[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99233.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
    4::306     1e-56  41%  309 aa  RBSK_ECOLI RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::306     1e-56  41%  309 aa  RBSK_ECO57 RecName: Full=Ribokinase;         EC=2.7.1.15;
    1::298     3e-53  40%  306 aa  RBSK_HAEIN RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::315     5e-49  39%  318 aa  RBSK_SCHPO RecName: Full=Putative ribokinase;         EC=2.7.1.15;
    3::292     3e-43  37%  300 aa  RBSK_LACLA RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::293     3e-39  35%  293 aa  RBSK_BACSU RecName: Full=Ribokinase;         EC=2.7.1.15;
    6::292     2e-37  34%  294 aa  RBSK_BACHD RecName: Full=Ribokinase;         EC=2.7.1.15;
   23::318     1e-36  35%  323 aa  RBSK_MOUSE RecName: Full=Ribokinase;         EC=2.7.1.15;
   22::317     3e-36  35%  322 aa  RBSK_HUMAN RecName: Full=Ribokinase;         EC=2.7.1.15;
    1::317     6e-35  34%  318 aa  RBSK_DICDI RecName: Full=Probable ribokinase;         EC=2.7.1.15;
    3::331     9e-33  36%  333 aa  RBSK_YEAST RecName: Full=Probable ribokinase;         EC=2.7.1.15;
   35::322     1e-22  32%  324 aa  SCRK5_ARATH RecName: Full=Putative fructokinase-5;       
   40::315     1e-22  30%  328 aa  SCRK2_SOLHA RecName: Full=Fructokinase-2;         EC=2.7.1.4;
   36::322     1e-22  33%  323 aa  SCRK1_ORYSI RecName: Full=Fructokinase-1;       
   36::322     2e-22  33%  323 aa  SCRK1_ORYSJ RecName: Full=Fructokinase-1;       
   40::315     2e-22  30%  328 aa  SCRK2_SOLLC RecName: Full=Fructokinase-2;         EC=2.7.1.4;
   39::334     4e-22  32%  345 aa  SCRK3_ARATH RecName: Full=Probable fructokinase-3;       
   36::316     9e-22  33%  323 aa  SCRK1_MAIZE RecName: Full=Fructokinase-1;       
   40::315     3e-21  34%  329 aa  SCRK2_ARATH RecName: Full=Probable fructokinase-2;       
   39::323     1e-20  31%  326 aa  SCRK4_ARATH RecName: Full=Probable fructokinase-4;       
   38::325     1e-20  29%  325 aa  SCRK1_ARATH RecName: Full=Probable fructokinase-1;       
   41::310     2e-20  28%  319 aa  SCRK_SOLTU RecName: Full=Fructokinase;         EC=2.7.1.4;
   47::322     1e-19  30%  336 aa  SCRK2_ORYSJ RecName: Full=Fructokinase-2;       
   47::322     1e-19  30%  336 aa  SCRK2_ORYSI RecName: Full=Fructokinase-2;       
   47::322     2e-19  30%  335 aa  SCRK2_MAIZE RecName: Full=Fructokinase-2;       
   34::316     4e-18  30%  320 aa  YDJE_BACSU RecName: Full=Uncharacterized sugar kinase ydjE;        
   29::310     1e-17  27%  315 aa  YDJH_ECOLI RecName: Full=Uncharacterized sugar kinase ydjH;        
   35::314     1e-15  29%  324 aa  KDGK_BACSU RecName: Full=2-dehydro-3-deoxygluconokinase;       
   12::207     4e-15  28%  250 aa  Y356_ARCFU RecName: Full=Uncharacterized sugar kinase AF_0356;     
   38::302     4e-15  26%  309 aa  K6PF2_ECOLI RecName: Full=6-phosphofructokinase isozyme 2;       
   10::311     6e-15  24%  480 aa  HLDE_THICR RecName: Full=Bifunctional protein hldE;Includes:
    7::287     8e-15  27%  313 aa  YEIC_ECOLI RecName: Full=Uncharacterized sugar kinase yeiC;        
   43::318     4e-14  28%  325 aa  IOLC_LISMO RecName: Full=5-dehydro-2-deoxygluconokinase;       
   43::318     4e-14  28%  325 aa  IOLC_LISMH RecName: Full=5-dehydro-2-deoxygluconokinase;       
   43::318     4e-14  28%  325 aa  IOLC_LISMF RecName: Full=5-dehydro-2-deoxygluconokinase;       
   43::318     4e-14  28%  325 aa  IOLC_LISMC RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::305     2e-13  25%  338 aa  IOLC_CLOPE RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::305     2e-13  25%  338 aa  IOLC_CLOP1 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   62::339     4e-13  20%  362 aa  YEII_ECOLI RecName: Full=Uncharacterized sugar kinase yeiI;        
   43::318     6e-13  26%  325 aa  IOLC_LISIN RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::316     1e-12  25%  339 aa  IOLC_CLOTE RecName: Full=5-dehydro-2-deoxygluconokinase;       
   27::301     4e-12  28%  307 aa  SCRK_VIBAL RecName: Full=Fructokinase;         EC=2.7.1.4;
   32::343     5e-12  27%  343 aa  ADK_PHYPA RecName: Full=Adenosine kinase;         Short=AK;        
   44::318     1e-11  26%  331 aa  IOLC_PHOPR RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::306     1e-11  23%  339 aa  IOLC_CLOBA RecName: Full=5-dehydro-2-deoxygluconokinase;       
   55::295     1e-11  28%  298 aa  YIHV_ECOLI RecName: Full=Uncharacterized sugar kinase yihV;        
    7::297     1e-11  24%  302 aa  Y406_METJA RecName: Full=Uncharacterized sugar kinase MJ0406;      
   44::306     1e-11  24%  339 aa  IOLC_CLOB8 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     2e-11  24%  332 aa  IOLC2_BACCZ RecName: Full=5-dehydro-2-deoxygluconokinase 2;        
   37::320     3e-11  27%  338 aa  IOLC_MYCH7 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   37::320     3e-11  27%  338 aa  IOLC_MYCH2 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   23::256     4e-11  29%  284 aa  YURL_BACSU RecName: Full=Uncharacterized sugar kinase yurL;        
   37::320     4e-11  27%  338 aa  IOLC_MYCHJ RecName: Full=5-dehydro-2-deoxygluconokinase;       
   10::302     7e-11  24%  309 aa  Y1544_METTH RecName: Full=Uncharacterized sugar kinase MTH_1544;   
   12::299     7e-11  25%  476 aa  HLDE_ACTSZ RecName: Full=Bifunctional protein hldE;Includes:
   44::321     1e-10  24%  332 aa  IOLC_BACHK RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     1e-10  24%  332 aa  IOLC_BACAN RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     1e-10  24%  332 aa  IOLC_BACAC RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     1e-10  24%  332 aa  IOLC_BACAA RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     1e-10  24%  332 aa  IOLC1_BACCZ RecName: Full=5-dehydro-2-deoxygluconokinase 1;        
   34::303     1e-10  26%  477 aa  HLDE_BLOPB RecName: Full=Bifunctional protein hldE;Includes:
   12::305     1e-10  26%  475 aa  HLDE_ACTP2 RecName: Full=Bifunctional protein hldE;Includes:
    1::270     2e-10  25%  313 aa  K1PF_HAEIN RecName: Full=1-phosphofructokinase;       
   44::306     2e-10  23%  339 aa  IOLC_CLOBB RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     2e-10  27%  477 aa  HLDE_SALDC RecName: Full=Bifunctional protein hldE;Includes:
    8::299     2e-10  25%  476 aa  HLDE_ARCB4 RecName: Full=Bifunctional protein hldE;Includes:
   20::281     2e-10  25%  490 aa  HLDE_GEOMG RecName: Full=Bifunctional protein hldE;Includes:
   17::316     2e-10  25%  491 aa  HLDE_GEOLS RecName: Full=Bifunctional protein hldE;Includes:
   44::296     2e-10  30%  468 aa  HLDE_CAMC5 RecName: Full=Bifunctional protein hldE;Includes:
   44::321     3e-10  24%  332 aa  IOLC_BACC3 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   44::321     3e-10  24%  332 aa  IOLC_BACAH RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     5e-10  25%  477 aa  HLDE_SALTY RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALTI RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALSV RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALPK RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALPC RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALPB RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALPA RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALNS RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALHS RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALG2 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALEP RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALCH RecName: Full=Bifunctional protein hldE;Includes:
   34::299     5e-10  25%  477 aa  HLDE_SALA4 RecName: Full=Bifunctional protein hldE;Includes:
   12::299     5e-10  27%  476 aa  HLDE_HAEIE RecName: Full=Bifunctional protein hldE;Includes:
   12::299     5e-10  27%  476 aa  HLDE_HAEI8 RecName: Full=Bifunctional protein hldE;Includes:
   20::276     5e-10  26%  490 aa  HLDE_GEOSL RecName: Full=Bifunctional protein hldE;Includes:
   36::342     6e-10  29%  344 aa  ADK1_ARATH RecName: Full=Adenosine kinase 1;         Short=AK 1;   
   65::318     8e-10  26%  477 aa  HLDE_SULDN RecName: Full=Bifunctional protein hldE;Includes:
   34::299     8e-10  24%  477 aa  HLDE_CITK8 RecName: Full=Bifunctional protein hldE;Includes:
   12::305     8e-10  25%  475 aa  HLDE_ACTPL RecName: Full=Bifunctional protein hldE;Includes:
   26::262     1e-09  27%  312 aa  K1PF_SHIFL RecName: Full=1-phosphofructokinase;       
   26::262     1e-09  27%  312 aa  K1PF_ECOLI RecName: Full=1-phosphofructokinase;       
   26::262     1e-09  27%  312 aa  K1PF_ECOL6 RecName: Full=1-phosphofructokinase;       
   26::262     1e-09  27%  312 aa  K1PF_ECO57 RecName: Full=1-phosphofructokinase;       
    1::278     1e-09  24%  462 aa  HLDE_NITSB RecName: Full=Bifunctional protein hldE;Includes:
   37::300     1e-09  28%  310 aa  Y1459_PYRHO RecName: Full=Uncharacterized sugar kinase PH1459;     
   37::311     1e-09  24%  326 aa  IOLC_LACCA RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     2e-09  25%  477 aa  HLDE_SALAR RecName: Full=Bifunctional protein hldE;Includes:
   12::299     2e-09  24%  476 aa  HLDE_MANSM RecName: Full=Bifunctional protein hldE;Includes:
   36::305     2e-09  26%  478 aa  HLDE_DICNV RecName: Full=Bifunctional protein hldE;Includes:
   12::299     2e-09  27%  476 aa  HLDE_HAEIG RecName: Full=Bifunctional protein hldE;Includes:
  166::299     3e-09  32%  314 aa  Y057_BUCAP RecName: Full=Uncharacterized sugar kinase BUsg_057;    
   44::281     3e-09  29%  337 aa  IOLC_GEOTN RecName: Full=5-dehydro-2-deoxygluconokinase;       
   51::299     4e-09  23%  315 aa  Y060_BUCAI RecName: Full=Uncharacterized sugar kinase BU060;       
   34::299     5e-09  25%  476 aa  HLDE_ENT38 RecName: Full=Bifunctional protein hldE;Includes:
   44::281     7e-09  32%  335 aa  IOLC_GEOKA RecName: Full=5-dehydro-2-deoxygluconokinase;       
  165::299     7e-09  34%  477 aa  HLDE_KLEP3 RecName: Full=Bifunctional protein hldE;Includes:
    1::306     9e-09  26%  307 aa  SCRK_ECOLX RecName: Full=Fructokinase;         EC=2.7.1.4;
   16::270     1e-08  26%  310 aa  LACC_LACLA RecName: Full=Tagatose-6-phosphate kinase;       
   12::299     1e-08  26%  476 aa  HLDE_SHEPA RecName: Full=Bifunctional protein hldE;Includes:
   34::299     1e-08  22%  477 aa  HLDE_ECOHS RecName: Full=Bifunctional protein hldE;Includes:
   43::319     2e-08  25%  331 aa  IOLC_BACHD RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     2e-08  22%  477 aa  HLDE_SHISS RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_SHIF8 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_SHIBS RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_SHIB3 RecName: Full=Bifunctional protein hldE;Includes:
  165::299     2e-08  33%  477 aa  HLDE_KLEP7 RecName: Full=Bifunctional protein hldE;Includes:
   12::299     2e-08  24%  475 aa  HLDE_HAEDU RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOUT RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOSM RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOSE RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOLU RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOLI RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOLC RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOL6 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOL5 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOK1 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECODH RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECOBW RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO8A RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO81 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO7I RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO5E RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO57 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO55 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO45 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO27 RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_ECO24 RecName: Full=Bifunctional protein hldE;Includes:
   16::282     2e-08  26%  489 aa  HLDE_DESAA RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-08  22%  477 aa  HLDE_SHIFL RecName: Full=Bifunctional protein hldE;Includes:
   11::298     2e-08  23%  475 aa  HLDE_HAES1 RecName: Full=Bifunctional protein hldE;Includes:
   43::324     3e-08  23%  325 aa  IOLC_BACSU RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     3e-08  22%  477 aa  HLDE_ESCF3 RecName: Full=Bifunctional protein hldE;Includes:
   12::299     3e-08  25%  476 aa  HLDE_SHEHH RecName: Full=Bifunctional protein hldE;Includes:
   34::299     3e-08  26%  476 aa  HLDE_SHEFN RecName: Full=Bifunctional protein hldE;Includes:
   14::277     3e-08  24%  487 aa  HLDE_MAGSM RecName: Full=Bifunctional protein hldE;Includes:
   12::299     3e-08  26%  476 aa  HLDE_HAEIN RecName: Full=Bifunctional protein hldE;Includes:
   34::299     4e-08  22%  477 aa  HLDE_SHIDS RecName: Full=Bifunctional protein hldE;Includes:
   17::276     6e-08  24%  490 aa  HLDE_PELCD RecName: Full=Bifunctional protein hldE;Includes:
  157::299     8e-08  27%  475 aa  HLDE_ENTS8 RecName: Full=Bifunctional protein hldE;Includes:
   43::293     1e-07  25%  325 aa  IOLC_BACLD RecName: Full=5-dehydro-2-deoxygluconokinase;       
  158::305     1e-07  28%  479 aa  HLDE_PSEHT RecName: Full=Bifunctional protein hldE;Includes:
  193::302     1e-07  31%  475 aa  HLDE_COXBN RecName: Full=Bifunctional protein hldE;Includes:
  102::360     1e-07  27%  362 aa  ADK_HUMAN RecName: Full=Adenosine kinase;         Short=AK;        
   86::343     1e-07  28%  345 aa  ADK2_ARATH RecName: Full=Adenosine kinase 2;         Short=AK 2;   
   34::298     1e-07  24%  474 aa  HLDE_PSEU2 RecName: Full=Bifunctional protein hldE;Includes:
  166::299     2e-07  28%  476 aa  HLDE_SHESR RecName: Full=Bifunctional protein hldE;Includes:
  166::299     2e-07  28%  476 aa  HLDE_SHESM RecName: Full=Bifunctional protein hldE;Includes:
  166::299     2e-07  28%  476 aa  HLDE_SHESA RecName: Full=Bifunctional protein hldE;Includes:
  193::302     2e-07  31%  475 aa  HLDE_COXBU RecName: Full=Bifunctional protein hldE;Includes:
  193::302     2e-07  31%  475 aa  HLDE_COXBR RecName: Full=Bifunctional protein hldE;Includes:
  133::181     2e-07  43%  302 aa  PDXK_DICDI RecName: Full=Pyridoxal kinase;       
  191::299     2e-07  28%  476 aa  HLDE_SHESW RecName: Full=Bifunctional protein hldE;Includes:
  191::299     2e-07  28%  476 aa  HLDE_SHEPC RecName: Full=Bifunctional protein hldE;Includes:
  191::299     2e-07  28%  476 aa  HLDE_SHEB8 RecName: Full=Bifunctional protein hldE;Includes:
   34::298     3e-07  24%  474 aa  HLDE_PSE14 RecName: Full=Bifunctional protein hldE;Includes:
  191::299     4e-07  28%  476 aa  HLDE_SHEB9 RecName: Full=Bifunctional protein hldE;Includes:
  191::299     4e-07  28%  476 aa  HLDE_SHEB5 RecName: Full=Bifunctional protein hldE;Includes:
  191::299     4e-07  28%  476 aa  HLDE_SHEB2 RecName: Full=Bifunctional protein hldE;Includes:
   34::274     4e-07  26%  474 aa  HLDE_PROMH RecName: Full=Bifunctional protein hldE;Includes:
    3::279     4e-07  26%  463 aa  HLDE_HELAH RecName: Full=Bifunctional protein hldE;Includes:
   34::298     5e-07  24%  474 aa  HLDE_PSESM RecName: Full=Bifunctional protein hldE;Includes:
   53::306     5e-07  24%  481 aa  HLDE_MARAV RecName: Full=Bifunctional protein hldE;Includes:
  101::359     5e-07  26%  361 aa  ADK_RAT RecName: Full=Adenosine kinase;         Short=AK;       
   47::306     6e-07  22%  307 aa  SCRK_SALTY RecName: Full=Fructokinase;         EC=2.7.1.4;
   16::307     6e-07  25%  309 aa  LACC_STRSV RecName: Full=Tagatose-6-phosphate kinase;       
  157::299     6e-07  27%  474 aa  HLDE_PHOLL RecName: Full=Bifunctional protein hldE;Includes:
   43::278     8e-07  25%  330 aa  IOLC_BACA2 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   34::299     8e-07  26%  481 aa  HLDE_SODGM RecName: Full=Bifunctional protein hldE;Includes:
  191::299     8e-07  29%  476 aa  HLDE_SHEDO RecName: Full=Bifunctional protein hldE;Includes:
  101::359     8e-07  26%  361 aa  ADK_MOUSE RecName: Full=Adenosine kinase;         Short=AK;        
   51::274     1e-06  23%  476 aa  HLDE_VIBVY RecName: Full=Bifunctional protein hldE;Includes:
   27::300     1e-06  25%  314 aa  KDGK_HAEIN RecName: Full=2-dehydro-3-deoxygluconokinase;       
  186::298     1e-06  27%  474 aa  HLDE_PSEPF RecName: Full=Bifunctional protein hldE;Includes:
  194::273     1e-06  37%  482 aa  HLDE_HELHP RecName: Full=Bifunctional protein hldE;Includes:
  101::359     1e-06  26%  361 aa  ADK_CRIGR RecName: Full=Adenosine kinase;         Short=AK;        
   17::264     2e-06  24%  310 aa  LACC_STRU0 RecName: Full=Tagatose-6-phosphate kinase;       
   36::257     2e-06  22%  303 aa  K1PF_BACSU RecName: Full=1-phosphofructokinase;       
   34::299     2e-06  24%  476 aa  HLDE_YERPY RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPS RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPP RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPN RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPG RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPE RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPB RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERPA RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  24%  476 aa  HLDE_YERP3 RecName: Full=Bifunctional protein hldE;Includes:
  191::299     2e-06  32%  476 aa  HLDE_SHELP RecName: Full=Bifunctional protein hldE;Includes:
  138::291     2e-06  31%  434 aa  INGK_ECOLI RecName: Full=Inosine-guanosine kinase;       
  138::291     2e-06  31%  434 aa  INGK_ECOL6 RecName: Full=Inosine-guanosine kinase;       
  138::291     2e-06  31%  434 aa  INGK_ECO57 RecName: Full=Inosine-guanosine kinase;       
  183::298     2e-06  26%  473 aa  HLDE_PSEU5 RecName: Full=Bifunctional protein hldE;Includes:
  186::298     2e-06  27%  477 aa  HLDE_PSEF5 RecName: Full=Bifunctional protein hldE;Includes:
  191::305     2e-06  26%  478 aa  HLDE_ERWCT RecName: Full=Bifunctional protein hldE;Includes:
   34::299     2e-06  25%  477 aa  HLDE_EDWI9 RecName: Full=Bifunctional protein hldE;Includes:
  357::466     3e-06  36%  490 aa  THIED_GEOSL RecName: Full=Bifunctional protein thiED;Includes:
   20::281     3e-06  23%  488 aa  HLDE_PELPD RecName: Full=Bifunctional protein hldE;Includes:
   51::274     4e-06  22%  476 aa  HLDE_VIBVU RecName: Full=Bifunctional protein hldE;Includes:
   51::274     4e-06  25%  476 aa  HLDE_VIBSL RecName: Full=Bifunctional protein hldE;Includes:
   83::353     4e-06  24%  363 aa  ADK_TOXGO RecName: Full=Adenosine kinase;         Short=AK;        
  130::220     5e-06  30%  221 aa  SCRK_SALTH RecName: Full=Fructokinase;         EC=2.7.1.4;Flags:
   51::276     5e-06  25%  476 aa  HLDE_VIBFM RecName: Full=Bifunctional protein hldE;Includes:
  157::274     5e-06  30%  476 aa  HLDE_PHOPR RecName: Full=Bifunctional protein hldE;Includes:
   29::229     7e-06  28%  326 aa  SCRK_RHILT RecName: Full=Fructokinase;         EC=2.7.1.4;
   10::299     7e-06  25%  477 aa  HLDE_HAHCH RecName: Full=Bifunctional protein hldE;Includes:
  169::281     7e-06  27%  487 aa  HLDE_GEOBB RecName: Full=Bifunctional protein hldE;Includes:
   12::299     9e-06  25%  476 aa  HLDE_SHESH RecName: Full=Bifunctional protein hldE;Includes:
   59::287     1e-05  25%  333 aa  YZ37_SYNY3 RecName: Full=Uncharacterized sugar kinase slr0537;     
   36::264     1e-05  27%  310 aa  LACC_STAHJ RecName: Full=Tagatose-6-phosphate kinase;       
   51::276     1e-05  25%  476 aa  HLDE_VIBF1 RecName: Full=Bifunctional protein hldE;Includes:
  167::299     1e-05  28%  475 aa  HLDE_AERHH RecName: Full=Bifunctional protein hldE;Includes:
   12::299     2e-05  24%  476 aa  HLDE_PASMU RecName: Full=Bifunctional protein hldE;Includes:
  166::299     2e-05  25%  478 aa  HLDE_ERWT9 RecName: Full=Bifunctional protein hldE;Includes:
  165::299     2e-05  25%  476 aa  HLDE_YERE8 RecName: Full=Bifunctional protein hldE;Includes:
  189::303     2e-05  26%  473 aa  HLDE_METCA RecName: Full=Bifunctional protein hldE;Includes:
  167::299     2e-05  29%  475 aa  HLDE_AERS4 RecName: Full=Bifunctional protein hldE;Includes:
  267::385     3e-05  31%  575 aa  Y1655_HAEIN RecName: Full=Uncharacterized protein HI1655;
  191::305     3e-05  26%  478 aa  HLDE_PECCP RecName: Full=Bifunctional protein hldE;Includes:
  185::281     3e-05  33%  458 aa  HLDE_CAMFF RecName: Full=Bifunctional protein hldE;Includes:
  115::190     4e-05  38%  265 aa  THID_MYCTU RecName: Full=Phosphomethylpyrimidine kinase;       
  115::190     4e-05  38%  265 aa  THID_MYCBO RecName: Full=Phosphomethylpyrimidine kinase;       
   16::263     4e-05  24%  309 aa  LACC_STRPC RecName: Full=Tagatose-6-phosphate kinase;       
   16::263     4e-05  24%  309 aa  LACC_STRPB RecName: Full=Tagatose-6-phosphate kinase;       
   37::276     5e-05  23%  490 aa  HLDE_RHOP5 RecName: Full=Bifunctional protein hldE;Includes:
   17::263     6e-05  24%  309 aa  LACC_STRPM RecName: Full=Tagatose-6-phosphate kinase;       
   17::263     6e-05  24%  309 aa  LACC_STRPD RecName: Full=Tagatose-6-phosphate kinase;       
   17::265     6e-05  24%  310 aa  LACC_STRA5 RecName: Full=Tagatose-6-phosphate kinase;       
   17::265     6e-05  24%  310 aa  LACC2_STRA3 RecName: Full=Tagatose-6-phosphate kinase 2;       
   49::288     6e-05  27%  474 aa  HLDE_WOLSU RecName: Full=Bifunctional protein hldE;Includes:
  157::299     6e-05  25%  476 aa  HLDE_SERP5 RecName: Full=Bifunctional protein hldE;Includes:
   43::192     8e-05  30%  225 aa  PYRH_META3 RecName: Full=Uridylate kinase;         Short=UK;       
   16::264     8e-05  27%  310 aa  LACC_STAAR RecName: Full=Tagatose-6-phosphate kinase;       
  186::305     8e-05  27%  474 aa  HLDE_AZOVD RecName: Full=Bifunctional protein hldE;Includes:
   19::137     1e-04  26%  148 aa  Y1336_METJA RecName: Full=Uncharacterized protein MJ1336;
  145::186     1e-04  43%  312 aa  PDXK_SHEEP RecName: Full=Pyridoxal kinase;       
  145::186     1e-04  43%  312 aa  PDXK_BOVIN RecName: Full=Pyridoxal kinase;       
  135::247     2e-04  33%  276 aa  THID_STAAR RecName: Full=Phosphomethylpyrimidine kinase;       
   34::298     2e-04  23%  474 aa  HLDE_PSEFS RecName: Full=Bifunctional protein hldE;Includes:
   43::138     2e-04  29%  225 aa  PYRH_METMP RecName: Full=Uridylate kinase;         Short=UK;       
  131::186     2e-04  38%  312 aa  PDXK_HUMAN RecName: Full=Pyridoxal kinase;       
   16::263     2e-04  24%  309 aa  LACC1_STRA3 RecName: Full=Tagatose-6-phosphate kinase 1;       
  167::299     2e-04  27%  477 aa  HLDE_SHEPW RecName: Full=Bifunctional protein hldE;Includes:
  157::315     3e-04  23%  473 aa  HLDE_NITOC RecName: Full=Bifunctional protein hldE;Includes:
   24::260     3e-04  23%  261 aa  FRLD_ECOLI RecName: Full=Fructoselysine kinase;         EC=2.7.1.-;
   43::308     3e-04  27%  340 aa  ADK_DICDI RecName: Full=Adenosine kinase;         Short=AK;        
  135::247     4e-04  32%  276 aa  THID_STAAW RecName: Full=Phosphomethylpyrimidine kinase;       
  135::247     4e-04  32%  276 aa  THID_STAAS RecName: Full=Phosphomethylpyrimidine kinase;       
  118::248     4e-04  32%  271 aa  THID_BACSU RecName: Full=Phosphomethylpyrimidine kinase;       
   43::138     4e-04  28%  225 aa  PYRH_METM7 RecName: Full=Uridylate kinase;         Short=UK;       
   43::138     4e-04  28%  225 aa  PYRH_METM5 RecName: Full=Uridylate kinase;         Short=UK;       
  155::196     4e-04  43%  322 aa  PDXK_PIG RecName: Full=Pyridoxal kinase;       
   17::265     4e-04  24%  310 aa  LACC_STRA1 RecName: Full=Tagatose-6-phosphate kinase;       
  166::267     4e-04  27%  476 aa  HLDE_SHEON RecName: Full=Bifunctional protein hldE;Includes:
  187::318     4e-04  29%  461 aa  HLDE_CAMJ8 RecName: Full=Bifunctional protein hldE;Includes:
  167::276     4e-04  28%  476 aa  HLDE_ALISL RecName: Full=Bifunctional protein hldE;Includes:
  324::454     4e-04  28%  454 aa  AK3_BACSU RecName: Full=Probable aspartokinase;       
  285::350     5e-04  31%  355 aa  SCRKL_DICDI RecName: Full=Uncharacterized sugar kinase;       
   17::231     5e-04  25%  310 aa  LACC_STAEQ RecName: Full=Tagatose-6-phosphate kinase;       
   78::261     5e-04  31%  313 aa  LACC_ENTFA RecName: Full=Tagatose-6-phosphate kinase;       
   43::116     5e-04  31%  326 aa  IOLC_BACSK RecName: Full=5-dehydro-2-deoxygluconokinase;       
   43::138     7e-04  28%  225 aa  PYRH_METM6 RecName: Full=Uridylate kinase;         Short=UK;       
  123::240     7e-04  28%  289 aa  PDXY_VIBF1 RecName: Full=Pyridoxamine kinase;         Short=PM
  138::186     7e-04  37%  312 aa  PDXK_MOUSE RecName: Full=Pyridoxal kinase;       
   16::263     7e-04  24%  309 aa  LACC_STRP3 RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     7e-04  26%  310 aa  LACC_STAAB RecName: Full=Tagatose-6-phosphate kinase;       
  186::298     7e-04  25%  473 aa  HLDE_PSEPK RecName: Full=Bifunctional protein hldE;Includes:
  186::298     7e-04  25%  473 aa  HLDE_PSEPG RecName: Full=Bifunctional protein hldE;Includes:
  186::298     7e-04  25%  473 aa  HLDE_PSEP1 RecName: Full=Bifunctional protein hldE;Includes:
  106::174     9e-04  29%  255 aa  THID_AQUAE RecName: Full=Phosphomethylpyrimidine kinase;       
   16::263     9e-04  22%  309 aa  LACC_STRPG RecName: Full=Tagatose-6-phosphate kinase;       
   17::231     9e-04  25%  310 aa  LACC_STAES RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAW RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAT RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAS RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAN RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAM RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAE RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAAC RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAA9 RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAA8 RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAA3 RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAA2 RecName: Full=Tagatose-6-phosphate kinase;       
   16::264     9e-04  26%  310 aa  LACC_STAA1 RecName: Full=Tagatose-6-phosphate kinase;       
   68::166     9e-04  33%  303 aa  FTSY_RICPR RecName: Full=Cell division protein ftsY homolog;
  210::311     9e-04  30%  689 aa  DNLJ_RICAE RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
RBSK_ECOLI      -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
RBSK_ECO57      -AGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGES
RBSK_HAEIN      MRKTLTVLGSINADHVISVPYFTKPGETLTGQNYQIAYGGKGANQXXXXXXXXXXXXFISCIGSDSIGKT
RBSK_SCHPO      ----IVVLGSMNTDLVMRTKICPSGGETIEPDGFSTGNGGKGANQAVAVARADTKVSMLGCVGDDAFGVE
RBSK_LACLA      ---KVSVIGSISMDLVTRTNRVPNAGETVFGEDFAMVPGGKGANQAVAFARSPNEVSMIGAVGKDAFGES
RBSK_BACSU      ----ICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTA
RBSK_BACHD      ----ITVVGSINMDMVTITDVVPVQGETVLGKDFRTVPGGKGANQAVAAARLGANVRMIGRVGDDPFGHV
RBSK_MOUSE      --------GSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAKAAIVCKVGNDSFGND
RBSK_HUMAN      --------GSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAMTSMVCKVGKDSFGND
RBSK_DICDI      MENNITVVGASNWDTFIYVDKMPRVGETIKGTDLKVSYGGKAANQAVQASLLGSNCTLITKLGDDPSGVN
RBSK_YEAST      ----ITVIGSLNYDLDTFTDRLPNAGETFRANHFETHAGGKGLNQAAAIGKSRYSVRMIGNVGNDTFGKQ
SCRK5_ARATH     ------------------------------------APGGAPANVACAITKLGGKSAFIGKFGDDEFGHM
SCRK2_SOLHA     ------------------------------------APGGAPANVAIAVTRLGGRSAFVGKLGDDEFGHM
SCRK1_ORYSI     ------------------------------------APGGAPANVAIAVARLGGGAAFVGKLGDDEFGRM
SCRK1_ORYSJ     ------------------------------------APGGAPANVAIAVARLGGGAAFVGKLGDDEFGRM
SCRK2_SOLLC     ------------------------------------APGGAPANVAIAVTRLGGKSAFVGKLGDDEFGHM
SCRK3_ARATH     ------------------------------------APGGAPANVAIAVSRLGGRAAFVGKLGDDDFGHM
SCRK1_MAIZE     ------------------------------------APGGAPANVAIAVSRLGGGAAFVGKLGDDEFGRM
SCRK2_ARATH     ------------------------------------APGGAPANVAIAVSRLGGRAAFVGKLGDDEFGHM
SCRK4_ARATH     ------------------------------------APGGAPANVAIAISRLGGRAAFVGKLGDDEFGHM
SCRK1_ARATH     ------------------------------------APGGAPANVAIAVSRLGGRSAFVGKLGDDEFGHM
SCRK_SOLTU      ------------------------------------APGGAPANVAIAVTRLGGKSAFVGKLGDDEFGHM
SCRK2_ORYSJ     ------------------------------------APGGAPANVACAISKLGGSSAFVGKFGDDEFGHM
SCRK2_ORYSI     ------------------------------------APGGAPANVACAISKLGGSSAFVGKFGDDEFGHM
SCRK2_MAIZE     ------------------------------------APGGAPANVACAIAKLGGSSAFVGKFGDDEFGHM
YDJE_BACSU      ------------------------------------SAGGAPANVSAAIAKLGGDAAFSGKVGKDPFGYF
YDJH_ECOLI      --------------------------DSYPLERIAMTTGGDAINEATIISRLGHRTALMSRIGKDAAGQF
KDGK_BACSU      ---------------------------------------GAESNVACGLARLGFRMGWMSKVGNDQLGTF
Y356_ARCFU      ---------------------------------------------------------YIGKVGSDEEGRI
K6PF2_ECOLI     --------------------------------------GGGGINVARAIAHLGGSATAIFPAGG-ATGEH
HLDE_THICR      ---KILVVGDVMLDQYWRIPEAPVP--VVKVADENVRAGG-AANVALNIADLGADVNLMGVIGQDSFGQQ
YEIC_ECOLI      ----VVIIGSANIDVA------GYSHESLNYADIKFTPGGVGRNIAQNLALLGNKAWLLSAVGSDFYGQS
IOLC_LISMO      --------------------------------------GGSPANIAIGTAKLGLKVGFIGKISDDQHGRF
IOLC_LISMH      --------------------------------------GGSPANIAIGTAKLGLKVGFIGKISADQHGRF
IOLC_LISMF      --------------------------------------GGSPANIAIGTAKLGLKVGFIGKISADQHGRF
IOLC_LISMC      --------------------------------------GGSPANIAIGTAKLGLKVGFIGKISADQHGRF
IOLC_CLOPE      --------------------------------------GGSPANIAVGLARLGKKVGFIGKVSDDRFGEF
IOLC_CLOP1      --------------------------------------GGSPANIAVGLARLGKKVGFIGKVSDDRFGEF
YEII_ECOLI      ------VVGTINMD-IRGMADIRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDFYGEM
IOLC_LISIN      --------------------------------------GGSPANIAIGTAKLGLKVGFIGKISDDQHGRF
IOLC_CLOTE      --------------------------------------GGSPGNIAVGLARLGKKVGFLSTVSDDQFGNF
SCRK_VIBAL      --------------------------------------GGAPANVAVAIARLSGKSAFFGRVGDDPFGRF
ADK_PHYPA       ---------TLNNAILAEDKHLPMYKELAANPDVEYIAGGATQNTIRIAQGESNATSYFGCVGKDEYGDR
IOLC_PHOPR      --------------------------------------GGSAANIAVAISKLGGKVGFIGCVADDAFGGY
IOLC_CLOBA      --------------------------------------GGSPANIAVGLSRLGKKVGFIGKVSKDQFGKF
YIHV_ECOLI      -------------------------------------------------------VDFIGRVGDDDTGNS
Y406_METJA      ---KITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
IOLC_CLOB8      --------------------------------------GGSPANIAVGLARLGKKIGFIGKVSKDQFGEF
IOLC2_BACCZ     --------------------------------------GGSPANIAIGATRLGLQTGFIGKVSDDQMGRF
IOLC_MYCH7      --------------------------------------GGSAANIAIGLSRLKNKVGFFGSVSDDQFGNF
IOLC_MYCH2      --------------------------------------GGSAANIAIGLSRLKNKVGFFGSVSDDQFGNF
YURL_BACSU      --------------------------------------GGNALNVAVLAKRLGHESSYIGIVGNDEAAAH
IOLC_MYCHJ      --------------------------------------GGSAANIAIGLSRLKNKVGFFGSVSDDQFGNF
Y1544_METTH     -------VGHTAFDYIIHLDEFPEPNTSTAIKRMRNLHGGAAANVALVGSRLGLRTSLVSAVGGDFEGSE
HLDE_ACTSZ      ---KVLVLGDVMLDTNRISPEAPVPVVRVKKHEERAGGA---ANVAMNIASLNVPVRLLGLTGDDEAGNA
IOLC_BACHK      --------------------------------------GGSPANIAIGAARLGLQTGFIGKVSDDQMGRF
IOLC_BACAN      --------------------------------------GGSPANIAIGAARLGLQTGFIGKVSDDQMGRF
IOLC_BACAC      --------------------------------------GGSPANIAIGAARLGLQTGFIGKVSDDQMGRF
IOLC_BACAA      --------------------------------------GGSPANIAIGAARLGLQTGFIGKVSDDQMGRF
IOLC1_BACCZ     --------------------------------------GGSPANIAIGAARLGLQTGFIGKVSDDQMGRF
HLDE_BLOPB      -------------------PEAPVP--IVKVNKIIDRPGG-AANVAMNIASLGARSRLLGLTGVDEAAKI
HLDE_ACTP2      ---KVLVLGDVMLDTNRISPEAPVP--VVKVQDIEERAGG-AANVAMNIASLSVPVALHGLIGQDDAGRA
K1PF_HAEIN      MASVVTITLNAAYDLVGRLNRI-QLGEVNTVETLGLFPAGKGINVAKVLKDLGVNVAVGGFLGKDNSADF
IOLC_CLOBB      --------------------------------------GGSPANIAVGLSRLGKKVGFIGKVSKDQFGKF
HLDE_SALDC      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANVRLVGLTGIDDAARA
HLDE_ARCB4      ----ILVIGDLMIDHYLRIPEAPVQVVNVKKESSVLGGAGNVINNLFTLGTT---VDVISVIGDDNVANE
HLDE_GEOMG      ------VIGDLMLDEYLRIPEAPVQVLDVTREEVRIGGAGNVANNLVALGCRVSVASVVGG---DENGTI
HLDE_GEOLS      ---KCLVVGDLMLDEYLRIPEAPVQVVDVLREDLRLGGAGNVANNLLALG---CQVTVASVIGEDENGWA
HLDE_CAMC5      ----------------------------------------------------------LGGAGNVVQNLL
IOLC_BACC3      --------------------------------------GGSPANIAIGASRLGLQTGFIGKVSDDQMGRF
IOLC_BACAH      --------------------------------------GGSPANIAIGASRLGLQTGFIGKVSDDQMGRF
HLDE_SALTY      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALTI      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALSV      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALPK      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALPC      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALPB      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALPA      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALNS      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALHS      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALG2      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALEP      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALCH      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SALA4      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_HAEIE      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVSVQLMGLIGQDETGSA
HLDE_HAEI8      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVSVQLMGLIGQDETGSA
HLDE_GEOSL      ------VIGDLMLDQYLRIPEAPVQVVDVTREEIRIGGAGNVANNLVALGCRVSVASVVGG---DENGTI
ADK1_ARATH      ----------LNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQN-SIKVAQWMLQVSYMGSIGKDKYGEA
HLDE_SULDN      -------------------------------------------------------VSVSGVIGNDENGVE
HLDE_CITK8      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGANSRLVGLTGIDDAARA
HLDE_ACTPL      ---KVLVLGDVMLDTNRISPEAPVP--VVKVQGIEERAGG-AANVAMNIASLSVPVALHGLIGQDDAGRA
K1PF_SHIFL      -------------------------GEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGGFLGKDNQDGF
K1PF_ECOLI      -------------------------GEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGGFLGKDNQDGF
K1PF_ECOL6      -------------------------GEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGGFLGKDNQDGF
K1PF_ECO57      -------------------------GEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGGFLGKDNQDGF
HLDE_NITSB      MKPRILVLGDVMIDHYLRIPEAPVQVVDVQKEELVLGGAGNVVNNLLAFG---AEVGIISVVGEDANGIW
Y1459_PYRHO     --------------------------------------GGAPANVAVGVSRLGVKSSLISKVGNDPFGEY
IOLC_LACCA      --------------------------------------GGSPANIAIGSAKLGQKVGFIGKVSDDQLGHY
HLDE_SALAR      -------------------PEAPVP--VVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_MANSM      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVPVQLLGLTGLDETGKA
HLDE_DICNV      -------------------PEAPVPVVNIEQQ---TATAGGAANVAMNIAALGGQVYLCGLIGDDDAGAV
HLDE_HAEIG      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVPVQLMGLIGQDETGSA
Y057_BUCAP      ----------------------------------------------------------------------
IOLC_GEOTN      --------------------------------------GGSPANIAIGMARLGMKTGFIGRVADDQMGRF
Y060_BUCAI      ---------------------------------------GGAANVAKNIAEIGGYTKIVGFIGMDNEGLI
HLDE_ENT38      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAHSRLVGLTGIDDAARA
IOLC_GEOKA      --------------------------------------GGSPANIAIGMARLGMKTGFIGRVADDQMGRF
HLDE_KLEP3      ----------------------------------------------------------------------
SCRK_ECOLX      MSAKVWVLGDAVVDL------LPESDGRLLP-----CPGGAPANVAVGIARLGGTSGFIGRVGDDPFGAL
LACC_LACLA      ------------------------PLETLKIDDVSKTAGGKGLNVTRVLYESGDKVTATGFLGGKI-GEF
HLDE_SHEPA      ---KVLVVGDVMLDTARISPEAPVP--VVKVEQLEDRPGG-AANVAINIATLGGSASLAGIVGVDETADA
HLDE_ECOHS      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
IOLC_BACHD      --------------------------------------GGSPANIVIGSSKLGLKAGFIGKIADDQHGRF
HLDE_SHISS      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SHIF8      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SHIBS      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SHIB3      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_KLEP7      ----------------------------------------------------------------------
HLDE_HAEDU      ---KVLVLGDVMLDTNRISPEAPVP--VVKVKDMEERAGG-AANVAMNIASLNATVALHGLVGHDDAGCV
HLDE_ECOUT      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOSM      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOSE      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOLU      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOLI      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOLC      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOL6      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOL5      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOK1      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECODH      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECOBW      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO8A      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO81      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO7I      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO5E      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO57      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO55      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO45      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO27      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_ECO24      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_DESAA      -SCRVLVVGDMMIDEYLRIPEAPVQVVEVKKTTSTLGGAGNVVNNALGAKVSVAGVMGGGKAGDLLNGKL
HLDE_SHIFL      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_HAES1      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVPVRLLGLTGKDEAARA
IOLC_BACSU      --------------------------------------GGSPANIAIGSAKLGLKAGFIGKIPDDQHGRF
HLDE_ESCF3      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARA
HLDE_SHEHH      ---KVLVVGDVMLDTARISPEAPVP--VVKVEQLEDRPGG-AANVAINIATLGGSASLAGIVGEDETADA
HLDE_SHEFN      -------------------PEAPVP--VVKINQIEDRPGG-AANVALNIATLGGHVQLAGIVGQDETAQA
HLDE_MAGSM      ----VLVVGDLMLDRYLRIPEAPVPVVHMQRESHRCGGA---ANVASNLAKLGLHTSIVGFVGEDSDGQV
HLDE_HAEIN      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQENEERAGG-AANVAMNIASLNVPVQLMGLIGQDETGSA
HLDE_SHIDS      -------------------PEAPVP--VVKVNTIEERPGG-AANVAMNITSLGANARLVGLTGIDDAARA
HLDE_PELCD      ---RALVIGDLMLDEYLRIPEAPVQVVDVVREDLRLGGAGNVINNLVTLG-CQVHVASVLGEGHD--GLL
HLDE_ENTS8      ----------------------------------------------------------------------
IOLC_BACLD      --------------------------------------GGSPANIAIGSSKLGLKTGFIGKIPDDQHGRF
HLDE_PSEHT      ----------------------------------------------------------------------
HLDE_COXBN      ----------------------------------------------------------------------
ADK_HUMAN       --------------------------------------------------------TFFGCIGIDKFGEI
ADK2_ARATH      --------------------------------------------------------SYMGSIGKDKYGEA
HLDE_PSEU2      -------------------PEAPVP--VVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAES
HLDE_SHESR      ----------------------------------------------------------------------
HLDE_SHESM      ----------------------------------------------------------------------
HLDE_SHESA      ----------------------------------------------------------------------
HLDE_COXBU      ----------------------------------------------------------------------
HLDE_COXBR      ----------------------------------------------------------------------
PDXK_DICDI      ----------------------------------------------------------------------
HLDE_SHESW      ----------------------------------------------------------------------
HLDE_SHEPC      ----------------------------------------------------------------------
HLDE_SHEB8      ----------------------------------------------------------------------
HLDE_PSE14      -------------------PEAPVP--VVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAES
HLDE_SHEB9      ----------------------------------------------------------------------
HLDE_SHEB5      ----------------------------------------------------------------------
HLDE_SHEB2      ----------------------------------------------------------------------
HLDE_PROMH      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGANSRLVGLTGIDEAAKA
HLDE_HELAH      ---KILVIGDLIADYYLLSPEAPVPILEVKKESKSLGGAANVANNLISLG---AQVFLCGVVGDDLEGKH
HLDE_PSESM      -------------------PEAPVP--VVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAES
HLDE_MARAV      ---------------------------------------GGAANVARNIAHLDGQAAILGIIGNDTDGRL
ADK_RAT         --------------------------------------------------------TFFGCIGIDKFGEI
SCRK_SALTY      ---------------------------------------------------------FIGAVGGDPFGRY
LACC_STRSV      ------------------------PLEELKIDEVSKTAGGKGLNVTRVLAEIGDNVAATGLIGG-TNGEF
HLDE_PHOLL      ----------------------------------------------------------------------
IOLC_BACA2      --------------------------------------GGSPANIAIGSAKLGLKAGFIGKIPDDQHGRF
HLDE_SODGM      -------------------PEAPVP--IVKVDAIEERPGG-AANVAMNIAALGCHSRLVGLTGIDDAARA
HLDE_SHEDO      ----------------------------------------------------------------------
ADK_MOUSE       --------------------------------------------------------TFFGCIGIDKFGEI
HLDE_VIBVY      ---------------------------------------GGAANVAMNIASLGGHARIVGLTGMDEPAKV
KDGK_HAEIN      --------------------------------------GGDTLNSATYLSRVSSQVHYVSALGTDNLSKQ
HLDE_PSEPF      ----------------------------------------------------------------------
HLDE_HELHP      ----------------------------------------------------------------------
ADK_CRIGR       --------------------------------------------------------TFFGCIGIDKFGEI
LACC_STRU0      -------LDVFNLDTVNRV------AETHKTP------GGKGLNVTRVLSQVGDDVLATGLLGGKI-GEF
K1PF_BACSU      --------------------------------------GGKGIN--VSRLLKRHHVAFVGGF----TGEY
HLDE_YERPY      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPS      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPP      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPN      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPG      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPE      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPB      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERPA      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_YERP3      -------------------PEAPVP--VVKVDTIEERPGG-AANVAMNIASLGAVARLVGLTGIDDAARA
HLDE_SHELP      ----------------------------------------------------------------------
INGK_ECOLI      ----------------------------------------------------------------------
INGK_ECOL6      ----------------------------------------------------------------------
INGK_ECO57      ----------------------------------------------------------------------
HLDE_PSEU5      ----------------------------------------------------------------------
HLDE_PSEF5      ----------------------------------------------------------------------
HLDE_ERWCT      ----------------------------------------------------------------------
HLDE_EDWI9      -------------------PEAPVP--VVKVETIEERPGG-AANVAMNIASLGASARLVGLTGVDDAARA
THIED_GEOSL     ----------------------------------------------------------------------
HLDE_PELPD      ------VIGDLMLDEYLRIPEAPVQVVDVVREEMRLGGAGNVVNNLVELG---AEVTVCSVVGDDDNGQA
HLDE_VIBVU      ---------------------------------------GGAANVAMNIASLGGHARIVGLTGMDEPAKV
HLDE_VIBSL      ---------------------------------------GGAANVAMNIASLGGHAHIVGLTGKDEPAEV
ADK_TOXGO       --------------------------------------------------RKPGSAGYMGAIGDDPRGQV
SCRK_SALTH      ----------------------------------------------------------------------
HLDE_VIBFM      ---------------------------------------GGAANVAMNIAALGGDAHLVGLVGEDEPAQA
HLDE_PHOPR      ----------------------------------------------------------------------
SCRK_RHILT      --------------------------------------GGAIFNTAIALGRLGIPTAFFTGIADDMMGEI
HLDE_HAHCH      -NSRVVVVGDVMLDTSRISPEAPVP--VVKVEQLEDRPGG-AANVALNIAALGSAAVILGVTGKDEAAQS
HLDE_GEOBB      ----------------------------------------------------------------------
HLDE_SHESH      ---KVLVVGDVMLDRYWRIPEAPVP--VVKISQIEDRPGG-AANVALNVATLGGQVSLAGIVGKDEAADA
YZ37_SYNY3      ------------------------------------SSGGSAANTLVSLAQLGGTGFYACKVGKDEAGAF
LACC_STAHJ      --------------------------------------GGKGLNVTRVLSEFGENVLASGFLGGAL-GQF
HLDE_VIBF1      ---------------------------------------GGAANVAMNIAALGGDAHLVGLVGEDEPAQA
HLDE_AERHH      ----------------------------------------------------------------------
HLDE_PASMU      ---KVLVLGDVMLDTNRISPEAPVP--VVRVQDNEERAGG-AANVAMNIAALNVPVKLLGLTGRDETGLA
HLDE_ERWT9      ----------------------------------------------------------------------
HLDE_YERE8      ----------------------------------------------------------------------
HLDE_METCA      ----------------------------------------------------------------------
HLDE_AERS4      ----------------------------------------------------------------------
Y1655_HAEIN     ----------------------------------------------------------------------
HLDE_PECCP      ----------------------------------------------------------------------
HLDE_CAMFF      ----------------------------------------------------------------------
THID_MYCTU      ----------------------------------------------------------------------
THID_MYCBO      ----------------------------------------------------------------------
