC-GHVFVTRSTGKD--------------LNLDVCSECHPFYTGKQKVLDTGGR
RL31_THIDA      MKAGIHPDYNEVTVTCSC-GNTFVTRSTLGK------------PALHVEVCASCHPFYTGKQKIVDTAGR
RL31_THEYD      MKEKIHPEYKEAKVV-CACGETFVTRSTK--------------PVIKVDICSKCHPFYTGKQKIVDTEGR
RL31_THEPX      MKPNIHPTYYHDAVVRCACGNTFITGSTKKE--------------IRVEICSKCHPFFTGQQKIVDTGGR
RL31_THEP3      MKPNIHPTYYHDAVVRCACGNTFITGSTKKE--------------IRVEICSKCHPFFTGQQKIVDTGGR
RL31_NEIG1      MKQGIHPNYREVNVTCSC-GNKFVTKSAMEKEN------------FNIEVCSLCHPFYTGTQKIVDTTGR
RL31_MYCSS      MKTGIHPDYVETT-VQCGCGNTFTTRSTKKT--------GN----IVVEVCSQCHPFYTGKQKILDSGGR
RL31_MYCSK      MKTGIHPDYVETT-VQCGCGNTFTTRSTKKT--------GN----IVVEVCSQCHPFYTGKQKILDSGGR
RL31_MYCSJ      MKTGIHPDYVETT-VQCGCGNTFTTRSTKKT--------GN----IVVEVCSQCHPFYTGKQKILDSGGR
RL31_MYCS2      MKTGIHPEYVDTT-VQCGCGHSFTTRSTKQSGTIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_THEFY      MKPGIHPDYH-VTQVTCTCGNSFVTRSTAPNG------------VIRAEICSSCHPFYTGKQKILDTGGR
RL31_PELPB      MKQDIHPKYKEVTVNCANCGNSFVTRSTR--------------PTIKVDICNNCHPFYTGKQTLVDTAGR
RL31_GEOSL      MKEGIHPKYNDVM-VKCACGNSFQTRSTKTE--------------ISTEICSACHPFFTGKQKLIDTAGR
RL31_GEOMG      MKEGIHPKYNEVT-VKCACGNSFQTRSTRTE--------------ISTEICSACHPFFTGKQKLVDTAGR
RL31_CARHZ      MKPGIHPEYGKARVI-CACGETFETGSTKKE--------------IRVEICSKCHPFYTGSQRTVEARGR
RL31_GEOSF      MREGIHPKYNEVTV-------KCLCGNT--------FQTRSTKPEISTEICSACHPFFTGKQKLVDTAGR
RL31_GEOLS      MKEGIHPMYNEVT-VKCACGNSFLTRSTRKE--------------IFTEICSACHPFFTGKQKLVDTAGR
RL31_PROAC      MKQGIHPDYRETTVVCTC-GNTFTTRSTSQSGT------------LNADVCSKCHPFYTGKQKILDAGGR
RL31_PELLD      MKSDIHPKYTEVTVVCANCGNSFETRSTR--------------PSIKVDVCSNCHPFYTGKQTLVDTAGR
RL31_PSEHT      MKEGIHPKY-EVISATCSCGNEFETSSTKN---------------IHLDVCSACHPFYTGKQKILDTGGR
RL31_GEOUR      MKEGIHPNYTEVTV-------KCLCGNT--------FQTRSTKPEISTEICSACHPFFTGKQKLIDTAGR
RL31_DESRM      MKEKIHPNYQEVE-VKCVCGNTFKTGSTKKE--------------IKVEICSNCHPFYTGAQRQIEVGGR
RL31_CLOAB      MQKDIQPEYHQDAVVKCACGNTFTTGSTKKE--------------LKVDICSKCHPFFTGQQKIVDVGGR
RL31_THISH      MKPDIHPDYHEVAVTCSC-GNNFKTRSTYQGSE------------LNVEVCSACHPFFTGKQKIMDTAGQ
RL31_SOLUE      MKAGIHPAYNEISVI-CACGHSLKTRSTHKGD-------------MRVEICSSCHPFFTGKQKLMDTAGR
RL31_DESHY      MKEKTHPKYEQTT-ITCVCGEVIPTGSTKKD--------------IKVEICSKCHPFYTGVQRFVDAGGR
RL31_DESHD      MKEKTHPKYEQTT-ITCVCGEVIPTGSTKKD--------------IKVEICSKCHPFYTGVQRFVDAGGR
RL31_NATTJ      MKREIHPEYKKAKVV-CACGNSFETGSTKEE--------------LKVEICSSCHPFFTGKQKLVDSGGR
RL31_GEOSM      MKEGIHPKYNEII-VKCLCGNSFESRSTKAE--------------ISTEVCSQCHPFYTGKQKLMDTAGR
RL31_IDILO      MKQGIHPKY-ETLKVSCSCGHTFETRSTRSED-------------LHLDVCSECHPFYTGKQRVMDTGGR
RL31_DEHE1      MKEKIHPKYNTATNVSCACGNTFTVGSTKDS--------------IKVELCAQCHPFYTGEKRMVDTAGR
RL31_ALKOO      MKKDIHPVYQEVE-VHCACGNNFKTGSTNKE--------------IRVEICSQCHPFFTGKQKNVEKGGR
RL31_VIBVU      MKAGIHPEY-KAVNATCSCGNSFVFNSTLDKES------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_PHOPR      MKQGIHPDY-------SATNARCSCGNTFIFQSTMTKD-------VNLDVCDKCHPFYTGKQRQASSGGR
RL31_SYNAS      MKEGIHPEYKETT-ITCVCGNVITTRSTKQD--------------IKVEICSQCHPFITGKQKIIDTAGR
RL31_PELTS      MKKNIHPNYGKAR-VSCVCGETFETGSTKKE--------------LRVEICSKCHPFYTGSQRMIETGGR
RL31_HALOH      MKKGIHPEIKKTKIV-CACGAEYETNSTKED--------------IHVEVCSRCHPFYTGKQRKATKGGR
RL31_GEOBB      MKEGIHPKYNEIT-VKCLCGNSFESRSTKAE--------------ISTEVCSQCHPFYTGKQKLMDTAGR
RL31_PELCD      MKEGIHPKY-EAVEVKCHCGNVIQTRSTKCAD-------------MQVEVCSACHPFYTGKQKLLDTAGR
RL31_DESVM      MKENIHPTTFKAK-MTCACGYEAEALSTKGE-------------VVNVEICSQCHPFYTGKQRFVDTAGR
RL31_CHRVO      MKNDIHPNYKELSVTCSC-GQQFVTKSTMGKDA------------FSIEVCSSCHPFYTGKQKIVDTAGR
RL31_CHLL2      MKQDIHPKYTKVTVNCANCGNAFETRSTRNT--------------IKVDICNNCHPFYTGKQMLVDTAGR
RL31_BIFLO      MQQGIHPDYHPVEVTCSC-GNTFVTRTAGKEDHMF------------VDVCSQCHPFYTGKQKILDTGGR
RL31_BIFLI      MQQGIHPDYHPVEVTCSC-GNTFVTRTAGKEDHMF------------VDVCSQCHPFYTGKQKILDTGGR
RL31_BIFLD      MQQGIHPDYHPVEVTCSC-GNTFVTRTAGKEDHMF------------VDVCSQCHPFYTGKQKILDTGGR
RL31_VIBVY      MKAGIHPEY-KAVNATCSCGNSFVFNSTLDKDS------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_SALRD      MQHDLHPEYSEVTI-------QLADGSEITTRSTMETDSYET------EVDSTNHPFYTGRRQFVDTAGR
RL31_FRATT      MRQEIHPKYTEVTVTCSC-GNTFVTRSTAGKKE------------MNIDICSECHPFYTGKQRIVDTAGR
RL31_FRATM      MRQEIHPKYTEVTVTCSC-GNTFVTRSTAGKKE------------MNIDICSECHPFYTGKQRIVDTAGR
RL31_FRATH      MRQEIHPKYTEVTVTCSC-GNTFVTRSTAGKKE------------MNIDICSECHPFYTGKQRIVDTAGR
RL31_FRAT1      MRQEIHPKYTEVTVTCSC-GNTFVTRSTAGKKE------------MNIDICSECHPFYTGKQRIVDTAGR
RL31_CHRSD      MKQAIHPEYKKVTATCSC-GATFEFGSTARED-------------FYVDVCSQCHPFYTGKQKQATTGGR
RL31_SACEN      MKSGIHPEY-VTTQVNCGCGNSFTTRSTRTSGQ------------ITVEICSNCHPFYTGKQKILDTGGR
RL31_HELMI      MKEGIHPQVHRAK-VHCACGESFETTSTRKE--------------IKVDVCSKCHPFFTGKSRTVEVGGR
RL31_FRATN      MRQEIHPKYTEVTVTCSC-GNTFVTRSTVGKKE------------MNIDICSECHPFYTGKQRIVDTAGR
RL31_CHLTE      MKPEIHPKYTKVTVNCANCGTTFETRSTRNNN-------------IKVDICSKCHPFYTGKQVLVDTAGR
RL31_CAMFF      MKKDIHPEYVECT-VTCACGNTFTSKSNKSE--------------IRVDICSECHPFFTGSEKIVDSAGR
RL31_VIBPA      MKAGIHPEY-KAVNATCSCGNSFEFNSTLGKES------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_VIBHB      MKAGIHPEY-KAVSATCSCGNSFEFKSTLDKES------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_TREPS      MKKGLHPRYEETKVV-CACGNVIVTASTVKD--------------LRVEICSACHPFFTGKQKLVDSAGR
RL31_TREPA      MKKGLHPRYEETKVV-CACGNVIVTASTVKD--------------LRVEICSACHPFFTGKQKLVDSAGR
RL31_MYCA9      MKSGIHPNYVETNVV-CGCGNTFTTRSTKESGHIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_GLUDA      MKSGIHPDYHEIVIMTDGTEYKTRSCYA---------QPGAT---LRLDIDPKSHPAWTGVQRMLDTGGQ
RL31_DEHSC      MKEKIHPKYNTATNVICACGNTFTVGSTKDN--------------IKVELCAQCHPFYTGEKRMVDTAGR
RL31_CYAP8      ---------------------------------------GSTQPEIHVEVWSGNHPFYTGTQKMIDTEGR
RL31_CHLPD      MKQDLHPKYTKVTVNCANCGNSFETRSTR--------------PSIKVDICNNCHPFYTGKQMLVDTAGR
RL31_SYNY3      ---------------------------------------GSTKPEINVEIWSGNHPFYTGTQKIIDTEGR
RL31_SYNWW      MKAKIHPKYHQAKAR-CACGNEFEVGSTSEN--------------IRVEICSKCHPFYTGKGRLVDTTGR
RL31_SYNP2      ---------------------------------------GSTQPEINVEIWSGNHPFYTGTQKIIDTEGR
RL31_DESVV      MKDNIHPTVYKAT-MNCACGYQAEVLSTKGEN-------------VHVEICSNCHPFYTGKQRLIDTAGR
RL31_DESVH      MKDNIHPTVYKAT-MNCACGYQAEVLSTKGEN-------------VHVEICSNCHPFYTGKQRLIDTAGR
RL31_CAMHC      MKKDIHPNYVECT-VACACGNTFKTRSNK--------------PEIKVDVCSKCHPFFTGSEKIVDSAGR
