[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99183.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
    1::181     e-110 100%  181 aa  Y370_LACS1 RecName: Full=UPF0374 protein LSL_0370;
    7::182     3e-93  85%  182 aa  Y1241_LACPL RecName: Full=UPF0374 protein lp_1241;
    1::178     1e-91  81%  178 aa  Y1475_LACSS RecName: Full=UPF0374 protein LSA1475;
    4::177     3e-85  79%  177 aa  Y1781_STRMU RecName: Full=UPF0374 protein SMU_1781;
    4::174     6e-85  80%  177 aa  Y421_STRTD RecName: Full=UPF0374 protein STER_0421;
    4::174     6e-85  80%  177 aa  Y374_STRT2 RecName: Full=UPF0374 protein stu0374;
    4::174     6e-85  80%  177 aa  Y374_STRT1 RecName: Full=UPF0374 protein str0374;
    4::177     2e-84  79%  177 aa  Y469_STRPG RecName: Full=UPF0374 protein SpyM50469;
    4::177     2e-84  79%  177 aa  Y1617_STRP8 RecName: Full=UPF0374 protein spyM18_1617;
    4::177     2e-84  79%  177 aa  Y1608_STRP1 RecName: Full=UPF0374 protein SPy_1608/M5005_Spy1321;
    4::177     2e-84  79%  177 aa  Y1437_STRPD RecName: Full=UPF0374 protein MGAS10270_Spy1437;
    4::177     2e-84  79%  177 aa  Y1430_STRPF RecName: Full=UPF0374 protein MGAS10750_Spy1430;
    4::177     2e-84  79%  177 aa  Y1367_STRP6 RecName: Full=UPF0374 protein M6_Spy1367;
    4::177     2e-84  79%  177 aa  Y1362_STRPM RecName: Full=UPF0374 protein M28_Spy1362;
    4::177     2e-84  79%  177 aa  Y1342_STRPB RecName: Full=UPF0374 protein MGAS2096_Spy1342;
    4::177     2e-84  79%  177 aa  Y1315_STRPC RecName: Full=UPF0374 protein MGAS9429_Spy1315;
    4::177     2e-84  79%  177 aa  Y1243_STRPZ RecName: Full=UPF0374 protein Spy49_1243;
    4::176     7e-84  79%  176 aa  YJJG_LACLA RecName: Full=UPF0374 protein yjjG;
    4::176     7e-84  79%  176 aa  Y1055_LACLS RecName: Full=UPF0374 protein LACR_1055;
    4::177     9e-84  78%  177 aa  Y1832_STRSV RecName: Full=UPF0374 protein SSA_1832;
    4::177     1e-83  79%  177 aa  Y422_STRS7 RecName: Full=UPF0374 protein SZO_04220;
    4::177     1e-83  79%  177 aa  Y1718_STRE4 RecName: Full=UPF0374 protein SEQ_1718;
    4::177     1e-83  79%  177 aa  Y1542_STREM RecName: Full=UPF0374 protein Sez_1542;
    4::177     1e-83  79%  177 aa  Y1356_STRP3 RecName: Full=UPF0374 protein SpyM3_1356/SPs0505;
    4::177     2e-83  78%  177 aa  Y492_STRA1 RecName: Full=UPF0374 protein SAK_0492;
    4::177     2e-83  78%  177 aa  Y446_STRA3 RecName: Full=UPF0374 protein gbs0446;
    4::177     2e-83  78%  177 aa  Y411_STRA5 RecName: Full=UPF0374 protein SAG0411;
    4::177     2e-83  76%  177 aa  Y2045_STRPI RecName: Full=UPF0374 protein SPH_2045;
    4::177     2e-83  76%  177 aa  Y1984_STRP7 RecName: Full=UPF0374 protein SP70585_1984;
    4::177     2e-83  76%  177 aa  Y1932_STRZP RecName: Full=UPF0374 protein SPP_1932;
    4::177     2e-83  76%  177 aa  Y1903_STRPN RecName: Full=UPF0374 protein SP_1903;
    4::177     2e-83  76%  177 aa  Y1878_STRPS RecName: Full=UPF0374 protein SPCG_1878;
    4::177     2e-83  76%  177 aa  Y1848_STRZT RecName: Full=UPF0374 protein SPT_1848;
    4::177     2e-83  76%  177 aa  Y1836_STRZJ RecName: Full=UPF0374 protein SPJ_1836;
    4::177     2e-83  76%  177 aa  Y1719_STRR6 RecName: Full=UPF0374 protein spr1719;
    4::177     2e-83  76%  177 aa  Y1706_STRP2 RecName: Full=UPF0374 protein SPD_1706;
    4::176     2e-83  78%  176 aa  Y1550_LACLM RecName: Full=UPF0374 protein llmg_1550;
    4::177     3e-83  76%  177 aa  Y1925_STRPJ RecName: Full=UPF0374 protein SPN23F19250;
    4::177     4e-83  79%  177 aa  Y1373_STRU0 RecName: Full=UPF0374 protein SUB1373;
    4::177     1e-82  78%  177 aa  Y697_ENTFA RecName: Full=UPF0374 protein EF_0697;
    4::177     1e-82  77%  177 aa  Y625_STRGC RecName: Full=UPF0374 protein SGO_0625;
    4::174     1e-82  80%  177 aa  Y445_STRSY RecName: Full=UPF0374 protein SSU05_0445;
    4::174     1e-82  80%  177 aa  Y432_STRS2 RecName: Full=UPF0374 protein SSU98_0432;
    4::177     1e-80  74%  177 aa  Y1812_STRP4 RecName: Full=UPF0374 protein SPG_1812;
    4::174     2e-70  64%  196 aa  Y1604_LACJO RecName: Full=UPF0374 protein LJ_1604;