LACC_STRPC      ------------------------PLDELKCDDVTKTPGGKGLNVSRVLNDFGETVKATGCVGGE-SGDF
LACC_STRPB      ------------------------PLDELKCDDVTKTPGGKGLNVSRVLNDFGETVKATGCVGGE-SGDF
HLDE_RHOP5      -------------------PEAPAPVIAAQRSEIDVGGAG---NVARNIASLGARCVFIGLVGDDDAGRT
LACC_STRPM      -------LNELKCDTVNRVV------------DVTKTPGGKGLNVSRVLNDFGETVKATGCIGGE-SGDF
LACC_STRPD      -------LNELKCDTVNRVV------------DVTKTPGGKGLNVSRVLNDFGETVKATGCIGGE-SGDF
LACC_STRA5      -------LENFNMDTVNRVT------------DVSKTPGGKGLNVTRVLSQLGDNVVATGLLGGDF-GDF
LACC2_STRA3     -------LENFNMDTVNRVT------------DVSKTPGGKGLNVTRVLSQLGDNVVATGLLGGDF-GDF
HLDE_WOLSU      ---------------------------------------GGACNVMSNLIALEASVLSCGVVGEDLAGRE
HLDE_SERP5      ----------------------------------------------------------------------
PYRH_META3      -----------------------------------VVGGGNTARTYISVAREFANESFCDEIG--ILATR
LACC_STAAR      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
HLDE_AZOVD      ----------------------------------------------------------------------
Y1336_METJA     ----------------------------------------------------------------------
PDXK_SHEEP      ----------------------------------------------------------------------
PDXK_BOVIN      ----------------------------------------------------------------------
THID_STAAR      ----------------------------------------------------------------------
HLDE_PSEFS      -------------------PEAPVP--VVKVEQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAES
PYRH_METMP      -----------------------------------VVGGGNTARQYISVAREFANESFCDEIG--ILATR
PDXK_HUMAN      ----------------------------------------------------------------------
LACC1_STRA3     ------------------------PLDVFKMDEVSKTAGGKGLNVTRVLAEIGDNVAATGLIGG-TNGHF
HLDE_SHEPW      ----------------------------------------------------------------------
HLDE_NITOC      ----------------------------------------------------------------------
FRLD_ECOLI      --------------------------------------GGNAVNVAVYCTRYGIQPGCITWVGDDDYGTK
ADK_DICDI       ---------------------LPLYGE-IKSGKVEYIPGGAAQNTSRVCQKDKQTVCYTGCVGTDENATI
THID_STAAW      ----------------------------------------------------------------------
THID_STAAS      ----------------------------------------------------------------------
THID_BACSU      ----------------------------------------------------------------------
PYRH_METM7      -----------------------------------VVGGGNTARQYISVAREFTNESFCDEIG--ILATR
PYRH_METM5      -----------------------------------VVGGGNTARQYISVAREFTNESFCDEIG--ILATR
PDXK_PIG        ----------------------------------------------------------------------
LACC_STRA1      -------LENFNMDTVNRVT------------DVSKTPGGKGLNVTRVLSQLGDNVVATGLLGGYF-GDF
HLDE_SHEON      ----------------------------------------------------------------------
HLDE_CAMJ8      ----------------------------------------------------------------------
HLDE_ALISL      ----------------------------------------------------------------------
AK3_BACSU       -------------------------------------------------------------------GRR
SCRKL_DICDI     ----------------------------------------------------------------------
LACC_STAEQ      -------LDQFNLDTVNRVSQTSK------------TAGGKGLNVTRVLSEFGEDVIFLGGLGQYIEEQI
LACC_ENTFA      ----------------------------------------------------------------------
IOLC_BACSK      --------------------------------------GGSPANIAIGSAKLGLKVGFVGKIPDDQHGRF
PYRH_METM6      -----------------------------------VVGGGNTARQYISVAREFTNESFCDEIG--ILATR
PDXY_VIBF1      ----------------------------------------------------------------------
PDXK_MOUSE      ----------------------------------------------------------------------
LACC_STRP3      ------------------------PLDELKCDDVTKTPGGKGLNVCRVLNEFGETVKATGCIGGE-SGDF
LACC_STAAB      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
HLDE_PSEPK      ----------------------------------------------------------------------
HLDE_PSEPG      ----------------------------------------------------------------------
HLDE_PSEP1      ----------------------------------------------------------------------
THID_AQUAE      ----------------------------------------------------------------------
LACC_STRPG      ------------------------PLDELKCDDVTKTPGGKGLNVCRVLNDFGETVKATGCIGGE-SGDF
LACC_STAES      -------LDQFNLDTVNRVSQTSK------------TAGGKGLNVTRVLSEFGEDVIFLGGLGQYIEEQI
LACC_STAAW      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAT      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAS      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAN      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAM      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAE      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAAC      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAA9      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAA8      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAA3      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAA2      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
LACC_STAA1      ------------------------PLTALKLDDVNKTAGGKGLNVTRVLAQVGEPVLASGFIGGEL-GQF
FTSY_RICPR      ----------------------------------------------------------------------
DNLJ_RICAE      ------------------------------------AGSLRQLDSSITAKRPLKYFVYSGGVTEQSSQDQ


                         .         .         *         .         .         .         .:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
RBSK_ECOLI      VRQQLATDNIDITPVSVIKESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
RBSK_ECO57      VRQQLATDNIDITPVSVIKESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLE
RBSK_HAEIN      MKNAFAQEGIDTTHINTVSEMTGMAFIQVAKSSENSIVLASGANSHLSEMVVRQSEAQIAQSDCLLMQLE
RBSK_SCHPO      MLSGLXXXXXXXXXXXXINKSTGVAMIIVEETGENRILLSEGANGNVDTAFVKAMEQRISTCNLLIMQLE
RBSK_LACLA      ILQNFKENAVLFENVGTVPQTTGIAQITLYDD-DNRIIIIPGANNEVLPSYLADLWEKIKESQLVILQNE
RBSK_BACSU      ILNNLKANGVRTDYMEPVHTESGTAHIVLAE-GDNSIVVVKGANDDITPAYALNALEQIEKVDMVLIQQE
RBSK_BACHD      LTENLAKEGIITDSVKPVTDCTSGVATILLSDRDNRIIVTKGANEHVTPDYVAAFEQELAASDVVLLQLE
RBSK_MOUSE      YIENLKQNHISTEFTYQTRDATGTASIIVNNEGQNIIVIVAGANLFLNSEDLKKAASVISRAKVMICQLE
RBSK_HUMAN      YIENLKQNDISTEFTYQTKDATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLE
RBSK_DICDI      TLKNFKDKNINCEFVSVVNVPSGCATXXXXXXXXXXXXXXXXXXXLLNEKDVDNAKSQIQNSSLLLCQLE
RBSK_YEAST      LKDTLSDCGVDITHVGTYEGNTGTATILIEEGGQNRILIVEGANS--KTIYDPKQLCEIEEEEYVVFQHE
SCRK5_ARATH     LVNILKKNGVNSEGVCDTNARTALAFVTLKKDGEREFMFYRNADMLLKESELNKDL--IKKAKIFISLIS
SCRK2_SOLHA     LAGILKTNGVQADGI-NFDKGTALAFVTLRADGEREFMFYRNPSADMLLTPAELNLDLIRSAKVFISLIV
SCRK1_ORYSI     LAAILRXXXXXXXXXXDAGARTALAFVTLRADGEREFMFYRNPSADMLLTHAELNVELIKGSISLIAEHL
SCRK1_ORYSJ     LAAILRXXXXXXXXXXDAGARTALAFVTLRADGEREFMFYRNPSADMLLTHAELNVELIKGSISLIAEHL
SCRK2_SOLLC     LAGILKTNGVQAEGI-NFDKGTALAFVTLRADGEREFMFYRNPSADMLLTPAELNLDLIRSAKVFISLIV
SCRK3_ARATH     LAGILRKNGVDDQGI-NFDEGTALAFVTLRSDGEREFMFYRNPSDELNLELIRSAKVFHYGSISLITEHM
SCRK1_MAIZE     LAAILRXXXXXXXXXX-FDSGTALAFVTLRADGEREFMFYRNPSADMLLTADELNVELIKGSISLIAEHL
SCRK2_ARATH     LAGILRKNGINFDKGAR----TALAFVTLRSDGEREFMFYRNPSDELNLELIRSAKVFHYGSISLITEHM
SCRK4_ARATH     LAGILKQNGVSAEGIFDTGARTALAFVTLRSDGEREFMFYRNPSDELNLDVIRSAKVFHYGSISLIV--E
SCRK1_ARATH     LAGILRKNGVDDQGIFDTGARTALAFVTLRADGDREFMFYRNPSADMLLRPDELNLDLIRSAKVFISLIV
SCRK_SOLTU      LAGILKTNGVQADGI-NFDKGTALAFVTLRADGEREFMFYRNPSADMLLTPDELNLDLIRSAKVFISLIV
SCRK2_ORYSJ     LVDILKKNGVNAEGLFDEHARTALAFVTLKSNGEREFMFYRNPSADMLLTEAELNLDLIRRAKIFISLIT
SCRK2_ORYSI     LVDILKKNGVNAEGLFDEHARTALAFVTLKSNGEREFMFYRNPSADMLLTEAELNLDLIRRAKIFISLIT
SCRK2_MAIZE     LVNILKQNNVNAEGLFDKHARTALAFVTLKHDGEREFMFYRNPSADMLLTEAELDLGLVRRARVFISLIS
YDJE_BACSU      LKRTL--DAVHVDTVMDEKAPTTLAFVSLKQNGERDFVFNRGADALFTLEDIQEKLNEAKSDPFCSAYLR
YDJH_ECOLI      ILDHCRKENIDIQSLKQVSIDTSINVGLVTEDGERTFVTNNGSLWKLNIDDVDFARFSQAKLLSLASIFN
KDGK_BACSU      ILQELKKEGVDVSRVSKVKEGDPQVTYYRKNSAASTLTTYFQCAGHLHVTGIPPALSEMKDFTYHVMN--
Y356_ARCFU      LLADFEREGVSTDFVIRAEGRSGTAMIFVDEKGNRAILVDPGVNDTIAYDEID--VDSARKYDLILTSFK
K6PF2_ECOLI     LVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGS
HLDE_THICR      LNQVLEQAGVASNWVYSESGTICKLRVLSHHQQLIRMDFENAVPELSAKSLAKLVAEKVADYDVLVISAK
YEIC_ECOLI      LLTQTNQSGVYVDKCLIVGENTSSYLSLLDNTGEMLVAINDNISNAITAEYLAQHGEFIQRAKVIVADCN
IOLC_LISMO      IEKYMRDLAINTDGMVKDTEGVGLAFTEIKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLALAQ
IOLC_LISMH      IEKYMRDLSINTDGMVKDTEGVGLAFTEIKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLALAQ
IOLC_LISMF      IEKYMRDLSINTDGMVKDTEGVGLAFTEIKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLALAQ
IOLC_LISMC      IEKYMRDLSINTDGMVKDTEGVGLAFTEIKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLALAQ
IOLC_CLOPE      VVNYFKKEGIDVSEIAKNGESLGLTFTEILSPTESSILMYRNGIAXXXXXXXXXXXXYIKNTKAIVALAM
IOLC_CLOP1      VVNYFKKEGIDVSEIAKNGESLGLTFTEILSPTESSILMYRNGIAXXXXXXXXXXXXYIKNTKAIVALAM
YEII_ECOLI      LLEETRRAGVNVSGCVRLHGQSTSTYLAIANRDDQTVLAINDTHEQLTPQLLNGSRDLLRHAGVVLADCN
IOLC_LISIN      IEKYMRDLNINTDGMVKDTAGVGLAFTEIKSPEECSILMYRENVADLYLTPEEISEDYIKETRVLLALAQ
IOLC_CLOTE      VVNYLKNEGIDISQIAKNGEKLGLTFTEILSPKESSILMYRKGIADLQLSSKEVSEDYIKSAKAIVALSK
SCRK_VIBAL      MQSILDQEGVCTEFLIKDPEQTSTVVVDLDDQGERSFMVKPSADQFMSV----EDMGNFKQGDWLHVANE
ADK_PHYPA       MFKLASEGGVNIRYDVDEDLPTGTCGVLVVK-GERSLVANLSAANKYKIAFVEKAKYIYSAGFFLTVSPE
IOLC_PHOPR      VRGYMTEQGINLDGMMTDNSGS-RTSVAFTEMKPNDCTVLIYRNKASDLTLKPEQVDPIAQSKMLVALSE
IOLC_CLOBA      VVDYFNNEGIDTSQIAENGESLGLTFTEIASPTESSILMYRNGIADLELDVNEIDEEYIKNTKAIVALAK
YIHV_ECOLI      LLAELESWGVNTRYTKRYNQASSQSAIMVDTKGERIIINYPSPDLLPDAEWLEEI--DFSQWDVVLADVR
Y406_METJA      YERYLKNLDINISKLYSEEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEIGDPEFNLKCAK
IOLC_CLOB8      VVNYFDNEGIDTSQISKNGENLGLTFTEIASPTESSILMYRQGIADLELNVDEIDEEYIKNTKAIVALAK
IOLC2_BACCZ     ITRYLQDNNINTDQICIDRTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC_MYCH7      VLNVFENEKIDISHIKKTKDKLGLTFTEMLSEEKSTILMYRDNVADLQIDVSDIDLDYILRTKILVISGT
IOLC_MYCH2      VLNVFEKEKIDISHIKKTKDKLGLTFTEMLSEEKSTILMYRDNVADLQIDVSDIDLDYILRTKILVISGT
YURL_BACSU      LLNVLKLEQVNADYIRQAHGENGMAIVTLDEQGDRIFVNKGGIQSRLRLAFQEKDVSFISGHDLLHTSVY
IOLC_MYCHJ      VLNVFENEKIDISRIKKTKDKLGLTFTEMLSEEKSTILMYRDNVADLQIDVSDIDLDYILRTKILVISGT
Y1544_METTH     YRELLESSGIDIESILVADESTPTAFVMTDSDHNQISYFYWGAARYFKDA--ETPADAIKSARAVHLATG
HLDE_ACTSZ      LTGLLEKQKICCDTITKLRILSRHQQLLRLDFEEN----FNNVHSDNLLTKLESAVKNV--GALILSDYK
IOLC_BACHK      ITGYLKDNKINTDQIPIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC_BACAN      ITGYLKDNKINTDQIPIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC_BACAC      ITGYLKDNKINTDQIPIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC_BACAA      ITGYLKDNKINTDQIPIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC1_BACCZ     ITGYLKDNKINTDQIRIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
HLDE_BLOPB      LKKQLNESNIKWNFISVR---TCPTIIKLRVMSRNQQLIRLDFEQYFNNVDTTKLLKQVKYKVLVLSDYK
HLDE_ACTP2      LDKLLNSHNIQNHCVALDSHPTTKLRILSRHQQLLRLDFEEGFHHVASDSLLAKLEQEITAYGALILSGK
K1PF_HAEIN      E-QMFNQHGLE----DKFHRVDGKTRINVKTETEADVTDLNFLGYQISPQVWQQFVTDCLNYDIVAVCGS
IOLC_CLOBB      VVDYFDNEGIDTSQIAENGESLGLTFTEIASPTESSILMYRNGIADLELDVNEIDEEYIKNTKAIVALAK
HLDE_SALDC      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFGGDPQPLHERINQGSIGALVLSDYA----K
HLDE_ARCB4      LKSLLEKIKISTSNIVENNRKTSKKSRLI--ASQQQVLRYDDINEESHKKIISNLEKNIKKSSIILSDYG
HLDE_GEOMG      LLHAFSGKGVDVSGVFEDPQRTTSRKTRVVAANQQIVRIDRESRDPIGAGYEEKIVGFLRESDYLKGVLT
HLDE_GEOLS      LLKAFSRQGVDTAPIQEPGRRTGRKTRVIA-ANQQIVRIDRESREPLSGQIEQQLINWLQQSDYLKGVL-
HLDE_CAMC5      ALSVVGDDEVGLRIKNMLSEGAGGGLILSEKGRESSIVVRIDKESAVKSELVQKVTENLKNSVVLLSDYG