RL31_VIBSL      MKVGIHPEYKAV-------------SATCSCGNTFEFNSTLAKESIHLDVCDKCHPFYTGKQRIVDTGGR
RL31_PROMA      ---------------------------------------GSTQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROA2      MKQDIHPKYTKVTVTCANCGKDFETRSTRSS--------------IKVDICSNCHPFYTGKQVLVDTAGR
RL31_METCA      MKPDIHPDYTTVTVSCSC-------GNTFETRSTIGKD-------FHVEVCSACHPFYTGKQKIVDTAGR
RL31_MAGSM      MKEGIHPKYEEATFTCASCSNEIKTRSTAGD--------------LTLGICSECHPFYTGKHKLVDTAGR
RL31_HAEDU      MKQGIHPEYKEITATCSC-------GNVIKTRSTVEKN-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_DECAR      MKADIHPNYKEIQ-VNCSCGNTFTTKSTMSKDA------------FHVEVCSACHPFYTGKQKIVDTAGR
RL31_CYAP7      ---------------------------------------GSTQPEIHVEVWSGNHPFYTGTQKMIDTEGR
RL31_NITMU      MKPDIHPDYQEITVTCSC-------GSTFQTRSTMGKP-------LHIEVCSVCHPFYTGKQKIVDTAGR
RL31_MYCPA      MKADIHPTYAETTVL-CGCGNTFQTRSTKDGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCA1      MKADIHPTYAETTVL-CGCGNTFQTRSTKDGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MARMS      MKKDIHPNY-------SAVTATCTCGNTLQLNSTLGSD-------LHVDVCSNCHPFYTGQQKMVDTGGR
RL31_CHLPB      MKKDIHPKYTTVTVTCANCGNSFETRSTKES--------------IKVDICSNCHPFYTGKQVLVDTAGR
RL31_AZOSB      MKADIHPKYAEVNVTCSC-GHVFTTRSTLGKPE------------LHVEVCAACHPFYTGKQKIVDTAGR
RL31_RHOBA      MQDGIHPNYQETS-VTCGCGNTFTTRSTR--------------PELKIDICSECHPFYTGKLKYVDTAGR
RL31_NAUPA      MKKGIHPEYVKCQ-VKCTCGHEFEILSTKES--------------LRVEVCDKCHPFYTGQERNIDRGGK
RL31_MARAV      MKEGIHPKYEDITATCSC-------GNVIKTRSTIGHD-------LQLDVCSQCHPFYTGKQKVMDTGGR
RL31_GLOVI      -KAGIHPRYEEARIV-CGCGAIYETRSTKPG-------------VTNVEICANCHPFFTGQQKIVDAEGR
RL31_DESDG      MKDNIHPTVYKAKLV-CACGNEIDTTSTKGE-------------VVNVEICSSCHPFYTGKQRFVDTAGR
RL31_CLOD6      MQKEIQPKYNPVE-VRCACGNTFVAGSTKDE--------------IKVEICSECHPFYTGKQKNIEKGGR
RL31_AZOSE      MKADIHPKYAEVQVTCSC-------GNTFETRSTLG------KPALHVEVCAACHPFYTGKQKIVDTAGR
RL31_ACIF5      MKSNIHPKYEEITVTCSC-GNVFKTRSTANRD-------------LHIDLCSECHPFYTGKQRAVSAAGQ
RL31_ACIF2      MKSNIHPKYEEITVTCSC-GNVFKTRSTANRD-------------LHIDLCSECHPFYTGKQRAVSAAGQ
RL31_ACIC1      MKPDIHPEYRETTVICSC-GNTFTTRSTAKSG------------VIHAEVCSNCHPFYTGKQKILDVGGR
RL31_TREDE      MKKDIHPKYEE-------TTVTCACGNVINTRSTVKD--------IKVEICSQCHPFFTGKQKLVDTAGR
RL31_SYNPX      ---------------------------------------GSTQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_ONYPE      MKANIHPQFETVEVSCATCGKQHPIGTTVTS--------------IKIETCSNCHPFYTGAQTFVVKAGP
RL31_NOCFA      MKAGIHPAYVDTTVV-CGCGNTFQTRSTKESGH------------ITVEVCSQCHPFYTGKQKILDTGGR
RL31_MYCTU      MKSDIHPAYEETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCTA      MKSDIHPAYEETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCBT      MKSDIHPAYEETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCBP      MKSDIHPAYEETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCBO      MKSDIHPAYEETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_LARHH      MKANIHPDYTDLKVTCSC-GNAFTTKSTMSKDA------------FHIEVCSECHPFYTGKQKVVDTAGR
RL31_HAES2      MKQGIHPEYKEITATCSC-------GNVIKTRSTVGKN-------LNLDVCSNCHPFYTGKQRVVDTGGR
RL31_BUCCC      MKKNIHPEYKKI-FATCSCGYTIPIFSTKSSDMSLD-------------VCSQCHPFYTGKQRTMNKKGR
RL31_ALISL      MKVGIHPEYKAVKATCSCGNFEFKSALGKDT--------------IHLDVCGECHPFYTGKQRIVDTGGR
RL31_SULNB      MRKGIHPEYMECK-VTCACGNKFEVRSNK--------------PEMSIDICNECHPFFTGSEKILDAAGR
RL31_MANSM      MKQGIHPEYKEITVTCSC-GNVIKTRSTAGHD-------------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_CAMLR      MKKEIHPEYVECK-VSCACGNSFTTKSNK--------------PEIKVDICSSCHPFFTGSEKIVDAAGR
RL31_ARCB4      MKKDIHPDY-KVCTVTCACGNSF---ETKSNVETL-----------KIDICSSCHPFFTGEQKLVDAAGR
RL31_ACTSZ      MKQGIHPEYKEITATCSC-------GNVIKTRSTLGKD-------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_VIBFM      MKVGIHPEYTAVKATCSCGNFEFNSALGKDS--------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_VIBF1      MKVGIHPEYTAVKATCSCGNFEFNSALGKDS--------------IHLDVCDKCHPFYTGKQRIVDTGGR
RL31_PROMS      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM9      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM4      ---------------------------------------GSTQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM2      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM0      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_MYCLE      MKANIHPAYAETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_MYCLB      MKANIHPAYAETTVV-CGCGNTFQTRSTKPGGRIV------------VEVCSQCHPFYTGKQKILDSGGR
RL31_ERWCT      MKKGIHPNYSEVTVTCSC-------GNVIKTHSTVGRD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_WOLSU      MKKGIHPNYVPCKVTCVTSGKEFEVLSTK--------------PELRIDISSFCHPFYTGSDKVVDTAGR
RL31_THET8      -------------------------------------ETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGR
RL31_THET2      -------------------------------------ETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGR
RL31_SYNS9      ---------------------------------------GATQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_SYNS3      ---------------------------------------GSTQPEINVDVWSGNHPFFTGTQKILDTEGR
RL31_SYNPW      ---------------------------------------GSTQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROMP      ---------------------------------------GSTKPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM5      ---------------------------------------GSTKPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PELPD      MKEGIHPMYSDATV-------KCLCGNT--------FQTRSTRKEINTEICSACHPFFTGKQKLIDTAGR
RL31_SERP5      MKQGIHPKYEEVTANCSC-------GNVIKIRSTVGHD-------LNLDVCGECHPFYTGKQRDVATGGR
RL31_RHILW      MKAGIHPDYHMIVVMTDGTEYE--TRSTWGSEGAV----------MNLEIDSKSHPAWTGNQQLMDRGGR
RL31_RHIEC      MKAGIHPDYHMIVVMTDGTEYE--TRSTWGSEGAV----------MNLEIDSKSHPAWTGNQQLMDRGGR
RL31_RHIE6      MKAGIHPDYHMIVVMTDGTEYE--TRSTWGSEGAV----------MNLEIDSKSHPAWTGNQQLMDRGGR
RL31_PASMU      MKQGIHPNYVEVTATCSC-------GNVIKTRSTVGKD-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_MYCUA      MKSDIHPTYEETTVV-CGCGNTFQTRSTKQGGRIV------------AEVCSQCHPFYTGKQKILDSGGR
RL31_MYCMM      MKSDIHPTYEETTVV-CGCGNTFQTRSTKQGGRIV------------AEVCSQCHPFYTGKQKILDSGGR
RL31_MICAN      ---------------------------------------GSTKPEIHVEVWSGNHPFYTGTQKMIDTEGR
RL31_METI4      MKKDIHPNYQETT-ISCACGAVYTTKSTK--------------PSIRIGICASCHPLFTGQQKFVDTAGR
RL31_DICTD      MKKGIHPELKKAKIV-CACGAVYETLSTKE--------------YMTVEICSKCHPFFTGQRKFVDTEGR