    1::177     1e-65  59%  180 aa  Y1957_STAAR RecName: Full=UPF0374 protein SAR1957;
    1::177     1e-65  59%  180 aa  Y1551_STAES RecName: Full=UPF0374 protein SE_1551;
    1::177     1e-65  59%  180 aa  Y1405_STAEQ RecName: Full=UPF0374 protein SERP1405;
    1::177     1e-65  59%  180 aa  Y2004_STAA8 RecName: Full=UPF0374 protein SAOUHSC_02004;
    1::177     1e-65  59%  180 aa  Y1955_STAA2 RecName: Full=UPF0374 protein SaurJH1_1955;
    1::177     1e-65  59%  180 aa  Y1925_STAAC RecName: Full=UPF0374 protein SACOL1925;
    1::177     1e-65  59%  180 aa  Y1921_STAA9 RecName: Full=UPF0374 protein SaurJH9_1921;
    1::177     1e-65  59%  180 aa  Y1867_STAAM RecName: Full=UPF0374 protein SAV1867;
    1::177     1e-65  59%  180 aa  Y1862_STAAT RecName: Full=UPF0374 protein USA300HOU_1862;
    1::177     1e-65  59%  180 aa  Y1852_STAA1 RecName: Full=UPF0374 protein SAHV_1852;
    1::177     1e-65  59%  180 aa  Y1848_STAA3 RecName: Full=UPF0374 protein SAUSA300_1848;
    1::177     1e-65  59%  180 aa  Y1807_STAAW RecName: Full=UPF0374 protein MW1807;
    1::177     1e-65  59%  180 aa  Y1800_STAAB RecName: Full=UPF0374 protein SAB1800c;
    1::177     1e-65  59%  180 aa  Y1789_STAAS RecName: Full=UPF0374 protein SAS1789;
    1::177     1e-65  59%  180 aa  Y1759_STAAE RecName: Full=UPF0374 protein NWMN_1759;
    1::177     1e-65  59%  180 aa  Y1684_STAAN RecName: Full=UPF0374 protein SA1684;
    1::177     2e-65  58%  180 aa  Y1094_STAHJ RecName: Full=UPF0374 protein SH1094;
    1::177     5e-65  59%  180 aa  Y926_STAS1 RecName: Full=UPF0374 protein SSP0926;
    7::180     7e-65  59%  181 aa  Y1440_STACT RecName: Full=UPF0374 protein Sca_1440;
    4::173     9e-65  59%  175 aa  Y877_LISMH RecName: Full=UPF0374 protein LMHCC_0877;
    4::173     9e-65  59%  175 aa  Y1711_LISMF RecName: Full=UPF0374 protein LMOf2365_1711;
    4::173     9e-65  59%  175 aa  Y1701_LISMC RecName: Full=UPF0374 protein Lm4b_01701;
    4::173     9e-65  59%  175 aa  Y1687_LISMO RecName: Full=UPF0374 protein lmo1687;
    4::173     6e-64  59%  175 aa  Y1795_LISIN RecName: Full=UPF0374 protein lin1795;
    4::173     6e-64  59%  175 aa  Y1705_LISW6 RecName: Full=UPF0374 protein lwe1705;
    4::172     5e-61  58%  176 aa  Y589_BACAA RecName: Full=UPF0374 protein BAA_0589;
    4::172     5e-61  58%  176 aa  Y527_BACAN RecName: Full=UPF0374 protein BA_0527/GBAA_0527/BAS0495;
    4::172     5e-61  58%  176 aa  Y4078_BACAC RecName: Full=UPF0374 protein BAMEG_4078;
    4::176     8e-61  54%  176 aa  Y890_BACLD RecName: Full=UPF0374 protein BLi00890/BL03042;
    4::172     1e-60  59%  176 aa  Y449_BACCN RecName: Full=UPF0374 protein Bcer98_0449;
    4::172     1e-60  58%  176 aa  Y583_BACC7 RecName: Full=UPF0374 protein BCAH187_A0583;
    4::172     1e-60  58%  176 aa  Y582_BACC1 RecName: Full=UPF0374 protein BCE_0582;
    4::172     1e-60  58%  176 aa  Y555_BACCQ RecName: Full=UPF0374 protein BCQ_0555;
    4::172     1e-60  58%  176 aa  Y546_BACC3 RecName: Full=UPF0374 protein BCA_0546;
    4::172     1e-60  58%  176 aa  Y510_BACC0 RecName: Full=UPF0374 protein BCAH820_0510;
    4::172     1e-60  58%  176 aa  Y4794_BACC2 RecName: Full=UPF0374 protein BCG9842_B4794;
    4::172     1e-60  58%  176 aa  Y460_BACAH RecName: Full=UPF0374 protein BALH_0460;
    4::172     1e-60  58%  176 aa  Y438_BACHK RecName: Full=UPF0374 protein BT9727_0438;
    4::172     1e-60  58%  176 aa  Y434_BACCZ RecName: Full=UPF0374 protein BCE33L0434;
    4::172     2e-60  58%  176 aa  Y531_BACC4 RecName: Full=UPF0374 protein BCB4264_A0531;
    4::172     2e-60  58%  176 aa  Y508_BACCR RecName: Full=UPF0374 protein BC_0508;
    4::176     2e-60  55%  176 aa  Y877_BACA2 RecName: Full=UPF0374 protein RBAM_008770;
    4::172     2e-60  57%  176 aa  Y443_BACWK RecName: Full=UPF0374 protein BcerKBAB4_0443;
    4::172     7e-60  57%  175 aa  Y899_OCEIH RecName: Full=UPF0374 protein OB0899;
    4::176     1e-59  54%  176 aa  YGAC_BACSU RecName: Full=UPF0374 protein ygaC;