IOLC_BACC3      ITGYLKDNKINTDQIHIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
IOLC_BACAH      ITGYLKDNKINTDQIHIDCTGTGLAFTEIKSPEDCSILMYRDNVADLNLDPTEVSEDYIKQSKLLISGTA
HLDE_SALTY      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALTI      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALSV      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALPK      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALPC      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALPB      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALPA      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALNS      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALHS      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALG2      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALEP      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALCH      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_SALA4      LSKTLAEVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALGSIVLSDYAK
HLDE_HAEIE      LSLLLEKQKIDCNFVALETHPTITKLRILSR------------HQQLLRLDFEEDFNNVDCKD-LLAKLE
HLDE_HAEI8      LSLLLEKQKIDCNFVALETHPTITKLRILSR------------HQQLLRLDFEEDFNNVDCKD-LLAKLE
HLDE_GEOSL      LLHAFSGKGIDVTGIVEDPSRTNQQIVRIDRESRDEI----GPDNERRIVDYLNAHGDILVSDYLKGVLT
ADK1_ARATH      MKKDATAAGVYVHYYEDEATPTGTCGVCVL-GGERSLIANLSAANCYKVEHLKKPENWAKAKFYYIAGFF
HLDE_SULDN      LLKLLREIDVNVDNIV-IQEGRKTSKKSRVIAASQQILRYDXXXXXXXXVILNSLAKDISRYDAVVLSDY
HLDE_CITK8      LSKTLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPLPLHERINQALGSIVLSDYAK
HLDE_ACTPL      LDKLLNSHNIQNHCVALDSHPTTKLRILSRHQQLLRLDFEEGFHHVASDSLLAKLEQEITAYGALILSGK
K1PF_SHIFL      Q-QLFSELGI-ANRFQVVQGRTRINVKLTEKDGEVTDFNFSGVTPADWERFVTDSLSWLGQFDMVCVSGS
K1PF_ECOLI      Q-QLFSELGI-ANRFQVVQGRTRINVKLTEKDGEVTDFNFSGVTPADWERFVTDSLSWLGQFDMVCVSGS
K1PF_ECOL6      Q-QLFSELGI-ANRFQVVQGRTRINVKLTEKDGEVTDFNFSGVTPADWERFVTDSLSWLGQFDMVCVSGS
K1PF_ECO57      Q-QLFSELGI-ANRFQVVQGRTRINVKLTEKDGEVTDFNFSGVTPADWERFVTDSLSWLGQFDMVCVSGS
HLDE_NITSB      LEQRFQEKGVQTYLLKENRPTTKKSRIIA--SNQQIVRVDREEKKEIESLTQQKILNVF---DRVIKEYD
Y1459_PYRHO     LIEELSKENVDTRGIVKEKKHTGIVFVQL-KGASPSFLLYD------DVAYFNMTLNDINVEEAKIVNFG
IOLC_LACCA      VTQYMASVGIDTSNMVKDDTGIGLTFTEIISPEESDILMYRNAHEVSRAYLAQTKMTGLAQSPSRXXXXX
HLDE_SALAR      LSKTLAEFNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPEPLHERINQALGSIVLSDYAK
HLDE_MANSM      LTTLLQTQKIDCDFVRLATHPTITKLRILSRHQQLLRLDFEEDFKNVQSTELLTKLNAVKNFGALILSDK
HLDE_DICNV      LRQIMREHAIGLPTITKLRVLSQHQQLIRLDFESNRY-----AECAHLMAVPFNRA--LPEHDLVIFSDY
HLDE_HAEIG      LSLLLEKQKIDCNFVALETHPTITKLRILSR------------HQQLLRLDFEEDFNNVDCKD-LLAKLE
Y057_BUCAP      ----------------------------------------------------------------------
IOLC_GEOTN      IVQYLKNNGIDTSHVITDKSGTGLAFTEIKSPTDCSILMYRDNVADLKLEPNDIHEDYIRQAKCLLALAK
Y060_BUCAI      LKKLMDHIRIDSDLISXXXXXXXXXXRILSEKKQLIRVDFQEKYISNKNNLLQKIIDSISSFKILVLSDY
HLDE_ENT38      LSKTLADVNVKCDFVSVPTHPT---ITKLRVLSRNQQLIFEGVDPEPMHERIAQALGSI-GALVLSDYAK
IOLC_GEOKA      IVRYLKNNGIDTSHVITDKSGTGLAFTEIKSPTDCSILMYRDNVADLKL-----EPNDI-DEDYITALAK
HLDE_KLEP3      ----------------------------------------------------------------------
SCRK_ECOLX      MQRTLLTEGVDITYLKQDEHRTSTVLVDLNDQGERSFMVRPSADLFLETTDLPCWRHGEWLHLCSIALSA
LACC_LACLA      IESELEQSPVS-PAFYKISGNTRNCIAILHEGNQTEILEQGPTSHEEAEGFLDHYSNLIKQSEVVTISGS
HLDE_SHEPA      LTVGVRALGVEPNTITKLRVMSRNQQLLRLDFEESY-------SQAESDALLAQSLSELDKVDVAVSDYA
HLDE_ECOHS      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
IOLC_BACHD      IESYMRGVGVDTSNLVVDQEGTGLAFTEIKSPEECSILMYRQADLYLSPEEVNEAY--IRRSKLLLALSK
HLDE_SHISS      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_SHIF8      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_SHIBS      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_SHIB3      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_KLEP7      ----------------------------------------------------------------------
HLDE_HAEDU      LDMLLKNHHIQNHCITLDSHPTITKLRILSRHQQLLRLDFEESFHNVESSLLAKLQQQITGYGALILSDK
HLDE_ECOUT      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOSM      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOSE      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOLU      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOLI      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOLC      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOL6      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOL5      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOK1      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECODH      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECOBW      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO8A      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO81      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO7I      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO5E      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO57      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO55      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO45      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO27      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_ECO24      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_DESAA      TALGVNTEGLLVDQGRATTRGANQQMLRIDRESKQEI------SEEQVQAIVRFAQNQIPQCDLVIASDY
HLDE_SHIFL      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPMHERINQALSSIVLSDYAK
HLDE_HAES1      LMQLLEKQSIHCDFTQLDSHPTTKLRILSRHQQLLRLDFEEDFNNITSADLLRKLESAVQNYGALILSDK
IOLC_BACSU      IESYMRKTGVDTTQMIVDQDGAGLAFTEILSPEECSILMYRDDVADLYLEPSEVSEDYIANAKMLLALAK
HLDE_ESCF3      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_SHEHH      LTLGIQTLGVEPNTITKLRVMSRNQQLLRLDFEESY-------TQAESEALLAKTLPELDKVDVAVSDYA
HLDE_SHEFN      LTQGVKVFGVEPQWLTVADKPTITKLRVLSRNQQLIRLDFEATSQALQSEAILDNVDVLVLSDYAKGAID
HLDE_MAGSM      LISALQESGIDTHGILPLTRVIGGHQQILRMDRETPLADTAHASQLLHQQVMPMLEGEQRPHVIILSDYA
HLDE_HAEIN      LSLLLEKQKIDCNFVALETHPTITKLRILSR------------HQQLLRLDFEEDFNNVDCKD-LLAKLE
HLDE_SHIDS      LSKSLADVNVKCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFEGVDPQPLHERINQALSSIVLSDYAK
HLDE_PELCD      LRRRLEEKQVGIEGLQFDAKRTTSRKTRILASGQQMMRFIDATQEAVLAEFVSNSADRILVSDYLKGVLT
HLDE_ENTS8      ----------------------------------------------------------------------
IOLC_BACLD      IETYMRNTGVDTSQMAVDKDGAGLAFTEILSPEECSILMYRDDVADLYLAPSEVNEDYIAKSKMLLALAK
HLDE_PSEHT      ----------------------------------------------------------------------
HLDE_COXBN      ----------------------------------------------------------------------
ADK_HUMAN       LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKLVEKARVCYIAGFFLTVSPE
ADK2_ARATH      MKKDATAAGVNVHYYED-ESAPXXXXXXXXXXXERSLIANLSAANCYKVDHLKKPENWAKAKFYYIAGFF
HLDE_PSEU2      LTNSLKAAGV----LARFQRIADQPTIVLRVMSRHQQLLRIDFEEPFRTAEVYSLLDGIKVL-VLSDYGK
HLDE_SHESR      ----------------------------------------------------------------------
HLDE_SHESM      ----------------------------------------------------------------------
HLDE_SHESA      ----------------------------------------------------------------------
HLDE_COXBU      ----------------------------------------------------------------------
HLDE_COXBR      ----------------------------------------------------------------------
PDXK_DICDI      ----------------------------------------------------------------------
HLDE_SHESW      ----------------------------------------------------------------------
HLDE_SHEPC      ----------------------------------------------------------------------
HLDE_SHEB8      ----------------------------------------------------------------------
HLDE_PSE14      LANSLKAAGVLARFQRIANQPT---IVKLRVISRHQQLLRIDFEEAFNTAEVYSLLDGIKVL-VLSDYGK
HLDE_SHEB9      ----------------------------------------------------------------------
HLDE_SHEB5      ----------------------------------------------------------------------
HLDE_SHEB2      ----------------------------------------------------------------------
HLDE_PROMH      LSNTLSQVNVRCDFVSIATHPTNQQLIRLDEEGFSNVSIYERIQQALPS------MGALILSDYA----K
HLDE_HELAH      FINALKIREVDTSGVLKTRCTTLKTRIIVQNQQIVRVEIKDPLNADLRKNLLDFVAEKIQEMDGIILSDY
HLDE_PSESM      LTNSLKAAGV----VARFQRIADQPTIVLRVMSRHQQLLRIDFEEPFNTAEVYSLLDGIKVL-VLSDYGK
HLDE_MARAV      LKDLLIKEKVH-SELLELDDARTQQMVRLDMEDTFPVAQAESVKQRYAELIEQ--YNTVIISDYA----K
ADK_RAT         LKSKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKLVEKARVYYIAGFFLTVSPE
SCRK_SALTY      MRHTLQQEQVDVSHMYLDDQHTSTVVVDLDDQGERTFTFMVRPSALVEEDLPQFAAGQWLHVCSIALSAE
LACC_STRSV      LLQ-------NLNQAVRISGDTRNCIAILHESKQTEILEAGPTITVDEANGFLHHFKSLMESAEVVSISG
HLDE_PHOLL      ----------------------------------------------------------------------
IOLC_BACA2      IVSYMQGKGVDTSQMTVDREGAGLAFTEILSPEECSILMYRDDVADLYLEPSEVNEGYIANAKMLLALAK
HLDE_SODGM      LGARLSEVDVTCDFVAVATHPTVTKLRVLSRNQQLIRLDFEGFDDVDAAPMIERIQLALPKTGALVLSAK
HLDE_SHEDO      ----------------------------------------------------------------------
ADK_MOUSE       LKRKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVKARVYYIAGFV
HLDE_VIBVY      LTETLNSLKVKCDFVA-LPEYPTITKLRVMSRGQQLIRLFEGTNPELVLTRMERALPHVQ-AVILSDYAK
KDGK_HAEIN      MLKYWQADGIQTNWVLQDEQHQGLYLIQLDAQGERTFLYWRNQSAAIYLSGISLAILPKNDRTFLIEQLS
HLDE_PSEPF      ----------------------------------------------------------------------
HLDE_HELHP      ----------------------------------------------------------------------
ADK_CRIGR       LKSKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLENNWVKARVYYIAGFV
LACC_STRU0      IQKELDQVGIE-HDFSPISGETRNCIAILHEGQQTEILESGPTISDEEGKVFLEHFESLVKQVSIISISG
K1PF_BACSU      IKTFLREE--NLETAFSEVKGDTRINVKLKTGDETEINGQGPTISDEDFKAFLEQFQSLQEGDIVVLAGS
HLDE_YERPY      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPS      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPP      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPN      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPG      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPE      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPB      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERPA      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_YERP3      LICKLSEVRVRCDFVSVPTHPTITKLRVLSRNQQLIRLDFEEGFDGVDPTPIQLALPQI-GALVLSDYAK
HLDE_SHELP      ----------------------------------------------------------------------
INGK_ECOLI      ----------DLNYLQGVDGPIGRCFTLIGESGERTFAISPGRAESIPEDVIAGASALVLTSYLVRCKPG
INGK_ECOL6      ----------DLNYLQGVDGPIGRCFTLIGESGERTFAISPGRAESIPEDVIAGASALVLTSYLVRCKPG
INGK_ECO57      ----------DLNYLQGVDGPIGRCFTLIGESGERTFAISPGRAESIPEDVIAGASALVLTSYLVRCKPG
HLDE_PSEU5      ----------------------------------------------------------------------
HLDE_PSEF5      ----------------------------------------------------------------------
HLDE_ERWCT      ----------------------------------------------------------------------
HLDE_EDWI9      LSTRLDEVHVECDFVAIPAQPT---ITKLRVLSRNQQLIFGGVDPGPILARIRQALPQV-GAVILSDYAK
THIED_GEOSL     ----------------------------------------------------------------------
HLDE_PELPD      LLEAFGRRGVATDAISRKTRVVAAHQQIVRIDRESRVPLSAEVERRVSDWITANAFDVILLSDYQKGVL-
HLDE_VIBVU      LTETLNSLKVKCDFVA-LPEYPTITKLRVMSRGQQLIRLFEGTDPELVLTRMERALPHVQ-AVILSDYAK
HLDE_VIBSL      LKNTLKCDFVELDDYPTITKSRGQQLIRLDFEDK-----FENTDPELVLSRMEQALPNVR-SVILSDYAK
ADK_TOXGO       LKELCDKEGLATRFMVAPGQSTGVCAVLINEK-ERTLCTHLGACGSFRTTFASGALIFYATAYTLTATPK
SCRK_SALTH      ----------------------------------------------------------------------