RL31_DESAP      MKEKLHPAYQKARIV-CVCGAQFEVGSTKKE--------------MRVDICSKCHPFYTGMQRTVETRGR
RL31_ACIBL      MKTATHPSYDEVR-VQCACGNSFATRSTHKGD-------------IHVEICSACHPFFTGKQKLMDTAGR
RL31_YERPY      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPS      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPP      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPN      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPG      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPE      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPB      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERPA      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_YERP3      MKQGIHPKYEQVTASCSC-------GNVIKINSTVGHD-------LNLDVCGECHPFYTGKQRDVASGGR
RL31_VESOH      MKTSIHPNYNDVQIICSC-------GNTFKTRSTIDKKE------LHLDVCSSCHPFYTGKQKIMDSAGR
RL31_STRCO      MKRDIHPEYVE-------TQVSCTCGASFTTRSTIE------SGTIRAEVCSECHPFYTGKQKILDTGGR
RL31_PSEPK      MKEGIHPNY-EVVAVTCSCGNKFETRSTLGN-------------VLSIDVCNLCHPFYTGKQKVLDTGGR
RL31_PSEPG      MKEGIHPNY-EVVAVTCSCGNKFETRSTLGN-------------VLSIDVCNLCHPFYTGKQKVLDTGGR
RL31_PROMT      ---------------------------------------GATQPEIQVDVWSGNHPFFTGTQKILDTEGR
RL31_PROMM      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_PROM3      ---------------------------------------GSTQPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_NOSP7      ---------------------------------------GSTKPELHVDVWSGNHPFYTGTQKIIDTEGR
RL31_HELHP      MKKGIHPEYIPCKVTCVTSGKQLEVLSTKSE--------------LRIDISSFCHPFYTGSDKITDITGR
RL31_HAEPS      MKQGIHPNYVEITATCSC-------GNVIKTHSTVGKD-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_HAEI8      MKQGIHPEYKEVTATCSC-------GNVIKTRSTLGKD-------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_GLUOX      MRSGIHPDYHEIVIMTDGTEYKTRS---------CYGEPGAT---LRLDVDPKSHPAWTGVQRMMDTGGQ
RL31_ERWT9      MKKGIHPNYAEVTAKCSC-------GNEIKTRSTVGHD-------LNLDVCGNCHPFYTGKQRDVASGGR
RL31_AYWBP      MKANIHPQFKTVEVSCATCGKQHPIGTTVNS--------------IKIETCSNCHTFYTGVQTFVVKAGP
RL31_ANAVT      ---------------------------------------GSTKPELHVDVWSGNHPFYTGTQKIIDTEGR
RL31_ANASP      ---------------------------------------GSTKPELHVDVWSGNHPFYTGTQKIIDTEGR
RL31_AERS4      MKAGIHPEYVAITAKCSC-------GNVINTFSTMGKD-------LNLDVCSACHPFYTGKQKEVSSGGR
RL31_ACTPJ      MKQGIHPEYTEITATCSC-------GNVIKTRSTVGKN-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_ACTP7      MKQGIHPEYTEITATCSC-------GNVIKTRSTVGKN-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_ACTP2      MKQGIHPEYTEITATCSC-------GNVIKTRSTVGKN-------LNLDVCGNCHPFYTGKQRVVDTGGR
RL31_VIBCM      MKAGIHPEY-KAVNATCSCGNSFVFNSTLGKDT------------MHLDVCDKCHPFYSGKQRIVDTGGR
RL31_VIBCH      MKAGIHPEY-KAVNATCSCGNSFVFNSTLGKDT------------MHLDVCDKCHPFYSGKQRIVDTGGR
RL31_VIBC3      MKAGIHPEY-KAVNATCSCGNSFVFNSTLGKDT------------MHLDVCDKCHPFYSGKQRIVDTGGR
RL31_THEEB      ---------------------------------------GSTKPELHVDIWSGNHPFFTGTQKIVDAEGR
RL31_SYNR3      ---------------------------------------GSTTPELHVDVWSGNHPFFTGTQKILDTEGR
RL31_SYNP6      ---------------------------------------GSTQPELHVDVWSGNHPFYTGTQKIIDTEGR
RL31_SYNJA      ---------------------------------------GSTKPELKVDVWSGNHPFFTGSQKIIDSEGR
RL31_SYNE7      ---------------------------------------GSTQPELHVDVWSGNHPFYTGTQKIIDTEGR
RL31_STRAW      MKRDIHPEYVETQ-VSCTCGASFTTRSTISSGT------------VRAEVCSECHPFYTGKQKILDTGGR
RL31_NITOC      MRQDIHPKYSEITVTCSC-GNSFSTRSTAGKD-------------FHIEVCSACHPFYTGKQKLLDTAGR
RL31_MOOTA      MKPNIHPDYGPARII-CACGNVIETRSTKKD--------------IRVEICSQCHPFYTGRQRVVERGGR
RL31_HAEIN      MKQGIHPEYKEITATCSC-------GNVIKTRSTLGKD-------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_HAEIG      MKQGIHPEYKEITATCSC-------GNVIKTRSTLGKD-------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_HAEIE      MKQGIHPEYKEITATCSC-------GNVIKTRSTLGKD-------INLDVCGNCHPFYTGKQRVVDTGGR
RL31_DESAA      MKKDIHPKYETTVI-------RCACGATV--------EAGSTVDDLTVEICSQCHPFFTGKQKLVDTAGR
RL31_CAMJR      MKKEIHPEYVECK-VSCACGNTFTTKSNKAE--------------LRVDICSNCHPFFTGSEKIVDAAGR
RL31_CAMJJ      MKKEIHPEYVECK-VSCACGNTFTTKSNKAE--------------LRVDICSNCHPFFTGSEKIVDAAGR
RL31_CAMJE      MKKEIHPEYVECK-VSCACGNTFTTKSNKAE--------------LRVDICSNCHPFFTGSEKIVDAAGR
RL31_CAMJD      MKKEIHPEYVECK-VSCACGNTFATKSNKAE--------------LRVDICSNCHPFFTGSEKIVDAAGR
RL31_CAMJ8      MKKEIHPEYVECK-VSCACGNTFTTKSNKAE--------------LRVDICSNCHPFFTGSEKIVDAAGR
RL31_ALTMD      MKQDIHPKYEEITATCSC-------GNVMKIRSTLGKD-------INLDVCSSCHPFYTGKQRNVDTGGR
RL31_ACICJ      MKADIHPDYHEIIIMTDGTEYKTRSCYGK---------PGDT---LRLDIDPKSHPAWTGQQRVLDTGGQ
RK31_CYAME      MKKNIHPKWHSIVY---GNGQQILTV-------------GSTKPELHVEVWSSIHPFYTGSQKQLDTEGR
RL31_DICT6      MKKGIHPELKKARIV-CACGAVYETLSTKE--------------YMTVEICSKCHPFFTGQRKFVDTEGR
RL31_DESMR      MKKDIHPKTFKATIRCHC-GFEAQALSTKGE-------------LVQVEVCSNCHPFFTGKQRFLDTAGR
RL31_DESAD      MKKDIHPKLHKAT-VRCHCGYESELYSTIGEE-------------VSTEICSNCHPFYTGKQRFVDTAGR
RL31_COXBU      MKENIHPPYKQIKVTCSC-GNTFMTGSTLDRE-------------LHLEICSACHPFYTGQQKMVDTAGR
RL31_COXBR      MKENIHPPYKQIKVTCSC-GNTFMTGSTLDRE-------------LHLEICSACHPFYTGQQKMVDTAGR
RL31_COXBN      MKENIHPPYKQIKVTCSC-GNTFMTGSTLDRE-------------LHLEICSACHPFYTGQQKMVDTAGR
RL31_COXB2      MKENIHPPYKQIKVTCSC-GNTFMTGSTLDRE-------------LHLEICSACHPFYTGQQKMVDTAGR
RL31_STRGG      MKRDIHPEYVE-------TQVSCTCGASFTTRSTI---DNGT---IRADVCSECHPFYTGKQKILDTGGR
RL31_SHEPA      MKAGIHPDYAEIT-ATCTCGNVIKINSTVGKD-------------LHLDVCGACHPFYTGTQKVMDTGGR
RL31_SHEHH      MKAGIHPDYAEIT-ATCTCGNVIKINSTVGKD-------------LHLDVCGACHPFYTGTQKVMDTGGR
RL31_RHIL3      MKAGIHPEYHMIVVMTDGTEYE--TRSTWGSEGAV----------MNLEIDSKSHPAWTGNQQLMDRGGR
RL31_DEIGD      ----------------------------------------STRPEIHVDVWSGAHPFWTGEERFVDTEGR
RL31_YERE8      MKQGIHPKY-DLVTASCSCGNVIKINSTVGHD-------------LNLDVCGECHPFYTGKQRDVATGGR
RL31_SYNJB      ---------------------------------------GSTKPELKVDVWSGNHPFFTGSQKIIDSEGR
RL31_SHEON      MKPGIHPEYAEIT-ANCTCGNVIKVNSTVGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHESR      MKPGIHPEY-AVITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHESM      MKPGIHPEY-AVITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHESA      MKPGIHPEY-AVITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SACD2      ---------------------------------------------IHIDVCSECHPFYTGKQKTADTGGR
RL31_SHEWM      MKPGIHPEYAEITATCTCGNVIKVNSTAGKS--------------LHLDVCGACHPFYTGTQKIVDTGGR
RL31_PSEA6      MKTGIHPDYQDMKATCSCGNVIVVRSTLKKD--------------LNLDVCSACHPFYTGKQRNVDTGGR