    4::176     2e-59  53%  176 aa  Y817_BACP2 RecName: Full=UPF0374 protein BPUM_0817;
    5::173     7e-59  56%  177 aa  Y474_GEOSW RecName: Full=UPF0374 protein GWCH70_0474;
    5::169     1e-58  59%  177 aa  Y468_GEOKA RecName: Full=UPF0374 protein GK0468;
    5::169     5e-58  59%  177 aa  Y473_GEOTN RecName: Full=UPF0374 protein GTNG_0473;
    1::173     5e-54  51%  175 aa  Y1315_BACSK RecName: Full=UPF0374 protein ABC1315;
    4::173     1e-53  54%  175 aa  Y940_BACHD RecName: Full=UPF0374 protein BH0940;
    8::167     2e-26  29%  596 aa  SYC_MYCPU RecName: Full=Cysteinyl-tRNA synthetase;       
  317::446     3e-06  30%  471 aa  AUBA_PYRKO RecName: Full=RNA-binding protein AU-1;AltName:
  379::446     1e-05  31%  471 aa  AUBA_THEGJ RecName: Full=RNA-binding protein AU-1;AltName:
  315::443     2e-05  27%  471 aa  AUBA_HALSA RecName: Full=RNA-binding protein AU-1;AltName:
  315::443     2e-05  27%  471 aa  AUBA_HALS3 RecName: Full=RNA-binding protein AU-1;AltName:
  323::387     5e-04  32%  412 aa  AUBA_SULTO RecName: Full=RNA-binding protein AU-1;AltName:
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWITREPALVYFHK
Y370_LACS1      MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWITREPALVYFHK
Y1241_LACPL     -----GPKEGDFITIKSYKHDGSLHRTWRDTMVLKTSENVLIGCNDHTLVTEDDGRRWVTREPAIVYFHK
Y1475_LACSS     ---MNAPKEGDYIAIQSYKHDGSLHRTWRDTMVLKTSENAVIGCNDHTLVTESDGRKWVTREPALIYFHK
Y1781_STRMU     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAVIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y421_STRTD      ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENAVIGVNDHTLVTEADGRRWVTREPAIVYFHK
Y374_STRT2      ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENAVIGVNDHTLVTEADGRRWVTREPAIVYFHK
Y374_STRT1      ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENAVIGVNDHTLVTEADGRRWVTREPAIVYFHK
Y469_STRPG      ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1617_STRP8     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1608_STRP1     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1437_STRPD     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1430_STRPF     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1367_STRP6     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1362_STRPM     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1342_STRPB     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1315_STRPC     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1243_STRPZ     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
YJJG_LACLA      ------PKEGDFITIQSYKHDGNLHRTWRDTMVLKTNENSIIGVNDHTLVTESDDRRWVTREPAIVYFHK
Y1055_LACLS     ------PKEGDFITIQSYKHDGNLHRTWRDTMVLKTNENSIIGVNDHTLVTESDDRRWVTREPAIVYFHK
Y1832_STRSV     ------PKEGDFITIQSYKHDGNLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y422_STRS7      ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1718_STRE4     ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1542_STREM     ------PKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1356_STRP3     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y492_STRA1      ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWVTREPAIVYFHK
Y446_STRA3      ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWVTREPAIVYFHK
Y411_STRA5      ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWVTREPAIVYFHK
Y2045_STRPI     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1984_STRP7     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1932_STRZP     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1903_STRPN     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1878_STRPS     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1848_STRZT     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1836_STRZJ     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1719_STRR6     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1706_STRP2     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1550_LACLM     ------PKEGDFITIQSYKHDGNLHRTWRDTMVLKTNENSIIGVNDHTLVTESDDRRWVTREPAIVYFHK