HLDE_VIBFM      LTTTLESLKVHCDFVA-LPEFPTITKLRVMSRGQQLIRLHDVAAEPIISRM-QQALSSVK-AVVLSDYAK
HLDE_PHOPR      ----------------------------------------------------------------------
SCRK_RHILT      LLETLKASNVDYSPCAITPRPSTIAFVKL-VNGQATYAFYGTAGRMITTADLPDLGDDCEALHFAISLIP
HLDE_HAHCH      LAARMESAGITLPTITKLRVISRHQQLIRMDFEES----FAGVPQEQKXXXXXXXXXXXXXSDYGKGALR
HLDE_GEOBB      ----------------------------------------------------------------------
HLDE_SHESH      LTTGIQALGVEPKTITKLRVMSRNQQLIRLDFEE----AYPEDESKALLTLSESALDNVAVSDYAKGAIT
YZ37_SYNY3      YLQDLNDCGLDTNHHETAGEGTGKCLVFVTPDADRTMNAFLGISGSLSVTEMD--WSALKQSQYLLVTSP
LACC_STAHJ      IEEQLMDAQIE-QSFFKIKGETRNCIAILHEGQQTEILEQGGKEEAYKTHLLEKRANVIAMSGSLPKGLN
HLDE_VIBF1      LTTTLESLKVHCDFVA-LPEFPTITKLRVMSRGQQLIRLHDVAAEPIISRM-QQALSSVK-AVVLSDYAK
HLDE_AERHH      ----------------------------------------------------------------------
HLDE_PASMU      LESLLAKSRIECDFVQLHTHPTITKLRILSRHQQLLRLDFEEDFQNVTSALLQKLDSALQNYGALVLSDK
HLDE_ERWT9      ----------------------------------------------------------------------
HLDE_YERE8      ----------------------------------------------------------------------
HLDE_METCA      ----------------------------------------------------------------------
HLDE_AERS4      ----------------------------------------------------------------------
Y1655_HAEIN     -----------------------------------------GDGQILGTT-IQSGFNDAKGNSTIPVQFD
HLDE_PECCP      ----------------------------------------------------------------------
HLDE_CAMFF      ----------------------------------------------------------------------
THID_MYCTU      ----------------------------------------------------------------------
THID_MYCBO      ----------------------------------------------------------------------
LACC_STRPC      IINHLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEKGPLLSVDETHQFKYLLNDV---DVVTMSGS
LACC_STRPB      IINHLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEKGPLLSVDETHQFKYLLNDV---DVVTMSGS
HLDE_RHOP5      LQTTLAKDAITPVLVCDPSRPTTRKVRFVSEHFSTHMLVAAPASAAVEQQLIDAVLKQLPAADIVLAKGV
LACC_STRPM      IINHLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEKGPLLSVDETHHFKYLLNDV---DVVTLSGS
LACC_STRPD      IINHLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEKGPLLSVDETHHFKYLLNDV---DVVTLSGS
LACC_STRA5      IRSGL--DALEIRHFLSIGGETRHCIAVLHEGQQTEILEKGPHITKDEADAFLNHLKLIFDAATIITVSG
LACC2_STRA3     IRSGL--DALEIRHFLSIGGETRHCIAVLHEGQQTEILEKGPHITKDEADAFLNHLKLIFDAATIITVSG
HLDE_WOLSU      LLGFLQELGMESKGIIKGRPTTQKSRIIISEESEEAMIAYIRSKLSLCDAVIL--------SDYGKGVL-
HLDE_SERP5      ----------------------------------------------------------------------
PYRH_META3      MNSMLLISALDNYAVKKVPENFKDAEIILNL---NKIVVMGGTHPAHTTDAVAASLAEYIDADMLVVATN
LACC_STAAR      IAKKLDHAGIK-HAFYNIKGETRNCIAILHEGQQTEILEQGPEIDN------QEAAGFIKHFEQLLEKVE
HLDE_AZOVD      ----------------------------------------------------------------------
Y1336_METJA     -------------------------------------------NDELSSKILGVIKNLNGKSDILVISDY
PDXK_SHEEP      ----------------------------------------------------------------------
PDXK_BOVIN      ----------------------------------------------------------------------
THID_STAAR      ----------------------------------------------------------------------
HLDE_PSEFS      LANSLRGAGVRAPTIVKLRVMSRHQQLLRIDFEEDALALNGQVDELLEGVKV------LVLSDY----GK
PYRH_METMP      MNSMLLISALGKDAVKQVPENFKDAEIILNM---DKILVMGGTHPAHTTDAVSATLAEFIDADLLV----
PDXK_HUMAN      ----------------------------------------------------------------------
LACC1_STRA3     LLQHLPQ---NIQAFFYEIAGDTRNCIAILHEGQQTEILEAGPTIAAEEVSLMGATDVVAISGSLPAGLP
HLDE_SHEPW      ----------------------------------------------------------------------
HLDE_NITOC      ----------------------------------------------------------------------
FRLD_ECOLI      LKQDLARMGVDISHVHTKHGVTAQTQVELHDNDR----VFGDYTEGVMADFA------LSEEDYALAQYD
ADK_DICDI       LKTATESNGVVTKYQVDSSAPTGACAVLINHKERSMVTNLGAANNFKIAHFQTEEMKAIVNSAYLVGYFL
THID_STAAW      ----------------------------------------------------------------------
THID_STAAS      ----------------------------------------------------------------------
THID_BACSU      ----------------------------------------------------------------------
PYRH_METM7      MNSMLLISALGKDAVKQVPENFKDAELILNM---DKILVMGGTHPAHTTDAVSATLAEFIDADLLV----
PYRH_METM5      MNSMLLISALGKDAVKQVPENFKDAELILNM---DKILVMGGTHPAHTTDAVSATLAEFIDADLLV----
PDXK_PIG        ----------------------------------------------------------------------
LACC_STRA1      IRSGL--DALEIRHFLSIGGETRHCIAVLHEGQQTEILEKGPHITKDEADAFLNHLKLIFDAATIITVSG
HLDE_SHEON      ----------------------------------------------------------------------
HLDE_CAMJ8      ----------------------------------------------------------------------
HLDE_ALISL      ----------------------------------------------------------------------
AK3_BACSU       ALQILEEHGLTYEHVPS---GIDDMTIILRQ---------GQMDAATERSVIKRIEEDLHADEVIVEHHL
SCRKL_DICDI     ----------------------------------------------------------------------
LACC_STAEQ      ETTRIKQAFFKI-------KGETRNCIAILHEGQQTEILEKGPTIELKESFKSHLLKLFKETDVAVMSGS
LACC_ENTFA      -----------------------QAFTSIKEETRDSIAILHEGNQAGPTVSPEEISNFLENFDQLIKQAE
IOLC_BACSK      ISSYMREAGVDTSQLVIDREGAGLTFTEILSPEECSILMY------------------------------
PYRH_METM6      MNSMLLISALGKDAVKHVPENFKDAELILNM---DKILVMGGTHPAHTTDAVSATLAEFIDADLLV----
PDXY_VIBF1      ----------------------------------------------------------------------
PDXK_MOUSE      ----------------------------------------------------------------------
LACC_STRP3      IINHLPDS--ILSRFYKISGYTRTCIAILHEGNQTEILEKGPMLSVDETHHFKYLLNDV---DVVTLSGS
LACC_STAAB      IAKKLDLAGIK-HAFYNIKGETRNCIAILHEGQQTEILEQGPEIDN------QEAAGFIKHFEQLLEKVE
HLDE_PSEPK      ----------------------------------------------------------------------
HLDE_PSEPG      ----------------------------------------------------------------------
HLDE_PSEP1      ----------------------------------------------------------------------
THID_AQUAE      ----------------------------------------------------------------------
LACC_STRPG      IINHLPDS--ILSRFYKISGDTRTCIVILHEGNQTEILEKGPLLSVEETHHFKYLLNDV---DVVTLSGS
LACC_STAES      ETTRIKQAFFKI-------KGETRNCIAILHEGQQTEILEKGPTIELKESFKSHLLKLFKETDVAVMSGS
LACC_STAAW      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAT      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAS      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAN      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAM      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAE      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAAC      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAA9      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAA8      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAA3      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAA2      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
LACC_STAA1      IAKKL--DHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPE-----IDNQEAAGFIKHFEQLLEKVE
FTSY_RICPR      ----------------------------------------------------------------------
DNLJ_RICAE      LLTKLKECGFNINEISKLASSEEEIFAFLKTNRENLPYEIDGVVYKLNDFVLQNRMGFIARS--------


                         +         .         .         .         .         *         .:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
RBSK_ECOLI      SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
RBSK_ECO57      SPLESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLH
RBSK_HAEIN      TPLSGVELAAQIAKKNGVKVVLNPAPAQXXXXXXXXXXXXXTPNETEAEILTGVEVADEQSAVKAASVFH
RBSK_SCHPO      IPLEAVEIALQIAHKHGVDVLMNPAPAIPLSHDMISYCAYLVPNEHEAAIL--LNQADSPATLENVDKLL
RBSK_LACLA      IPHETNLAIAKFCKENAIKVLYNPAPARKTDLEMIDFVDYITPNEHECELFPNL----------ALEEIL
RBSK_BACSU      IPEETVDEVCKYCHSHDIPIILNPAPARPLKQETIDHATYLTPNEHEASILFPELTISEALALYPA----
RBSK_BACHD      IPLETVAYVLEFCAKHHVTTVLNPAPAQKLPDAAWTDATYISPNENECLQLFG----DEPDANLR-----
RBSK_MOUSE      ISPAASLEALTMARRSGVKTLFNPAPAMADLDPQFYTLSSIFCNESEAEILTGHAVSDPTTAGKAAMILL
RBSK_HUMAN      ITPATSLEALTMARRSGVKTLFNPAPAIADLDQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLL
RBSK_DICDI      VSLNVTLHALKIAKESNCKTMLNLTPINNLILEMFKFVDILIVNEIE---LIGLXXXXXXQLMEMCDNLI
RBSK_YEAST      IPDPLSIIKWIHANRPNFQIVYNPSPFKAMPKKDWELVDLLVVNEIEGELVEEIKIKDDKICELLYEKLM
SCRK5_ARATH     EPCRTAHAAMKTAKDAGVLLSYDPNPSTEAAIEGIKSIDIIKVSDDEVTFLTRGDAEKDDVVLS----LM
SCRK2_SOLHA     EPCRAAHKAMEVAKEAGALLSYDPLPLWPSAEEAKKQIDVIKVSDVELEFLTGSNKIDDES----AMSLW
SCRK1_ORYSI     RAMEIAKEAGALSYDPNLREALWPSARTKILS-IWDHADIVKVSEVELEFLTGIDSVEDDVVM----KLW
SCRK1_ORYSJ     RAMEIAKEAGALSYDPNLREALWPSARTKILS-IWDQADIVKVSEVELEFLTGIDSVEDDVVM----KLW
SCRK2_SOLLC     EPCRAAHKAMEVAKEAGALLSYDPLPLWPSAEEAKKQIDVIKVSDVELEFLTGSNKIDDES----AMSLW
SCRK3_ARATH     KAMEVAKEAALLSYDPNLREPLWPSPARTQIMSIWDKADIIKVSDVELEFLTENKTMDDKT----AMSLW
SCRK1_MAIZE     RAMEIAKEAGALSYDPNLREALWPSARTQILS-IWDQADIVKVSEVELEFLTGIDSVEDDVVM----KLW
SCRK2_ARATH     KAMEVAKEAGALSYDPNLREPLWPSP-----EEARKQIDIIKVSDVELEFLTGNKTIDDET----AMSLW
SCRK4_ARATH     PCRSAHLKAMEVAKEAGALLSYDPLPLWPSKEEAQKQIEVIKVSDEELMFLTGSDKVDDET----AXXXX
SCRK1_ARATH     EPCRSAHKAMEVAKEAGALLSYDPEPLWPSKEEAKTQIEIIKVSDVELEFLTGSNKIDDET----ALTLW
SCRK_SOLTU      EPCRSAHKAMEVAKEAGALLSYDPNLRLPLWSSEAEARKAIKVSDVELEFLTGSDKIDDES----AMSLW
SCRK2_ORYSJ     EPCRSAHAAMRAAKSAGILCSYDPNPSEDAILSIWKEADFIKVSDDEVAFLTQGDANDEKNVL----SLW
SCRK2_ORYSI     EPCRSAHAAMRAAKSAGILCSYDPNPSEDAILSIWKEADFIKVSDDEVAFLTQGDANDEKNVL----SLW
SCRK2_MAIZE     EPCRXXXXGVLCSYDPNVRLPLWPSPAREGILSIWKEADFIKVSDDEVAFLTRGDANDEKNVLS----LW
YDJE_BACSU      LMSIAKDNGQFISFDPNYREDLWRGRVSEFVSVAKKAIDFVKVSDEELEIISGVKDHEKGVAI-----LH
YDJH_ECOLI      SPLKALTEIFTQAKARQIKPRLNET--LDDICEALSYVDYLFPNFAEAKLLTGKETLDE-----IADCFL
KDGK_BACSU      ---DMRNAGKTISFDPNVRPSLWPDQATMVINDLAGLADWFFPGIAEGELLTG-----EKTPEGIADYYL
Y356_ARCFU      NGLDSLNSQKRIVEEFDSVSFDPGMPYAEDMEKILKNTTIFLPNRQEIEMLF------SEDYRTAAERCI
K6PF2_ECOLI     LPLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIV
HLDE_THICR      GALQFVEEMIQAAKSQQVPVLIDPK-GNDF--SRYAGATLVKPNQGEFELIVGVCADQDDLIEKAKQLIQ
YEIC_ECOLI      ISEEAL--AWILDNAANVPVFVDPVSAVKVRDRLNQ-IHTLKPNRLEAETLSGIALSGREDVAKVAAWFH
IOLC_LISMO      SPREAVLKAVSLARKNDVYTWKNSEETAVYYSLVAEQADVIIGTRDEFDMMEN-QVGGKNEATKA--YLF
IOLC_LISMH      SPREAVLKAVSLARKNDVATWTNTEETAVYYSLVAEQADVIIGTRDEFDMMEN-QVGGKNEATKA--HLF
IOLC_LISMF      SPREAVLKAVSLARKNDVATWTNTEETAVYYSLVAEQADVIIGTRDEFDMMEN-QVGGKNEATKA--HLF
IOLC_LISMC      SPREAVLKAVSLARKNDVATWTNTEETAVYYSLVAEQADVIIGTRDEFDMMEN-QVGGKNEATKA--HLF
IOLC_CLOPE      SPSREXXXXXXXXXXXNGTVVINKDEIAIYYSIVGKESDIIMGSREEFDLMEGL-IAKDSTDEETAKRWL
IOLC_CLOP1      SPSREXXXXXXXXXXXNGTVVINKDEIAIYYSIVGKESDIIMGSREEFDLMEGL-IAKDSTDEETAKRWL
YEII_ECOLI      LTAEALEWVFTLADEIPVFVDTVSEFKAGKIKHWLAHIHTLKPTLPELEILWGQAITSDADRNTAVNALH
IOLC_LISIN      SPREAVLKAVHLAQKNDVYTWKNTEETAVYYSLVAEQADVIIGTRDEFDMMENQIGGNNE---MTIDNLF
IOLC_CLOTE      SPSEAAFVALEYAKKHNTRIIFNCKEEIAIYYSLAARMDVIMGSREEFNLMEGLISPEESNDKETAERWI
SCRK_VIBAL      PSRSSTFEAIKRAKAAGGFISFDPNLRDEVWQDQSEXXXXXXXXFSEEELLF---LTDSTSMAQGLQQIA
ADK_PHYPA       SMMTVAKHAAETGKMINLAAPFICQFFKDPLMELFPYVDFIFGNESEARAFAQVQGWETEDTKVIAVKLA
IOLC_PHOPR      SPREATLIAMEHARRSNTVVVLDVSWRTDVDASIYYGIDIVIGNREEFDMMETVLAPGNTDDDATADRFL
IOLC_CLOBA      SPSRXXXXXXXXXXXXNDTVVIFDVDYREYKDEIAKQSDIVMGSREEFDLMESLIVKEKSTDEESAKRWL
YIHV_ECOLI      WH-DGAKKAFTLARQAGVMTVLDGDITPQDISELVALSDHAAFSEPGLARLTGVK--EMASALKQAQTLT
Y406_METJA      KAYGNNLVSFDPGQDL-------PQYSKEMLLEIIEHTNFLFMNKHEFERASNLLNFEIDDYLERVDAL-
IOLC_CLOB8      SPSRXXXXXXXXXXXRNNTVVINSDEIAIYYSIAGKQSDIIMGSREEFDLMEKLITREKNSDEETAKRWL