RL31_PROM1      ---------------------------------------GATQPEIQVDVWSGNHPFFTGTQKILDTEGR
RL31_HELPY      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELPS      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELPJ      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELPH      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELPG      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELP2      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_HELAH      MKKGIHPEYIPCKVTCVTSGKEIEVLSTK--------------PEMRIDISSFCHPFYTGSDKIADTAGR
RL31_DEIRA      -------------------------------------ETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGR
RL31_DEIDV      ----------------------------------------STRPEIHVDVWSGVHPFWTGEERFVDTEGR
RK31_EMIHU      -KSAIHPDWYPKVYCDGQLVMKV----------------GATKPTLNVDIWSGNHPFYTGSQTIIDTEGR
RL31_TERTT      MKEDIQPKYGDMTATCSC-------GNVIKTRSTLAKD-------IHVDVCSECHPFYTGKQKVVDSGGR
RL31_SORC5      MKPGIHPEY-KASTITCACGAVVETRSTRGSFTT--------------DVCSACHPFYTGKHKIMDVAGR
RL31_SHELP      MKPGIHPEYAEIT-------------ATCTCGNVIKVNSTAGKPL-HLDVCGACHPFYTGTQKVMDTGGR
RL31_SHEFN      MKTGIHPNYAEITATCTCGNIKVNSTAGKN---------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_PSEE4      MKADIHPNY-EVVAVTCSCGNKFETRSTLGS-------------VLAIDVCNLCHPFYTGKQKVLDTGGR
RL31_NITSB      MRKDIHPEYVECE-VTCACGNHFVVMSNK--------------PQLKIDICNKCHPFFTGSEKIVDTTGR
RL31_KLEP7      MKKGIHPNYDEITATCSC-------GNVMKIRSTVGHD-------LNLDVCGKCHPFFTGKQRDVATGGR
RL31_AGRRK      MKANIHPDYHTIVVMTDGTEYE--TRSTWGSE-------GAT---MNLEIDSKSHPAWTGNQQLMDRGGR
RL31_RHORT      MKKDIHPDYHDITVV-MTDGSEFVTRSTYKGES------------LRLDIDPKSHPAWTGVHRLIDSGGQ
RL31_PHYMT      ---------------------------------------------IHIEICANCHPFYVGKQNFTTVAGR
RL31_MYCMO      MKPNIHPEYKNITLTCSTCEKKHIFGSTAKKSS--------------VDVCSNCHPFFTGDRSIQRTTGR
RL31_KLEP3      MKKGIHPKYEEITATCSC-------GNVMKIRSTVGHD-------LNLDVCGKCHPFFTGKQRDVATGGR
RL31_COLP3      MKKDIHPNYVEFNATCSC-------GNVVTTRSTIGKD-------IHLDVCSACHPFYTGKQKAAETGGR
RL31_CAMC1      MKKDIHPEYVDCT-VTCACGNTFKTKSNKSE--------------IRIDICDKCHPFFTGSEKIVDSAGR
RK31_THAPS      ---------------------------------------GSTKPQLQVDVWLGNHPFYTNSQTLVDSEGR
RK31_GUITH      ---------------------------------------GSTKSELNVDIWSGNHPFYTGSQKMLDTEGR
RL31_SHEAM      MKPGIHPEYAQIT-ATCTCGNVIKINSTVGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SALTY      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALTI      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALSV      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALPK      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALPC      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALPB      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALPA      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALNS      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALHS      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALG2      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALEP      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALDC      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALCH      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_SALA4      MKKGIHPNYVEITATCSC-------GNVIKTHSTVGHD-------LNLDVCGKCHPFFTGKQRVVDTGGR
RL31_BUCBP      MKKKIHPDYFKIVTCSCGNNINIFSTLSKN---------------INVDVCSKCHPFYTGQQRTSDTGGR
RL31_AZOVD      MKADIHPNYVEIEATCSC-------GNVIKTRSTLGKN-------ISIDVCSECHPFYTGKQKVLDTGGR
RL31_SODGM      MQKDIHPNYQEITATCSC-------GNVIKTRSTVGHD-------LNLDVCGACHPFYTGKQRVVDTGGR
RL31_SHEDO      MKPGIHPTYAEITATCTCGNIIKVNSTAGKS--------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_PSEPW      MKADIHPNY-EAVAVTCSCGNKFETRSTLGST-------------LAIDVCNLCHPFYTGKQKVLDTGGR
RL31_PSEMY      MKADIHPNYVEIDATCSC-------GNVIKTRSTIGKN-------ISLDVCSECHPFYTGKQKVLDTGGR
RL31_FRASN      MKADIHPQYHEXXXXXXXXXXXXXXXXKENGA-------------ISAEVCSQCHPFYTGKQKILDVGGR
RL31_DESPS      MRKDIHPEYHKINAV-CACGNEVELGSVETE--------------MKVEICSACHPFFTGKQKLIDTAGR
RL31_DESDA      MKKDIHPKVFNAT-ITCACGNEEKVLSTKGEQ-------------VNVEVCSACHPFFTGKQRFLDTAGR
RL31_DESAH      MKKDLHPEYKRTM-ASCACGNTLEVGSTRDE--------------IKVEICSKCHPFFTGKQKLVDTAGR
RL31_TRIEI      ---------------------------------------GSTQPEIHVDVWSGNHPYFTGTQKIIDTEGR
RL31_SHISS      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_SHIDS      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_SHIBS      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_SHIB3      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_RHOSR      MKSGIHPNYVATTVV-CGCGNTFETHSTKETGR------------INVEVCSQCHPFYTGKQKILDTGGR
RL31_NOVAD      MKTGIHPDYH-MIKVQMTDGTVFETRSTWGKE-------GETLAL---EIDPTSHPAWTGGTRQLDQGGR
RL31_ESCF3      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOUT      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOSM      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOSE      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOLU      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOLI      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOLC      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOL6      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOL5      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOHS      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECODH      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECOBW      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO8A      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO81      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO7I      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO5E      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO57      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO55      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO45      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO27      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ECO24      MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_ACAM1      ---------------------------------------GSTQEELHVDVWSGNHPFFTGTQKIIDTEGR
RL31_RHOCS      MKPEIHPEYHEIVVMTDGSSFK---------TRTTWGKPGDT---MRLDIDPKSHPAWTGVQKLVDTGGQ
RL31_MYXXD      -------------------------------------ETKSTRGSFSVEICSNCHPFFTGKYKLVDTAGR
RL31_MESFL      -KKDIQPKYEEAKFICTTCANEFICGTTKREE-------------MRIDVCSNCHPFFSGAQNFANTTGR