Y1925_STRPJ     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1373_STRU0     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWVTREPAIVYFHK
Y697_ENTFA      ------PKEGEFVTIQSYKHDGHLHRTWRDTMVLKTSEYSLIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y625_STRGC      ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHR
Y445_STRSY      ------PKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNHTLVTENDGRRWVTREPAIVYFHK
Y432_STRS2      ------PKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNHTLVTENDGRRWVTREPAIVYFHK
Y1812_STRP4     ------PKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHK
Y1604_LACJO     ------PREGDYIAIQSYKHNGTLHRNWRDTMVVKTEQNIIIGVNDRTLITEEDGRKWISREPAIVYFHR
Y1957_STAAR     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1551_STAES     MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTEHVIIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1405_STAEQ     MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTEHVIIGGNDHTLVTESDGRTWITREPAIVYFHS
Y2004_STAA8     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1955_STAA2     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1925_STAAC     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1921_STAA9     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1867_STAAM     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1862_STAAT     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1852_STAA1     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1848_STAA3     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1807_STAAW     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1800_STAAB     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1789_STAAS     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1759_STAAE     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1684_STAAN     MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y1094_STAHJ     MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTDHVIIGGNDHTLVTESDGRTWITREPAIVYFHS
Y926_STAS1      MVKESIPKEGQTIKIQSYKHDGNIHRVWSETTILKGTEHVVIGGNDHTLVTESDSRTWITREPAIVYFHS
Y1440_STACT     ------PKEGENIKIQSYKHDGNIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWITREPAIVYFHS
Y877_LISMH      ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y1711_LISMF     ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y1701_LISMC     ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y1687_LISMO     ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y1795_LISIN     ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y1705_LISW6     ------PKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWVTREPSICYFHS
Y589_BACAA      ------PKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHE
Y527_BACAN      ------PKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHE
Y4078_BACAC     ------PKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHE
Y890_BACLD      ------PKEGETIQIHSYKHNGQIHRIWNETTILKATELCIIGANDRTMVTESDGRTWVTREPAICYFHA
Y449_BACCN      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTLVTESDGRTWITREPAICYFHA
Y583_BACC7      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y582_BACC1      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y555_BACCQ      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y546_BACC3      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y510_BACC0      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y4794_BACC2     ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y460_BACAH      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y438_BACHK      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y434_BACCZ      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y531_BACC4      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y508_BACCR      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWITREPAICYFHA
Y877_BACA2      ------PKEGETIQIHSYKHNGLLHRIWNETTILKSTELCIIGANDRTMVTESDGRTWVTREPAICYFHA
Y443_BACWK      ------PKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWVTREPAICYFHA
Y899_OCEIH      ------PNAGSKVSIQSYKHNGQLHRTWENSVILKGTESVVIGANDRTKVIESDGRSWITREPAICYFHS