RL31_CAMC5      MKKEIHPEYIDCT-VTCACGNTFKTKSNKSE--------------IKIDICDKCHPFFTGSEKIVDSAGR
RL31_ANADE      MKEGIHPDYKATKVL-CACGNVIETRSVRGD--------------FHIEICSNCHPFFTGKQKIMDTAGR
RL31_SYMTH      MKAGIHP---------------------KTQKTTITCGCGATYEVIRVEICANCHPFYTGSRGATEAGSR
RL31_SHIFL      MKKDIHPKYEEITASCSC-------GNVIKIRSTVGHD-------LNLDVCSKCHPFFTGKQRDVATGGR
RL31_PSEPF      MKADIHPNYPEVAVTCSC-GNKFETRSTFGKA-------------LAIDVCNECHPFYTGKQKTLDTGGR
RL31_NITWN      MKAEIHPDYHKVVMTD---GTEYLTRST--------WKDGDT---MNLDIDSKSHPAWTGSQQILDRGGR
RL31_LEGPL      MKASVHPDY-QTVKVTCSCGEVFETRSTLCKD-------------LNIEVCSMCHPFYTGKQKLVDTGGR
RL31_LEGPH      MKASVHPDY-QTVKVTCSCGEVFETRSTLCKD-------------LNIEVCSMCHPFYTGKQKLVDTGGR
RL31_LEGPC      MKASVHPDY-QTVKVTCSCGEVFETRSTLCKD-------------LNIEVCSMCHPFYTGKQKLVDTGGR
RL31_LEGPA      MKASVHPDY-QTVKVTCSCGEVFETRSTLCKD-------------LNIEVCSMCHPFYTGKQKLVDTGGR
RL31_ALCBS      MKAEIHPDYQTATYTCSC-GNVIETRSTKGGD-------------MALDVCSACHPFYTGKQKQADSGGQ
RL31_AGRVS      MKANIHPEYHKIVVMTDGTEYETFS----------TW--GTEGQVMNLDIDSKSHPAWTGNQQLMDRGGR
RK31_PORYE      ---------------------------------------GSTKPELHVDIWSGNHPFFTGSQRIIDTEGR
RK31_PORPU      ---------------------------------------GSTKPELHVDIWSGNHPFFTGSQRIIDTEGR
RK31_PALPL      ---------------------------------------GSTKPELHVDIWSGNHPFFTGSQRIIDTEGR
RL31_PHOLL      MKKGIHPKYEEITATCSC-------GSVIQVRSTA----GHA---LNLDVCGQCHPFYTGKQRDVATGGR
RL31_NITHX      MKAEIHPDYHKVVMTD---GTEYMTRST--------WKDGDT---LNLDIDSKSHPAWTGSQQLLDRGGR
RL31_LEPBP      MKTDIHPKY-------VAAKIKCACGTVIETRST----SGD----ISVEICSNCHPFFTGKSKLVDTTGR
RL31_LEPBA      MKTDIHPKY-------VAAKIKCACGTVIETRST----SGD----ISVEICSNCHPFFTGKSKLVDTTGR
RL31_SHEB9      MKPGIHPKY-AIITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHEB8      MKPGIHPKY-AIITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHEB5      MKPGIHPKY-AIITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_SHEB2      MKPGIHPKY-AIITANCTCGNVIKVNSTAGKD-------------LHLDVCGACHPFYTGTQKVVDTGGR
RL31_MYCA5      MKKEIHPNFKEVKATCTSCGKEHIFGSTVEK--------------ISLDVCSNCHAFYTGDRSTVKARGR
RL31_MAGSA      MKDNIHPDYHEIVVMTDGTEYKTRSTMGKAGDT------------LRLDIDPKSHPAWTGVHRMVDTAGQ
RL31_RHISN      MKAGIHPEYHTIVVMTDGTEYE--TRSTWGSE-------GAT---MHLEIDSKSHPAWTGNQQLVDRGGR
RL31_PSYIN      MKNAIHPEYKEITATCSC-GNIVTVGSTAGKNLTLD-------------ICGECHPFYTGTQRVVDTGGR
RL31_PSEAE      MKADIHPTYEAIEATCSC-------GNVIKTRSTL-------CKPIHLDVCSECHPFYTGKQKVLDTGGR
RL31_PSEAB      MKADIHPTYEAIEATCSC-------GNVIKTRSTL-------CKPIHLDVCSECHPFYTGKQKVLDTGGR
RL31_PSEA8      MKADIHPTYEAIEATCSC-------GNVIKTRSTL-------CKPIHLDVCSECHPFYTGKQKVLDTGGR
RL31_LEPIN      MKTEIHPNYKAAKISCASCGTVY--------------ETRTSIGDINIEICSACHPFFTGKSKLVDTTGR
RL31_LEPIC      MKTEIHPNYKAAKISCASCGTVY--------------ETRTSIGDINIEICSACHPFFTGKSKLVDTTGR
RL31_LEPBL      MKTEIHPNYKAAKISCASCGTVY--------------ETRTSIGDINIEICSACHPFFTGKSKLVDTTGR
RL31_LEPBJ      MKTEIHPNYKAAKISCASCGTVY--------------ETRTSIGDINIEICSACHPFFTGKSKLVDTTGR
RL31_HAHCH      MKQGIHPEYKEITATCSC-------GNIIKTKSTL-------CENIHIDVCSSCHPFYTGKQKVLDTGGR
RL31_ENTS8      MKKDIHPKYVEITATCSC-------GNVIKTRSTVGHD-------LNLDVCGNCHPFFTGKQRVVDTGGR
RL31_ZYMMO      MKQNIHPDYH-FIKVQLTDGTVFETRSTWGKE-------GDT---MKLDIDPRVHPAWTGRSQLVDAGGQ
RL31_RHOPB      MKAEIHPNYHSITVV-MTDGTEYVTRST--------W--GNEGDKLNLDIDSKSHPAWTGQQQMLDRGGR
RL31_PSEA7      ---------------------------------------------IHLDVCSECHPFYTGKQKVLDTGGR
RL31_PELUB      MKKDIHPDYHTIK-VEMTDGTQFETRSTWGKEGEV----------LKLEIDPKSHAAWTGGKQKLMDKGR
RL31_PARL1      MKKDTHPDYHFIVQMNDGSTYK--TRSTYGSE-------GDTLVL---DIDPTTHPAWTGGQQILDRGGR
RL31_OLICO      MKPEIHPDYHKVVMTD---GTEYFTRSTYGAE-------GDT---LNLDIDSKSHPAWTGTQQILDRGGR
RL31_SPHWW      MKKDIHPDYHSIT-------VQLVDGTTYQTRSTY----GSAGDTLQLDIDPSVHPAWTGKSHMLDAGGQ
RL31_SHESH      MKADIHPAYAEIT-ATCTCGNVIKVNSTAGKA-------------LHLDVCGACHPFYTGTQKIVDTGGR
RL31_BUCAT      MKKKIHPRYSKITATCSC-------GNIIEIFSTINHN-------INLDICAKCHPFYTGKQRVIDTGGR
RL31_AGRT5      MKADIHPAYHTIVVMTDGTEYE--TRSTWGSEGAV----------MNLEIDPKSHPAWTGNQQLMDRGGR
RL31_SYNSC      ---------------------------------------GATQPEIHVDVWSGNHPFFTGTQKILDTEGR
RL31_SPHAL      MKKDIHPDYH-MITVKMTDGTEYQTRSTWGSEGDV----------MTLEIDPTAHPAWTGGQRMLDSGGQ
RL31_CHLP8      MKPEIHPKYTKVTVNCANCGTSFETRSTRNN--------------IKVDICSSCHPFYTGKQVLVDTAGR
RL31_BAUCH      MQKNIHPKYFEIRAICSC-------GNIIPTYSTLDQH-------LNLDVCSACHPFYTGKQRRVNTRGR
RL31_PSEF5      MKADIHPVYEAIT-------------ATCSCGNVIETRSTLAKPL-SLDVCNECHPFYTGKQKTLDVGGR
RL31_PROMH      MKKDIHPKYEEITATCSCGNVMKINSTAGHN--------------LNLDVCDKCHPFYTGKQRDVATGGR
RL31_ENT38      MKKDIHPKY-DFITANCSCGNAIKIRSTVGHD-------------LNLDVCGQCHPFYTGKQRDVATGGR
RL31_BUCAI      MKKKIHPRYSKITATCSC-------GNIIEIFSTINHN-------LNLDICAKCHPFYTGKQRVIDTGGR
RL31_BUCA5      MKKKIHPRYSKITATCSC-------GNIIEIFSTINHN-------LNLDICAKCHPFYTGKQRVIDTGGR
RL31_SULDN      MKKDIHPKLVECTVTCSC------GNSFKNESQKSE---------MRIDICNECHPFFTGSERMVDTAGR
RL31_PSEFS      MKADIHPAY-ETIEVTCSCGNKFETRS-------------NLCKPLGTDVCNECHPFYTGKQKTLDTGGR
RL31_PHEZH      MKQDTHPDYHFIVVMTDGTTYKTRSTLGK---------EGDT---LNLDIDPKTHPAWTGGHQLLDRGGR
RK31_CYACA      -KKNIHPQYEEAKFYCNGEIVKII---------------GSTRMEINADIWSGNHPFYIGTQKIVDTEGR
RL31_PSESM      MKADIHPVYEAI-------------DATCSCGNVIKTRSTLTGPL-SLDVCNECHPFYTGKQKTLDIGGR
RL31_HAMD5      MKKNIHPDY-KLVIASCSCGNVIEVNSTLGCN-------------INLDVCSNCHPAYTNKKREAATGGR
RL31_BLOPB      MKKNVHPKYNEISAYCSC-------GNIINTKSTLNRN-------LNIDVCHLCHPFYTGTQRILDTRGR
RL31_ACIBY      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RL31_ACIBT      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RL31_ACIBS      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RL31_ACIBC      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RL31_ACIB5      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RL31_ACIB3      MRADIHPKYEKLV-------------ATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGR
RK31_ODOSI      ---------------------------------------GSTKSELQVDIWLANHPFYTDSQTIIDSEGR
RL31_SALAI      MKPNIHPEY-VTTEVTCSCGNTFTTRSTAKGGS------------IHVETCSACHPFYTGKQRVLDTAGR
RL31_PSEU2      MKADIHPVYEAI-------------DATCSCGNVIKTRSTLAAPL-SLDVCNECHPFYTGKQKMLDVGGR
RK31_GRATL      ---------------------------------------GSTQAELHVDIWSGNHPFFTGSQRIIDTEGR
RL31_XANP2      MKSDIHPDYHKVVMTD---GSEYTTRSTYGKE-------GDT---LQLDIDPRTHPAWTGTQQLMDRGGR
RL31_SILPO      MKKDIHPDYHMI-------DVKLTDGTVIQMKST--WKEGDT---LSLEIDPSSHPAWTGSSRLMDTGGR
RL31_RHOPT      MKTEIHPDYHTIVVMTDGTEYQTRSTWGKEGDK------------LNLDIDPKSHPAWTGTQQVLDRGGR
RL31_RHOPA      MKTEIHPDYHTIVVMTDGTEYQTRSTWGKEGDK------------LNLDIDPKSHPAWTGTQQVLDRGGR
RL31_RHOP2      MKTEIHPDYHNIVVMTDGTEYQTRSTWGKEGDK------------LNLDIDPRSHPAWTGTQQVLDRGGR
RL31_FRAAA      MKADIHPTYHETT-VNCTCGSTFTTRSTK--------ENG----VVNAEVCSQCHPFYTGKQK-------
RL31_CAUCR      MKQDIHPDYHFIT-------VTLTDGSSYKTRSTYGKEGAN----LALDIDPRTHPAWTGNAQLMDRGGR
RL31_CAUCN      MKQDIHPDYHFIT-------VTLTDGSSYKTRSTYGKEGAN----LALDIDPRTHPAWTGNAQLMDRGGR
RL31_BUCAP      MKKKIHPAYSQII----------ATCSCGNIIEIFSTVNVN----LNLDICAKCHPFYTGKQRIIDTGGR
RL31_SILST      MKKDIHPDYH---FID----VKMTDGTVVKMRST--W--GNEGDQLALDIDPSAHPAWTGSSRLMDTGGR
RL31_RHOSK      MKKGIHPDYHMIVKMTDGTVFQIRSTWGKEGEQ------------MALEIDPLAHPAWTGTAKLMDTGGR
RL31_RHOS4      MKKGIHPDYHMIVKMTDGTVFQIRSTWGKEGEQ------------MALEIDPLAHPAWTGTAKLMDTGGR
RL31_RHOS1      MKKGIHPDYHMIVKMTDGTVFQIRSTWGKEGEQ------------MALEIDPLAHPAWTGTAKLMDTGGR
RL31_PSE14      MKADIHPVYEAI-------------DATCSCGNVIKTRSTLAAPL-SLDVCNECHPFYTGKQKTLDVGGR
RL31_MESSB      MKADIHPDYHMIVVMTDGTEY----------ETRSTWKEGDT---LNLDIDPNSHPAWTGQQTLVDRGGR
RL31_BRAJA      MKAEIHPDYHKVVMTD---GTEYLTRSTWGKE-------GDT---LNLDIDPKSHPAWTGNAQIMDRGGR
RL31_THEP1      MKKGIHPEM-KLVTVKCACGAEHTFYTTVDN--------------IRIDVCSNCHPFYTSGGKIVDTEGR
RL31_THEMA      MKKGIHPEM-KLVTVKCACGAEHTFYTTVDN--------------IRIDVCSNCHPFYTSGGKIVDTEGR
RL31_SINMW      MKADIHPDYHTIVVMTDGTEY----------ETRSTW--GTEGATMNLEIDPKSHPAWTGNQQLVDRGGR
RL31_RHOS5      MKKGIHPDYHMIVKMTDGTVFQVRSTWGKEGEQ------------MALEIDPLAHPAWTGTAKLMDTGGR
RL31_RHOP5      MKAEIHPDYHNITVV-MTDGTEYVTRST--------W--GKEGDKMNLDIDPKSHPAWTGTQQMLDRGGR
RL31_RHIME      MKADIHPDYHTIVVMTDGTEY----------ETRSTW--GTEGATMNLEIDPKSHPAWTGNQQLVDRGGR
RL31_BEUC1      ---------------------------------------------IHADVCSACHPFYTGKQKILDTGGR
RL31_BARBK      MKPNIHPDYHQI--------YVVMTDGTKYTTRSTWGKEGDT---LNLDIDPTTHPAWIGSQTLVDRGGR
RL31_ACIAD      MRADIHPKYQTLV-------------ATCSCGNVIETRSALGKETLYLDVCSACHPFYTGKQKNVDTGGR
RL31_MARMM      MKKDLHPDYH-VINVVMTNGTTFQTKSTWGKE-------GDT---INLDIDPTSHPAWTGNQHLLDRGGR
RL31_BRASB      MKADIHPNYHTIVVMTDGTEYQTRSTWGKEGDK------------LNLDIDPKSHPAWTGTQQIMDRGGR
RL31_AZOC5      MKSDIHPDYHKVVMTD---GTEYTTRSTFGKE-------GDT---LALDIDPRTHPAWTGTQQLLDRGGR
RL31_THESQ      MKKGIHPEM-KLVTVKCACGAEHTFYTTVDN--------------IRIDVCSKCHPFYTSGGKIVDTEGR
RL31_RHOPS      MKTEIHPNYHSIVVMTDGTEYQTRSTWGKEGDK------------LNLDIDPRSHPAWTGTQQVLDRGGR
RL31_PARDP      MKADIHPDYHLIVKMTDGTTYQVRS----------TWKEGDTMSL---DIDPNSHPAWTGSAKLMDTGGR
RL31_SALTO      MKPNSHPEYVTTEVACSC-GNTFTTRSTAKGGS------------IHVETCSACHPFYTGKQRVLDTAGR
RL31_NOCSJ      ---------------------------------------------IHADVCSQCHPFYTGKQKILDTGGR
RL31_BEII9      MKADIHPQYHKVVMTD---GTEFQTRSTYG-------EEGAT---LNLDIDPKTHPAWTGTQQLLDRGGR
RL31_MYCS5      MKKDLHPQYYSVAVKCETCKNEFTLKSTKKE--------------FKIDVCSKCHPVYTGNRSQAKSTGM
RL31_OCHA4      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUSU      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUSI      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUO2      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUME      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUMB      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUC2      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUAB      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUA2      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BRUA1      MKANIHPDYHKVVMTD---GTEYMTRSTWGKE-------GDT---MNLDIDPTTHPAWTGSQTLLDRGGR
RL31_BARHE      MKANIHPDYHKITVV-----------MTDGSQYTTRSTWGKEGDVLNLDIDPRTHPAWTGSQTLVDHGGR
RL31_PETMO      MKQGIHPEM-KLITVKCACGAEHTMYSTVDN--------------FRLDVCSECHPFYRGESQILDTEGR
RL31_THEAB      MKKGIHPEM-KLITVKCACGAEHKFYSAKEN--------------VRIDVCSSCHPFYKGAGMIVDTEGR
RL31_RHILO      MKSAIHPDYHTIVVMTDGTEY-----TTRST-----WKEGDT---MNLDIDPTTHPAWTGQQTLLDRGGR
RL31_METSB      MKADIHPQYHKVVMTD---GTEFLTRSTYGSE-------GAT---LNLDIDPKTHPAWTGSAQLLDRGGR
RL31_THEM4      MKKGIHPEM-KLVTVKCACGAEHKFYTVKEN--------------VRIDVCSSCHPFYKGAGMIVDTEGR
RK31_PHATR      ---------------------------------------GSTKSELQIDMWLANHPFYTNSQVLIDSEGR
RL31_MYCPU      ---------------------------------------------IAIDICSKCHPFYTGDRTLAKATGQ
RL31_BART1      MKANIHPNYHKITVV--------MTDGTQYTTRSTWGKEGDT---LNLDIDPRTHPAWTGSQTLVDRGGR
RL31_BARQU      MKANIHPNYHRITVV-MTDGSQYTTRSTWGKE-------GDT---LNLDIDPRTHPAWTGTQTLVDHGGR
RL31_WIGBR      MKKKIHPMSLDILATCSC-------GNSLKIKSTIKKD-------ILLDVCNKCHPFYTGTQKKLNIGGR
RL31_KOSOT      MKKGIHPEL-KLITVKCTCGAEHKFWTMKED--------------IKIDLCSNCHPFYKGGSLIVDTEGR
RL31_DINSH      MKKDIHPEYHII-------DVKMTDGTVIQMRST--W--GAEGDQLSLDIDPSVHPAWTGTSRLLDTGGR
RL31_ROSDO      MKADTHPDYHII-------DVKMTDGTVVQMKST--W--GKEGDQLSLDIDPSAHPAWTGSSRLLDTGGR
RL31_JANSC      MKKDLHPEYHVI-------NVKMTNGDVVEM-RSIWGAEGDT---LALDIDPTVHPAWTGGARLLDTGGR
RL31_FRASC      MKPDVHPTYHEXXXXXXXXXXXXXXXXKENG-------------VVNAEVCSQCHPFYTGKQK-------
ENO_THEM4       -------------FYNGETGKYFIDGTEKTSDELIEYYESNKYPIISIEDPFDQEDWDSYR-KFNEKVGK


                         .         .         *         .         .         .         .:140
query           VDRFNKKYGFTN
RL31B_LACS1     VDRFNKKYGFTN
RL31B_LACSS     VDRFNKKYGFAD
RL31B_LACCB     VDRFNKKYG---
RL31B_LACC3     VDRFNKKYG---
RL31B_LACBA     VDRFNKKYGLSN
RL31B_LACF3     VDKFNKKYGF--
RL31B_ENTFA     VDRFNKKYG---
RL31B_LACRJ     VDKFNKKYG---
RL31B_LACRD     VDKFNKKYG---
RL31B_BACHK     VDRFNKKYG---
RL31B_BACCZ     VDRFNKKYG---
RL31B_BACCR     VDRFNKKYG---
RL31B_BACC4     VDRFNKKYG---
RL31B_BACC3     VDRFNKKYG---
RL31B_BACC2     VDRFNKKYG---
RL31B_BACC0     VDRFNKKYG---
RL31B_BACAN     VDRFNKKYG---
RL31B_BACAC     VDRFNKKYG---
RL31B_BACAA     VDRFNKKYG---
RL31B_BACC7     VDRFNKKYG---
RL31B_BACC1     VDRFNKKYG---
RL31B_LACPL     VDRFNKKYG---
RL31B_EXIS2     VDRFNKKYG---
RL31B_MACCJ     VERFNKKFGF--
RL31B_LACLS     IARFEKKYG---
RL31B_LACLM     IARFEKKYG---
RL31B_PEDPA     VAKFNKKYG---
RL31B_STAHJ     VERFNKKFG---
RL31B_LACLA     IARFEKKYG---
RL31B_STAES     VERFNKKFG---
RL31B_STAEQ     VERFNKKFG---
RL31B_STACT     VERFNKKFG---
RL31B_STRU0     VDRFNKKYG---
RL31B_STRTD     VDRFNKKYG---
RL31B_STRT2     VDRFNKKYG---
RL31B_STRT1     VDRFNKKYG---
RL31B_BACHD     VDRFKKKY----
RL31B_STRA5     VDRFNKKYG---
RL31B_STRA3     VDRFNKKYG---
RL31B_STRA1     VDRFNKKYG---
RL31B_STAS1     VERFNKKFGF--