YGAC_BACSU      ------PKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHA
Y817_BACP2      ------PKEGETIQIQSYKHNGLIHRIWNETTILKATELCIIGANDRTMVTESDGRTWMTREPAICYFHA
Y474_GEOSW      ------PAEGEIIQIHSYKHNGLIHRVWEESIVLKGTSTCIIGANDKTMVTEADGRTWVTREPAICFFHA
Y468_GEOKA      ------PREGKIIQIHSYKHNGTIHRIWQETVVLKGTPSYVIGGNNKTLVMEADGRTWVTREPAICFFHA
Y473_GEOTN      ------PREGKIIQIHSYKHNGTIHRIWQETVVLKGTSAYVIGGNDKTLVMEADGRTWVTREPAICFFHA
Y1315_BACSK     ---MSFPKEGSTIQIHSYKHNGKLHRIWEDTIVLKGTSKVVVAGNDRIIVREADGRNWRTREPAICYFDA
Y940_BACHD      ------PKVGSKIQIQSYKHNGSIHRIWEETIVLKGTSKVVIGGNDRILVKESDGRHWRTREPAICYFDS
SYC_MYCPU       --------EKNFINVQAYKYNGDLYRQWNGSKIIKNDSQNIILYNFHSRIMEKSGKSWQVSEPSLWIFPK
AUBA_PYRKO      -----GPKKGWLFTLEHVKPDGQRIRLGPGE-VLEVSHNPLIEFGDYAITELEAGKWW--------FVHR
AUBA_THEGJ      -------------------------------------------------ITEIEAGKWW-------FVHR
AUBA_HALSA      -----GPSVGASIEIQHGKPDGALISLGRGEVTDRSAENARITVEREMTGGGTYDALGVAREAATTRFTE
AUBA_HALS3      -----GPSVGASIEIQHGKPDGALISLGRGEVTDRSAENARITVEREMTGGGTYDALGVAREAATTRFTE
AUBA_SULTO      ----------------------------------------------------------------IVEFDS


                         .         .         *         .         .         .         .:140
query           HYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKRLLDVDEYEDHGNKWHYSADI
Y370_LACS1      HYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKRLLDVDEYEDHGNKWHYSADI
Y1241_LACPL     HYWFNIVAMIRDNGVSYYCNLASPYVLDKEALKYIDYDLDVKVFPDGERRLLDVDEYEEHGAQWRYSADT
Y1475_LACSS     KYWFNVVAMIREGGVSYYCNLASPHVMDQEALKYIDYDLDVKVFPNGEKRLLDVDEYEAHSAKWHYSAET
Y1781_STRMU     KFWFNIIAMIRDNGVSYYCNLASPYIMDQEALKYIDYDLDVKVFADGEKKLLDVDEYELHKQKMGYSSDI
Y421_STRTD      KYWFNIIAMIRDNGISYYCNLASPYVLDQEALKYIDYDLDVKVFADGEKKLLDVDEYEIHKKEMHYSPDI
Y374_STRT2      KYWFNIIAMIRDNGISYYCNLASPYVLDQEALKYIDYDLDVKVFADGEKKLLDVDEYEIHKKEMHYSPDI
Y374_STRT1      KYWFNIIAMIRDNGISYYCNLASPYVLDQEALKYIDYDLDVKVFADGEKKLLDVDEYEIHKKEMHYSPDI
Y469_STRPG      KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1617_STRP8     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1608_STRP1     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1437_STRPD     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1430_STRPF     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1367_STRP6     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1362_STRPM     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1342_STRPB     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1315_STRPC     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
Y1243_STRPZ     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYEIHKKEMQYSADM
YJJG_LACLA      KFWFNIIAMIREEGVSYYCNLASPFVLDNEALKYIDYDLDVKVFKDGEKKLLDVEEYERHRRKMHYPKEI
Y1055_LACLS     KFWFNIIAMIREEGVSYYCNLASPFVLDNEALKYIDYDLDVKVFKDGEKKLLDVEEYERHRRKMHYPKEI
Y1832_STRSV     KYWFNIIAMIRDNGTSYYCNLASPYYLDNEALKYIDYDLDVKVFADGEKRLLDVEEYERHKKQMHYSDDL
Y422_STRS7      KYWFNIIAMIRDNGVSYYCNLASPYLMDAEALKYIDYDLDVKVFADGEKRLLDVDEYEMHKQEMHYSPNL
Y1718_STRE4     KYWFNIIAMIRDNGVSYYCNLASPYLMDAEALKYIDYDLDVKVFADGEKRLLDVDEYEMHKQEMHYSPNL
Y1542_STREM     KYWFNIIAMIRDNGVSYYCNLASPYLMDAEALKYIDYDLDVKVFADGEKRLLDVDEYEMHKQEMHYSPNL
Y1356_STRP3     KYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEYGIHKKEMQYSADM
Y492_STRA1      KYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEKRLLDVDEYEQHKAQMNYPTDI
Y446_STRA3      KYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEKRLLDVDEYEQHKAQMNYPTDI
Y411_STRA5      KYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEKRLLDVDEYEQHKAQMNYPTDI
Y2045_STRPI     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1984_STRP7     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1932_STRZP     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1903_STRPN     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1878_STRPS     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1848_STRZT     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1836_STRZJ     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1719_STRR6     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1706_STRP2     KYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1550_LACLM     KFWFNIIAMIREEGVSYYCNLASPFVLDNEALKYIDYDLDVKVFKDGEKKLLDVEEYERHRRNMHYPKEI