RL31B_STREM     VDRFNKKYG---
RL31B_STRE4     VDRFNKKYG---
RL31B_STRMU     VDRFNKKYG---
RL31B_STRS7     VDRFNKKYG---
RL31B_LISW6     VDRFNKKYG---
RL31B_STRZT     VDRFNKKYG---
RL31B_STRZP     VDRFNKKYG---
RL31B_STRZJ     VDRFNKKYG---
RL31B_STRR6     VDRFNKKYG---
RL31B_STRPN     VDRFNKKYG---
RL31B_STRPJ     VDRFNKKYG---
RL31B_STRPI     VDRFNKKYG---
RL31B_STRP7     VDRFNKKYG---
RL31B_STRP4     VDRFNKKYG---
RL31B_STRP2     VDRFNKKYG---
RL31B_STRSV     VDRFNKKYG---
RL31B_STAAW     VERFNKKFG---
RL31B_STAAT     VERFNKKFG---
RL31B_STAAS     VERFNKKFG---
RL31B_STAAR     VERFNKKFG---
RL31B_STAAN     VERFNKKFG---
RL31B_STAAM     VERFNKKFG---
RL31B_STAAE     VERFNKKFG---
RL31B_STAAC     VERFNKKFG---
RL31B_STAAB     VERFNKKFG---
RL31B_STAA9     VERFNKKFG---
RL31B_STAA8     VERFNKKFG---
RL31B_STAA3     VERFNKKFG---
RL31B_STAA2     VERFNKKFG---
RL31B_STAA1     VERFNKKFG---
RL31B_LISMO     VDRFNKKYG---
RL31B_LISMH     VDRFNKKYG---
RL31B_LISMF     VDRFNKKYG---
RL31B_LISMC     VDRFNKKYG---
RL31B_LISIN     VDRFNKKYG---
RL31B_STRPZ     VDRFNKKYG---
RL31B_STRPM     VDRFNKKYG---
RL31B_STRPG     VDRFNKKYG---
RL31B_STRPF     VDRFNKKYG---
RL31B_STRPD     VDRFNKKYG---
RL31B_STRPC     VDRFNKKYG---
RL31B_STRPB     VDRFNKKYG---
RL31B_STRP8     VDRFNKKYG---
RL31B_STRP6     VDRFNKKYG---
RL31B_STRP3     VDRFNKKYG---
RL31B_STRP1     VDRFNKKYG---
RL31B_LACDB     IERFNKKYGF--
RL31B_LACDA     IERFNKKYGF--
RL31B_LACJO     IEKFNKKYGMSS
RL31B_LACGA     IEKFNKKYGISS
RL31B_LACAC     IEKFNKKYG---
RL31B_LACH4     IEKFNKKYG---
RL31B_BACSK     VDRFKKKY----
RL31B_EXISA     IERFNKKY----
RL31B_OCEIH     VDRFKKKY----
RL31B_BACA2     VEQFNKKY----
RL31B_BACSU     VEQFKKRY----
RL31B_OENOB     VDKFNKKYG---
RL31B_NOCFA     VEKFNRKYG---
RL31B_BACLD     VEQFKKRF----
RL31B_AMOA5     VEKFQQKY----
RL31B_CORU7     VEKFQRRYG---
RL31B_CORK4     VEKFQRRYG---
RL31B_LEIXX     VEKFNTRY----
RL31B_CORDI     VEKFNQRYG---
RL31B_CORJK     VEKFQRRYG---
RL31B_HALHL     VDRFRKRFGMT-
RL31B_RHOE4     VEKFERRYG---
RL31B_CORA7     VEKFNQRFG---
RL31B_ALHEH     VDQFQKKFGIS-
RL31B_DICNV     VDRFRRKYGKKN
RL31B_ARTS2     VERFNARF----
RL31B_ARTCA     VERFNARF----
RL31B_CORGL     VEKFERRFG---
RL31B_CORGB     VEKFERRFG---
RL31B_RENSM     VERFNARF----
RL31B_COREF     VEKFERRFG---
RL31B_PROAC     VEKFNRRYG---
RL31B_MICLC     VERFNARF----
RL31B_METFK     VEKFRQKYG---
RL31B_SALAI     VEKFRAKY----
RL31B_POLSQ     VEKFRQKFG---
RL31B_STRM5     IDKFQKRY----
R31B1_STRCO     VARFERRYG---
RL31B_POLNS     VEKFRQKFG---
RL31B_VIBVY     VANFNRRF----
RL31B_VIBVU     VANFNRRF----
RL31B_STRMK     IDKFQKRY----
RL31B_XANOR     IDKFQKRY----
RL31B_XANOM     IDKFQKRY----
RL31B_XANCP     IDKFQKRY----
RL31B_XANC8     IDKFQKRY----
RL31B_XANC5     IDKFQKRY----
RL31B_XANAC     IDKFQKRY----
RL31B_CLAM3     VEKFNSRY----
RL31B_BURPS     VEKFKNKFG---
RL31B_BURP6     VEKFKNKFG---
RL31B_BURP1     VEKFKNKFG---
RL31B_BURP0     VEKFKNKFG---
RL31B_BURMS     VEKFKNKFG---
RL31B_BURMA     VEKFKNKFG---
RL31B_BURM9     VEKFKNKFG---
RL31B_BURM7     VEKFKNKFG---
RL31B_BDEBA     IDRFKKRYG---
R31B2_STRCO     VERFERRYG---
R31B1_STRAW     IAQFERRY----
RL31B_RHOSR     VEKFERRYG---
RL31B_JANMA     VDKFRKKFG---
RL31B_BORGA     IDKFNKRY----
RL31B_VIBPA     IANFNRRFG---
RL31B_STRGG     VERFERRYG---
RL31B_BURTA     VEKFKNKFG---
RL31B_BORAP     IDKFNKRY----
RL31B_BURP8     VEKFNKKFG---
RL31B_VIBHB     IANFNRRFG---
RL31B_XYLFM     IDKFKKRY----
RL31B_XYLFA     IDKFKKRY----
RL31B_SALTO     VEKFRQKY----
RL31B_SACEN     VEKFRRRYG---
RL31B_KOCRD     VERFNQRF----
RL31B_VIBSL     VANFTRRFG---
RL31B_BORBZ     IDKFNKRY----
RL31B_XYLFT     IDKFKKRY----
RL31B_XYLF2     IDKFKKRY----
RL31B_BURM1     VEKFKNKFG---
RL31B_BURCH     VEKFKNKFG---
RL31B_BURCC     VEKFKNKFG---
RL31B_BURCA     VEKFKNKFG---
RL31B_BORBU     IDKFNKRY----
RL31B_VIBCM     VANFTRRFG---
RL31B_VIBCH     VANFTRRFG---
RL31B_VIBC3     VANFTRRFG---
RL31B_LEUMM     VD----------
R31B2_STRAW     VERFERRYG---
RL31B_HERAR     VDKFRKKFG---
RL31B_BURXL     VEKFRNKFG---
RL31B_BURPP     VEKFRNKFG---
RL31B_BURVG     VEKFKNKFG---
RL31B_LEUCK     VD----------
RL31B_CLAMS     VEKFNSRY----
RL31B_BURCJ     VEKFKNKFG---
RL31B_MYCA9     VEKFRRRYG---
RL31B_BURS3     VEKFKNKFG---
RL31B_BURCM     VEKFKNKFG---
RL31B_BURA4     VEKFKNKFG---
RL31B_RALSO     VEKFRQKFG---
RL31B_MYCVP     VEKFRRRYG---
RL31B_ALISL     VANFNRRFG---
RL31B_RALME     VEKFRQKFG---
RL31B_THICR     VEKFRQKYG---
RL31B_RALPJ     VEKFRNKFG---
RL31B_CUPTR     VEKFRQKFG---
RL31B_RUBXD     ------------
RL31B_TROWT     VEKFYARY----
RL31B_TROW8     VEKFYARY----
RL31B_RALEJ     VEKFRQKFG---
RL31B_PSEFS     IAGFNKRF----
RL31B_BORPA     VEKFRARFART-
RL31B_BORBR     VEKFRARFART-
RL31B_BACV8     VDKFMSRYG---
RL31B_CHLTB     VDKFLKRY----
RL31B_CHLT2     VDKFLKRY----
RL31B_BIFLI     VQKFNARYG---
RL31B_BORPE     VEKFRARFART-
RL31B_AERS4     VARFGQRFG---
RL31B_RALEH     VEKFRQKFG---
RL31B_CHLAB     VDKFLKRY----
RL31B_AERHH     VARFGQRFG---
RL31B_PSEU5     IAGFNKRF----
RL31B_PSEF5     IAGFNKRF----
RL31B_PARD8     VDKFMSRYGNRN
RL31B_BACTN     VDKFMSRYG---
RL31B_BACFR     VDKFMSRYG---
RL31B_BACFN     VDKFMSRYG---
RL31_FUSNN      VDKFNKKF----
RL31B_CHLT3     VERFNKRFG---
RL31B_MYCPA     VEKFHRRYG---
RL31B_RHOOB     VEKFERRYG---
RL31B_CHLPN     VDKFLKRY----
RL31B_PORGI     VDKFMSRYGDRN
RL31B_PORG3     VDKFMSRYGDRN
RL31B_PROMH     VARFNKRFG---
RL31B_PSEE4     VAGFNKRF----
RL31B_PSESM     IAGFNKRF----
RL31B_CHLTA     VDKFLKRY----
RL31B_CHLCV     VDKFLKRY----
RL31B_YERE8     AARFHQRYG---
RL31B_CHLTR     VDKFLKRY----
RL31B_CHLMU     VDKFLKRY----
RL31B_PECCP     TARFQQRFG---
RL31B_PSEU2     IAGFNKRF----
RL31B_ERWCT     TARFHQRFG---
RL31B_PSYA2     VASFNKRFG---
RL31B_PHOLL     TARFQKKFG---
RL31B_PSYWF     VASFNKRFG---
RL31B_ACIAD     VATFNKRF----
RL31B_YERPY     TARFHQRFG---
RL31B_YERPS     TARFHQRFG---
RL31B_YERPP     TARFHQRFG---
RL31B_YERPN     TARFHQRFG---
RL31B_YERPE     TARFHQRFG---
RL31B_YERPB     TARFHQRFG---
RL31B_YERPA     TARFHQRFG---
RL31B_YERP3     TARFHQRFG---
RL31B_CHLFF     VDKFLKRY----
RL31_BACP2      VDRFNKKYG---
RL31B_CITK8     AARFQKRFG---
RL31_GEOKA      VDKFNKKYG---
RL31_BACLD      VDRFNKKYG---
RL31_BACSU      VDRFNKKYG---
RL31_BACA2      VDRFNKKYG---
RL31_GEOSW      VDKFNKKYG---
RL31_BACME      VDRFNKKYG---
RL31B_SHIBS     VARFTQRFG---
RL31B_ECOUT     VARFTQRFG---
RL31B_ECOSM     VARFTQRFG---
RL31B_ECOSE     VARFTQRFG---
RL31B_ECOLU     VARFTQRFG---
RL31B_ECOLI     VARFTQRFG---