Y1925_STRPJ     KYWFNIIAMIRDNGTSYYCNVASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDL
Y1373_STRU0     KYWFNIIAMIRDNGVSYYCNLASPYVLDGEALKYIDYDLDVKVFSDGEKRLLDVDEYEVHKVKMAYPSDI
Y697_ENTFA      KYWFNIIAMIREKGVSYYCNLASPYVLDDEALKYIDYDLDIKVFPDGEKRLLDVDEYEFHSKLMDYPEDI
Y625_STRGC      KYWFNIIAMIRENGTSYYCNLASPYYLDSEALKYIDYDLDVKVFADGEKRLLDVEEYERHKKKMNYSNDL
Y445_STRSY      KYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYIDYDLDVKVFADGEKRLLDVDEYERHRKAMKYSDDI
Y432_STRS2      KYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYIDYDLDVKVFADGEKRLLDVDEYERHRKAMKYSDDI
Y1812_STRP4     KYWFNIIAMIRDNGTSYYCNMASPYYXDEXALKYIDYDLDVKIFTDGEKRXLDVEEYERHKRKMNYSDDL
Y1604_LACJO     KLWFNVIAMLRPDGVAYYANLASPFILDREALKYIDYDLDIKVFPDGEKRLLDADEYAMNKKRWHYSEEI
Y1957_STAAR     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1551_STAES     EYWFNVICMFREDGIYYYCNLSSPFACDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1405_STAEQ     EYWFNVICMFREDGIYYYCNLSSPFACDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y2004_STAA8     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1955_STAA2     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1925_STAAC     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1921_STAA9     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1867_STAAM     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1862_STAAT     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1852_STAA1     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1848_STAA3     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1807_STAAW     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1800_STAAB     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1789_STAAS     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1759_STAAE     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1684_STAAN     EYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y1094_STAHJ     EFWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMNQMNYPHDI
Y926_STAS1      EFWFNVICMFREDGVYYYCNLSSPFVCDDEALKYIDYDLDIKVYPNGKYHLLDEDEYEQHMRQMNYSSDI
Y1440_STACT     EYWFNVICMFREDGVYYYCNLSSPFVCDDEALKYIDYDLDVKVYPNGKYHLLDEDEYQQHMQQMNYPKDI
Y877_LISMH      DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y1711_LISMF     DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y1701_LISMC     DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y1687_LISMO     DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y1795_LISIN     DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y1705_LISW6     DYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRFHLLDEGEYEQHRRQMKYPDSI
Y589_BACAA      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y527_BACAN      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y4078_BACAC     NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y890_BACLD      KQWFNVIGMLREDGIYYYCNISSPFALDDEAIKYIDYDLDVKVFPDMTYHILDEDEYADHKKAMNYPKEI
Y449_BACCN      NYWFNVIGMLREDGVYYYCNLSSPFAYDLEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSKMMKYPPVI
Y583_BACC7      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y582_BACC1      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y555_BACCQ      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y546_BACC3      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y510_BACC0      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y4794_BACC2     NYWFNVIGMLREDGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y460_BACAH      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y438_BACHK      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y434_BACCZ      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y531_BACC4      NYWFNVIGMLREDGVYYYCNLSSPFAYDPEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSEIMQYPPVI
Y508_BACCR      NYWFNVIGMLREDGVYYYCNLSSPFAYDPEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSEIMQYPPVI
Y877_BACA2      RQWFNVIGMLRDDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKSMNYPKEI
Y443_BACWK      NYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVI
Y899_OCEIH      KYWFNIIGMLRNDGIYYYCNISSPFVYDGEALKYIDYDLDVKVFPDMTFQLLDEDEYEEHRNLMNYPQVI
YGAC_BACSU      RQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEI
Y817_BACP2      KQWFNVIGMLRDDGVYYYCNISSPFATDEEAIKYIDYDLDVKVFPDMTYNILDEDEYADHKRQMNYPKEI
Y474_GEOSW      KHWFNIIGMIREEGIYYYCNLSSPFVWDEEALKYIDYDLDIKVFPDMTYILLDEDEYERHRKEMNYPDVI
Y468_GEOKA      KHWFNIIAMIREDGVYYYCNLSSPFVWDEEALKYIDYDLDIKVFPDMTYMLLDEDEYERHRREMHYPDVI
Y473_GEOTN      KHWFNIIAMIREDGVYYYCNLSSPFVWDDEALKYIDYDLDIKVFPDMTYMLLDEDEYERHRREMNYPDVI
Y1315_BACSK     EQWFNMICMLRADGIYYYCNLGTPFTWDEEALKYIDYDLDIKVYPDMTMKLLDEDEYELHSKLMKYPPEL
Y940_BACHD      EQWFNTIGMIRADGIYFYCNLGTPFTWDEEALKYIDYDLDIKVFPDMTFKLLDEDEYAMHRKMMKYPPEI
SYC_MYCPU       NENYNVNVLLRPEGNYYYINLTSPFIFEDNTIKYIDFDIDIKVYPKKEIEIVDIKEFQKNIKDYGYPPSV
AUBA_PYRKO      YYDKN------GNLKGEYYNINTPVEIYPDGARYVDLEVDIVKWPDGKKEIIDQEELKEH----------
AUBA_THEGJ      YYDRN------GNLKGEYYNINTPVEIYPDRARYIDLEIDIVKWPDGEKEIIDKDKLREH----------
AUBA_HALSA      GNWWYPTVYRSEDGEGTYLNVCTPVEVFPDAVRYVDLHVDVIKHADGAVEIVDREELQD-----------
AUBA_HALS3      GNWWYPTVYRSEDGEGTYLNVCTPVEVFPDAVRYVDLHVDVIKHADGAVEIVDREELQD-----------
AUBA_SULTO      RKWYQIHRYYNKDGKGIYVNISTPPELLRGKLRYLDLEVDV-VKVGDEVRIIDLEELE------------


                         +         .         .         .         .         *         .:210
query           DKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSRQQ
Y370_LACS1      DKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSRQQ
Y1241_LACPL     DRILKANVKVLVDWIKNKKGPFSQDYIDIWYSRYQELSRRQ
Y1475_LACSS     DRILKANVKVLVDWINNGKGPFSKEYIDIWYNRYQELAHHR
Y1781_STRMU     DYILKENVKILVDWINNGKGPFSQSYINIWYKRYLELKNR-
Y421_STRTD      DYILKEHVKILVDWINNGKGPFSQSYVNIWYKRYLEL----
Y374_STRT2      DYILKEHVKILVDWINNGKGPFSQSYVNIWYKRYLEL----
Y374_STRT1      DYILKEHVKILVDWINNGKGPFSQSYVNIWYKRYLEL----
Y469_STRPG      DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1617_STRP8     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1608_STRP1     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1437_STRPD     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1430_STRPF     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1367_STRP6     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1362_STRPM     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1342_STRPB     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1315_STRPC     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y1243_STRPZ     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
YJJG_LACLA      DHILKENVKILVDWINNEKGPFSKEYVEIWYNRYHQLKK--
Y1055_LACLS     DHILKENVKILVDWINNEKGPFSKEYVEIWYNRYHQLKK--
Y1832_STRSV     DFILKENVKILVDWINNGRGPFSDAYVNIWYKRYVELKNR-
Y422_STRS7      DFILKENVKLLVDWINKEKGPFSKAYVSIWYKRYLELKNR-
Y1718_STRE4     DFILKENVKLLVDWINKEKGPFSKAYVSIWYKRYLELKNR-
Y1542_STREM     DFILKENVKLLVDWINKEKGPFSKAYVSIWYKRYLELKNR-
Y1356_STRP3     DFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKNR-
Y492_STRA1      DYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKKR-
Y446_STRA3      DYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKKR-
Y411_STRA5      DYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKKR-
Y2045_STRPI     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1984_STRP7     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1932_STRZP     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1903_STRPN     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1878_STRPS     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1848_STRZT     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1836_STRZJ     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1719_STRR6     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1706_STRP2     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1550_LACLM     DHILKENVKILVDWINNEKGPFSKEYVEIWYNRYHQLKK--
Y1925_STRPJ     DYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1373_STRU0     DYILKENVKVLVDWIKHKKGPFSEAYIKIWYKRYLELKNR-