RL31B_ECOL6     VARFTQRFG---
RL31B_ECODH     VARFTQRFG---
RL31B_ECO8A     VARFTQRFG---
RL31B_ECO7I     VARFTQRFG---
RL31B_ECO45     VARFTQRFG---
RL31B_ECO27     VARFTQRFG---
R31B2_ECO57     VARFTQRFG---
R31B1_ECO57     VARFTQRFG---
RL31_GEOTN      VDKFNKKYG---
RL31_ANOFW      VDKFNKKYG---
RL31B_ECOHS     VARFTQRFG---
RL31B_ECO55     VARFTQRFG---
RL31_CLOCE      VDKFKKKYGIVD
RL31B_SALTY     AARFQKRFG---
RL31B_SALTI     AARFQKRFG---
RL31B_SALSV     AARFQKRFG---
RL31B_SALPC     AARFQKRFG---
RL31B_SALPB     AARFQKRFG---
RL31B_SALNS     AARFQKRFG---
RL31B_SALHS     AARFQKRFG---
RL31B_SALG2     AARFQKRFG---
RL31B_SALEP     AARFQKRFG---
RL31B_SALDC     AARFQKRFG---
RL31B_SALCH     AARFQKRFG---
RL31B_SALA4     AARFQKRFG---
RL31B_KLEP3     AARFRQRFG---
RL31B_PSEA7     VAGFNKRF----
RL31B_HAEPS     ASKFNERF----
RL31B_ACIBY     VASFNKRFARFN
RL31B_ACIBT     VASFNKRFARFN
RL31B_ACIBS     VASFNKRFARFN
RL31B_ACIBC     VASFNKRFARFN
RL31B_ACIB5     VASFNKRFARFN
RL31B_ACIB3     VASFNKRFARFN
RL31B_PSYCK     VASFN-------
RL31B_PSEAE     VAGFNKRF----
RL31B_PSEAB     VAGFNKRF----
RL31B_PSEA8     VAGFNKRF----
RL31B_PASMU     ASDFVNRYG---
RL31_EUBE2      IDKFNKKYGVSN
RL31B_SALPK     AARFQKRFG---
RL31B_SALPA     AARFQKRFG---
RL31B_SALAR     AARFQKRFG---
RL31B_ACTPJ     ASKFNERF----
RL31B_ACTP7     ASKFNERF----
RL31B_ACTP2     ASKFNERF----
RL31_ANATD      VERFMKKYG---
RL31B_HAEDU     ASKFNERF----
RL31B_NEIG2     ASKFNQRF----
RL31_CLOPS      VDKFNKRF----
RL31_CLOPE      VDKFNKRF----
RL31_CLOP1      VDKFNKRF----
RL31B_SERP5     ------------
RL31B_NEIMF     ASKFNQRF----
RL31B_NEIMB     ASKFNQRF----
RL31B_ERWT9     AARFNQRFG---
RL31_FINM2      VEKFKKKY----
RL31_BREBN      VDRFKRKY----
RL31B_NEIM0     ASKFNQRF----
RL31_CLOBM      VDKFMKKFNLSN
RL31_CLOBL      VDKFMKKFNLSN
RL31_CLOBK      VDKFMKKFNLSN
RL31_CLOBJ      VDKFMKKFNLSN
RL31_CLOBH      VDKFMKKFNLSN
RL31_CLOB6      VDKFMKKFNLSN
RL31_CLOB1      VDKFMKKFNLSN
RL31_SYNFM      IERFRRKY----
RL31_CLOBB      VEKFNKRF----
RL31_CLOBA      VEKFNKRF----
RL31B_NEIMA     ASKFNQRF----
RL31_CLOK5      VDRFLKKFNLKN
RL31_CLOK1      VDRFLKKFNLKN
RL31_CALS8      VERFMKKYG---
RL31_CLOB8      VDKFNKRF----
RL31B_NEIG1     ASKFNQRF----
RL31_CLONN      IEKFMKKY----
RL31_BIFAA      VARFEKRYG---
RL31_THETN      VERFRKRF----
RL31_NEIMB      VDKFNNKFG---
RL31_NEIMA      VDKFNNKFG---
RL31_MYCGI      VARFEKRYG---
RL31_DESOH      IERFRRKY----
RL31_MYCVP      VARFEKRYG---
RL31_NITEU      VEKFNQKYG---
RL31_CHLCH      VERFNKRF----
RL31_PROVI      VDRFNKRF----
RL31_ALKMQ      VEKFKKKFG---
RL31B_PARUW     V-----------
RL31_TOLAT      IDRFKKRF----
RL31_THIDA      VEKFRQRYG---
RL31_THEYD      VEKFMKKY----
RL31_THEPX      VERFRKRF----
RL31_THEP3      VERFRKRF----
RL31_NEIG1      VDKFNNKFG---
RL31_MYCSS      VARFEKRYG---
RL31_MYCSK      VARFEKRYG---
RL31_MYCSJ      VARFEKRYG---
RL31_MYCS2      VARFEKRYGKRN
RL31_THEFY      VARFEKRFG---
RL31_PELPB      VERFNKRF----
RL31_GEOSL      VERFRKKYG---
RL31_GEOMG      VERFRKKYG---
RL31_CARHZ      AEQFKKKYG---
RL31_GEOSF      VERFKKRYG---
RL31_GEOLS      VERFKKRYG---
RL31_PROAC      VARFERRYGKKN
RL31_PELLD      VDRFNKRF----
RL31_PSEHT      VDRFNKRFG---
RL31_GEOUR      VERFKRRYG---
RL31_DESRM      AEKFRKKYG---
RL31_CLOAB      VEKFRKKYNLS-
RL31_THISH      VDKFRRRYG---
RL31_SOLUE      IDRFEKKY----
RL31_DESHY      VDRFKKKYG---
RL31_DESHD      VDRFKKKYG---
RL31_NATTJ      VEKFKRKYG---
RL31_GEOSM      VERFRKRY----
RL31_IDILO      VDKFKKRFG---
RL31_DEHE1      VEKFRQRYG---
RL31_ALKOO      VEKFKKRFG---
RL31_VIBVU      VDRFNKRFG---
RL31_PHOPR      VDKFNKRFG---
RL31_SYNAS      VERFNQKYAGVN
RL31_PELTS      AERFRKKYG---
RL31_HALOH      IERFNKKYGLS-
RL31_GEOBB      VERFRKRY----
RL31_PELCD      IDRFRKKYAKNN
RL31_DESVM      IDRFRKKY----
RL31_CHRVO      VDKFNQKFG---
RL31_CHLL2      VERFNKRF----
RL31_BIFLO      VARFEKRYG---
RL31_BIFLI      VARFEKRYG---
RL31_BIFLD      VARFEKRYG---
RL31_VIBVY      VDRFNKRFG---
RL31_SALRD      VEKFNRRYG---
RL31_FRATT      VDKFKKRFG---
RL31_FRATM      VDKFKKRFG---
RL31_FRATH      VDKFKKRFG---
RL31_FRAT1      VDKFKKRFG---
RL31_CHRSD      VERFNKRFG---
RL31_SACEN      VARFEARYG---
RL31_HELMI      VDRFKKKYG---
RL31_FRATN      VDKFKKRFG---
RL31_CHLTE      VDRFNKRF----
RL31_CAMFF      VDKFKKKY----
RL31_VIBPA      VDRFNKRFG---
RL31_VIBHB      VDRFNKRFG---
RL31_TREPS      IDRFNRRY----
RL31_TREPA      IDRFNRRY----
RL31_MYCA9      VARFEARYG---
RL31_GLUDA      VAKFNKKFG---
RL31_DEHSC      VEKFRQRYG---
RL31_CYAP8      IDRFQKRYG---
RL31_CHLPD      VERFNKRF----
RL31_SYNY3      VDRFMRKYG---
RL31_SYNWW      VDRFKKKYGLS-
RL31_SYNP2      VDRFLRKYG---
RL31_DESVV      IDRFRKKY----
RL31_DESVH      IDRFRKKY----
RL31_CAMHC      VEKFNKKYG---
RL31_VIBSL      VDRFNKRFG---
RL31_PROMA      VDRFMRKYGMAN
RL31_PROA2      VERFKKRF----
RL31_METCA      VDKFRRKYG---
RL31_MAGSM      VERFRRKYG---
RL31_HAEDU      VERFNKRF----
RL31_DECAR      VEKFNQKFG---
RL31_CYAP7      VDRFLRKYG---
RL31_NITMU      VEKFRQKYG---
RL31_MYCPA      VARFEKRYG---
RL31_MYCA1      VARFEKRYG---
RL31_MARMS      VDRFNKRFG---
RL31_CHLPB      VERFKKRFAKKN
RL31_AZOSB      VERFRQKYG---
RL31_RHOBA      IDKFQKKF----
RL31_NAUPA      VDKFKKKYG---
RL31_MARAV      IDRFQKRFG---
RL31_GLOVI      VDRFLKKYG---
RL31_DESDG      IDRFRKKY----
RL31_CLOD6      IDKFKKRF----
RL31_AZOSE      VERFRQKYG---
RL31_ACIF5      VEKFRKRYG---
RL31_ACIF2      VEKFRKRYG---
RL31_ACIC1      VQKFEKRFG---
RL31_TREDE      IDRFKKRY----
RL31_SYNPX      VDRFMKKYG---
RL31_ONYPE      VDKFNKRYGIT-
RL31_NOCFA      VARFEARYG---
RL31_MYCTU      VARFEKRYG---
RL31_MYCTA      VARFEKRYG---
RL31_MYCBT      VARFEKRYG---
RL31_MYCBP      VARFEKRYG---
RL31_MYCBO      VARFEKRYG---
RL31_LARHH      IDKFKQKFG---
RL31_HAES2      VERFNKRF----
RL31_BUCCC      IQRFKKRFNFS-
RL31_ALISL      VDRFNKRFG---
RL31_SULNB      VDKFKKKY----
RL31_MANSM      VERFNKRF----
RL31_CAMLR      VEKFKKKY----
RL31_ARCB4      VEKFKAKY----
RL31_ACTSZ      VERFNKRF----
RL31_VIBFM      VDRFNKRFG---
RL31_VIBF1      VDRFNKRFG---
RL31_PROMS      VDRFMKKYG---
RL31_PROM9      VDRFMKKYG---
RL31_PROM4      VDRFMRKYGMAD
RL31_PROM2      VDRFMKKYG---
RL31_PROM0      VDRFMKKYG---
RL31_MYCLE      VARFEKRYG---
RL31_MYCLB      VARFEKRYG---
RL31_ERWCT      VDRFNKRF----
RL31_WOLSU      VEKFKQKY----
RL31_THET8      VERFQRRYG---
RL31_THET2      VERFQRRYG---
RL31_SYNS9      VDRFMKKYG---
RL31_SYNS3      VDRFMRKYG---
RL31_SYNPW      VDRFMRKYG---
RL31_PROMP      VD