Y697_ENTFA      DFILKENVKTLVDWINNEKGPFSPEYVDIWYQRYQQLSKK-
Y625_STRGC      DYILKENVKILVDWINQERGPFSQAYVNIWYKRYIELKNR-
Y445_STRSY      DFILKENVKILVDWINNQRGPFSPAYVNIWYKRYLEL----
Y432_STRS2      DFILKENVKILVDWINNQRGPFSPAYVNIWYKRYLEL----
Y1812_STRP4     DYILKEHVKILVXWINNGRGPFSEAYVNIWYKRYVELKNR-
Y1604_LACJO     DSILRSTSFELLDWIDQKKGPFARKFVQIWYERYNQL----
Y1957_STAAR     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKDRYKKI----
Y1551_STAES     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1405_STAEQ     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y2004_STAA8     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1955_STAA2     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1925_STAAC     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1921_STAA9     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1867_STAAM     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1862_STAAT     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1852_STAA1     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1848_STAA3     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1807_STAAW     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1800_STAAB     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1789_STAAS     DIILRRNVDILQQWIEQKKGPFAPDFIKVWNERYKKI----
Y1759_STAAE     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1684_STAAN     DIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y1094_STAHJ     DVILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKI----
Y926_STAS1      DVILRRNVDILQQWIEQKKGPFAPDFIKVWRERYKKI----
Y1440_STACT     DVILRRNVDILQQWIEQKKGPFAPDFIKVWRERYKKLRQK-
Y877_LISMH      DRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y1711_LISMF     DRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y1701_LISMC     DRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y1687_LISMO     DRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y1795_LISIN     DRILKTNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y1705_LISW6     DRILKTNVDVLSHWILDKKGPFSPDYIDIWYEKYKE-----
Y589_BACAA      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y527_BACAN      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y4078_BACAC     DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y890_BACLD      DGILRYHLNTLLHWIHQRKGPFASEFIDIWYERYLHYTK--
Y449_BACCN      DTILKRNVEYLRKWIHQRKGPFAPDFVDMWYERYL------
Y583_BACC7      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y582_BACC1      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y555_BACCQ      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y546_BACC3      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y510_BACC0      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y4794_BACC2     DTILKRNVAHLTQWIHQRKGPFAPDFVDMWYERYL------
Y460_BACAH      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y438_BACHK      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y434_BACCZ      DTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYL------
Y531_BACC4      DTILKRNVAHLTQWIHQRKGPFAPDFVDMWYERYL------
Y508_BACCR      DTILKRNVAHLTQWIHQRKGPFAPDFVDMWYERYL------
Y877_BACA2      DSILKEYLNTLLHWIHQRKGPFAPEFVDMWYERYLRYTK--
Y443_BACWK      DTILKRNVAHLTQWIHQRKGPFAPDFVDMWYERYL------
Y899_OCEIH      DRILHQQLEILIRWIRQGKGPFSPDFVDNWYEMYL------
YGAC_BACSU      DSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK--
Y817_BACP2      DSILREHLNTLLHWIHQRKGPFAPEFVDMWYERFLHYTK--
Y474_GEOSW      DRILKNNVKKLISWIHERKGPFAPDFIDKWYEKFL------
Y468_GEOKA      DRILKNNVQKLIGWIKERKGPFAPEFIDKWY----------
Y473_GEOTN      DRILKNNVQKLIGWIQERKGPFAPEFIDKWY----------
Y1315_BACSK     DVILRKSVDELISWIHQRKGPFAPQFVENWYERYLQ-----
Y940_BACHD      DRILQRSVDELVSWIHQRKGPFAPQFVESWYERFLQ-----
SYC_MYCPU       RKMVYKQVQNLLMFYEKQTSFFHRDFID-------------
AUBA_PYRKO      -----------------------------------------
AUBA_THEGJ      -----------------------------------------
AUBA_HALSA      -----------------------------------------
AUBA_HALS3      -----------------------------------------
AUBA_SULTO      -----------------------------------------