IOLC2_BACCZ     LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEESNDQVTAERWF
IOLC_MYCH7      SSREAVLKALFLAKNNGIKVVFDRPYSWKNLDEVSQNSDLIIGSYEEIQLTSRF-------CLENPENLI
IOLC_MYCH2      SSREAVLKALFLAKNNGIKVVFDRPYSWKNLDEVSQNSDLIIGSYEEIQLTSRF-------CLENPENLI
YURL_BACSU      SRLE--NDLPQLCGLVPVSFDFSTNREDDYLRR-------VCPYVTYA-FFSG-SDLSESECGELAKTAH
IOLC_MYCHJ      SSREAVLKALFLAKNNGIKVVFDRPYSWKNLDEVSQNSDLIIGSYEEIQLTSRF-------CLENPENLI
Y1544_METTH     DP-SFNCRCGEFARSLG--KIISFDPGQDLLERAVGVCDILFGNHHEIDRICSKLSVDIHGLR-------
HLDE_ACTSZ      GTLNDVQHMIRIARQAKVPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVAGVCQSDEDIVEKGLKMIA
IOLC_BACHK      LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEKSNDQVTAERWF
IOLC_BACAN      LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEKSNDQVTAERWF
IOLC_BACAC      LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEKSNDQVTAERWF
IOLC_BACAA      LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEKSNDQVTAERWF
IOLC1_BACCZ     LAKSPSREAVFLALEYARKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEQSNDQVTAERWF
HLDE_BLOPB      GSLNCIEEIIKLARYMNVPVIVDPK---GIQFSRYKGATLLTPNISEFESIVGSCRNEKILINRAQEIII
HLDE_ACTP2      GTLESVQQMIQVARKAGVPTLIDP-KGTDF--ERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKGLKLIA
K1PF_HAEIN      LPRGVSPELFNQLHQAGVKVVLDSSNAA-LTAGLKAKPWLVKPNHRELEAWVGHPLNSLEEIIAAAQQLK
IOLC_CLOBB      SPSRXXXXXXXXXXXXNDTIVIFDVDYREYKDEIAKQSDIVMGSREEFDLMESLIVKEKSTDEESAKRWL
HLDE_SALDC      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_ARCB4      KGVKLTQDIINIANKNSVKVLVDPXXXXXXXXXXXXTLT---PNKKEAQEATNIDIKDENSLINALKDLK
HLDE_GEOMG      PTLLAA--VIAVARERKIPVVVDPKGN----DYTKRGATLLTPNRKEAEAASGIAIRDEASLCRAGERLL
HLDE_GEOLS      TP-SVLASVTSTASRRNIPVLVDPKGS----DYSKRGATCLTPNRKEAEAASGVPIQDGASLQQAADTIM
HLDE_CAMC5      KGVKVCRDIINECVRLDIPVLIDPKGN----DYSKKNATLLTPNRKEASEATGIAIKNTIDLRAAIMKLK
IOLC_BACC3      LAKSPSREAVFLALEYAHKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEQSNDQVTAERWF
IOLC_BACAH      LAKSPSREAVFLALEYAHKTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLLNYEQSNDQVTAERWF
HLDE_SALTY      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALTI      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALSV      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALPK      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALPC      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALPB      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALPA      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALNS      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALHS      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALG2      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALEP      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALCH      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_SALA4      GALTSVQTMISLARQAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_HAEIE      SALKDVQKMIQIARKANVPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLIS
HLDE_HAEI8      SALKDVQKMIQIARKANVPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLIS
HLDE_GEOSL      PTLLA--EVIAFARKREIPVVVDPKGS----DYAKRGATVLTPNRKEAEAASGIAIRDDESLCRAGERLL
ADK1_ARATH      --LTVSPESIQLVREHKVFTMNLSAPFIDVQEKCLPYMDYIFGNETEARTFSRVHGWETDDVEQIAIKMI
HLDE_SULDN      SKGVLTKEVISTCSKNGIKVLVDPKGS----DYSKSGAYLLTPNKKEAIQATKIDIKDKQSLKEALLKMK
HLDE_CITK8      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAGKCKSEEEIVERGMKLIA
HLDE_ACTPL      GTLESVQQMIQVARKAGVPTLIDP-KGTDF--ERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKGLKLIA
K1PF_SHIFL      LPSGVSPEAFTTRLRSQCPCIIFDSSREALVAGLKAAPWLVKPNRRELEIWAGRKLPEMKDVIEAAHALR
K1PF_ECOLI      LPSGVSPEAFTTRLRSQCPCIIFDSSREALVAGLKAAPWLVKPNRRELEIWAGRKLPEMKDVIEAAHALR
K1PF_ECOL6      LPSGVSPEAFTTRLRSQCPCIIFDSSREALVAGLKAAPWLVKPNRRELEIWAGRKLPEMKDVIEAAHALR
K1PF_ECO57      LPSGVSPEAFTTRLRSQCPCIIFDSSREALVAGLKAAPWLVKPNRRELEIWAGRKLPEMKDVIEAAHALR
HLDE_NITSB      LVLLSDYDKGVLTKEVT-QTVIQRSSVPVFVDEKYRGATLIKPNKKEASKAVGFLIKNEEDLKRAGWKLK
Y1459_PYRHO     SVILARNP----SRETVMKVIKKIKGSSLIAFDVNLRLDLWRGQEEEM-----IKVLEEDIVKASEEEVL
IOLC_LACCA      XXXXXXXXGVEVIFELDYRTWQNAEETSLYYQLVAQKADVIIGTRDEFDVLENHQ---GRTDQETIATLF
HLDE_SALAR      GALTSVQTMIALARQADVAVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAG-KCKSEDELVERGMKLI
HLDE_MANSM      GTLNDVQQMIQIARKAKVPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVVGKCDTEEDIIEKGLKLIA
HLDE_DICNV      GKGSLHNVSALIAQAKAAKWVLVDPKGTDF--QRYRGADIVTPNVAELTAVVGHFADEKTMIAKARACLI
HLDE_HAEIG      SALKDVQKMIQIARKANVPVLIDPK-GTDF--ERYCGATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLIS
Y057_BUCAP      -----------LAKKMSIPILIDPKG----LDFKKSGATLLTPNLSEFEQIVG-KCHQEKQILQRGIKLV
IOLC_GEOTN      SPREAVFLALEYARRHGVVVFLDYRPYTWQSKEAAEKCDVIIGTREEFDMMEQFAVHQHDD-EKTAQKWF
Y060_BUCAI      AKGTLANNIIDLAKKMSIPILIDPKGI-----DFKKGASLLTPNLFEFEKIVGKCYRENEILQRGIKXXX
HLDE_ENT38      GALASVQQMIQLARKAGVPVLIDPK-GTEF--ERYRGATLLTPNLSEFEAVAGKCKNEEEIVERGMKIIA
IOLC_GEOKA      SPREAVFLALDYARRHGTVVVLDYRPYTWQSKEAAEKCDVIIGTREEFDMMDGQRRDDEQTAR----KWF
HLDE_KLEP3      ----------KLAREAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVG-KCQDEAEIVERGMKLI
SCRK_ECOLX      EPSRTSATAMTAIRHAGGFVSFDPNIREDLWQDXXXXXDVVKLSEEEWRLISGKTQNDRDICALAKEYEI
LACC_LACLA      LPSGLPNDYYELASDEGVAVVLDGAPLETVLKSSAKPT-AIKPNNEELSQLLGKEVTDIEELKDVLKESL
HLDE_SHEPA      KGALISPQSFEAANAKGVKVLVDPKGS----DFSKRGAYLLTPNMSEFEVVVGKVESEADLVAKAQGLLQ
HLDE_ECOHS      GALASVQQMIQLARKAGVPVLIDPK-STDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
IOLC_BACHD      SPSEAVLKAIRLAKRNDVKVVFEPEETAVYYSLVAEQSDIVIGTREEFDVLENRKGDNDETIRY----LF
HLDE_SHISS      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_SHIF8      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_SHIBS      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_SHIB3      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_KLEP7      ----------RLAREAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVG-KCQDEAQIVERGMKLI
HLDE_HAEDU      GTLAAVQQMIQIARQAKVPVLIDPK-GTDF--ERYRGATLLTPNMAEFEAVVGACLNDNDIVSKGLKLIN
HLDE_ECOUT      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOSM      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOSE      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOLU      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOLI      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOLC      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOL6      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOL5      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOK1      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECODH      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECOBW      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO8A      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO81      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO7I      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO5E      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO57      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO55      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO45      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO27      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_ECO24      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_DESAA      GKGVLTRELAKICKTAGKALIVDPKG----MDYSKKGATCITPNKKEASQASGVEIKDQASLERAAAKLL
HLDE_SHIFL      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_HAES1      GTLNDVQKMIQIARKVNIPVLIDPK-GTDFARY--RSATLLTPNMSEFEAVVGKCHSEEEIAEKGLQLIK
IOLC_BACSU      SPSEAVLKAVQYAKKHQVKVVLDYRPYTQSSDEVAEQSDIVIGTRDEFDVMENRTGGSNE---ESVNHLF
HLDE_ESCF3      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_SHEHH      KGAIISPQSFQAANAKGVKVLVDPKGS----DFSKRGAYLLTPNMSEFEVVVGKVESEADLVAKAQGLLE
HLDE_SHEFN      EPKDFIAKA----RAKGVKVLVDPK-GHDFARY--HGASLITPNMSEFEAVVGT-VTSEDDLIEKAQKLI
HLDE_MAGSM      LSFELCQALIVRARNLGIPVLVDPKGR----DYARRHATALSPNRGELRGVTGVEDGDLNTLLDAGESLR
HLDE_HAEIN      SALKDVQKMIQIARKANVPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVVGKCNTXXXXXXKGLKLIS
HLDE_SHIDS      GALASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIA
HLDE_PELCD      EDL--LQSVIAVGKQKGIPVVIDPKGN----DYAKRGATLLTPNRKETEVASGISIVDEESLRLAARTLM
HLDE_ENTS8      --LASVQQMIQLARKAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVAGKCKTEQDIVERGMKIIA
IOLC_BACLD      SPSEAVLKAVQLAKKHQVKVVLDYRPYTWTSAEVAEQSDIVIGTRDEFDVMENKSGGSNE---ESVQHLF
HLDE_PSEHT      --LSLIENMISLAKKAG-KTVLVDPKSSDL--HLYRGADYITPNLNEFKLAGGQTDSEEGLATSARKLIS
HLDE_COXBN      ---------------------------------------LLTPNLKEFEAVVGHCRTDQELESKARALIH
ADK_HUMAN       SVLKVAHHASENNRTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFADIKEIAKKT--QALPKMN
ADK2_ARATH      --LTVSPESIQLVSEHKVFTMNLSAPFIDVQEKFLPYMDFVFGNETEARTFSRVHGWETEDVEQIAIKII
HLDE_PSEU2      GALKNHQALIQAARKRGIPVLADPK-GKDFA--IYRGASLITPNLSEFEAIVGHCVDEAQLVTKGAQLMQ
HLDE_SHESR      -----------LARAKGVKVLVDPK-GSDF--SRYHGASLITPNMSEFEAVVGAVTSEADLLEKARGLLN
HLDE_SHESM      -----------LARAKGVKVLVDPK-GSDF--SRYHGASLITPNMSEFEAVVGAVTSEADLLEKARGLLN
HLDE_SHESA      -----------LARAKGVKVLVDPK-GSDF--SRYHGASLITPNMSEFEAVVGAVTSEADLLEKARGLLN
HLDE_COXBU      ---------------------------------------LLTPNLKEFEAVVGHCRTDQELEFKARALIH
HLDE_COXBR      ---------------------------------------LLTPNLKEFEAVVGHCRTDQELEFKARALIH
PDXK_DICDI      -------------------------------NEVIPNADYIFPNQTEVEFLTGIKIKNDQDALKAIDQFH
HLDE_SHESW      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_SHEPC      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_SHEB8      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_PSE14      GALRNHQALIQAARKRGIPVLADPK-GKDFT--IYRGASLITPNLSEFEAIVGHCEDEAQLVTKGAQLMQ
HLDE_SHEB9      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_SHEB5      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_SHEB2      ---------------------------------------LITPNMSEFEAVVGTVTSEADLLEKARGLLK
HLDE_PROMH      GALSHVQQMIQLAKKAGVPVLIDPK-GSDF--ERYRGATLLTPNMSEFEQVVGVCHTDDELVEKGTQLVK
HLDE_HELAH      NKFKITQTIIALANK-HYKLILCDPKGKDY--SKYSHASLITPNRFELEQALHLKLDGDANLLKALQILQ
HLDE_PSESM      GALKNHQALIQAARKRGIPVLADPK-GKDFA--IYRGASLITPNLSEFEAIVGHCEDEAQLVTKGAQLMQ
HLDE_MARAV      GTLACVGDLIQAARKAGKQVLVDPK-SKDF--SLYRGATVITPNLSEFKXXXXXXXXXXXXXXXXXXXLT
ADK_RAT         SVLKVARYAAENNRTLNLSAPFISQFFKEALMEVMPYVDILFGNETEAATFADIKEIARKT--QALPKVN
SCRK_SALTY      PSRSTTFAAMESIRSAGGRVSFDPNIRPDLWQDQAL---LLACLDRALHMANVVKLSEEELVFISSSNDL
LACC_STRSV      SPVEYYIQLVEIANQAGNKVVLDCSGAA-LEAVLKSDVKAIKPNNEELSQLLGREVSDLDELKAVLSEPL
HLDE_PHOLL      --LSQVQEMIKLANAAKVPVLIDPK-GNDF--ERYRGATLLTPNLSEFEAVVGHCKDDNELVEKGTRLVK
IOLC_BACA2      SPREAVLKAVHIAKKHDVKVVLDYRPYTWQSAEVAEQSDIVIGTRDEFDVMENRSGGGND---ETVRHLF
HLDE_SODGM      GALARVREMITLARAAGVPVLVDPK-GTDF--DRYRGATLLTPNLSEFEAVAG-PCKDEETLVSRGMKLI
HLDE_SHEDO      ---------------------------------------LITPNMSEFEAVVGPVKDEADLIEKARQLIK
ADK_MOUSE       SPESVLKVARYAAENNRVFTLNLSAPFIEALMDVMPYVDILFGNETEAATFAGFETKDIKEIAQALPKVN
HLDE_VIBVY      GALEHVEALIAKARAANVPVFIDPKGTNF---EPYRGATLLTPNMSEFEAVVGKVTSDDDLVEKALGLIE
KDGK_HAEIN      S---LAKKGTEIVFDSNYRPKLSLEEAQDCYLQLLPSVNIALVTFDDEQALWKDK-----TSRDTLERLH
HLDE_PSEPF      -----------------------------------RGASLITPNLSEFEAIVGGCADEHELVTKGATLMH
HLDE_HELHP      ---------------------------------------LLTPNKKEAELATGITICDKDSLIKAGMTLK
ADK_CRIGR       SPESVLKVARYAAENNRIFTLNLSAPFIESLMEVMPYVDILFGNETEAATFAGFETKDIKEIAQALAKVN
LACC_STRU0      SPVDFYSKMIEICERYQKPVVLD-CSGQALLEVLKGHAKVIKPNTEELSQLLNMEVTSDTSVLKAADQDL
K1PF_BACSU      IPSSLPHDTYEACKQQNARVVLDISGEA-LLKATEMKPFLMKPNHHELGEMFGTAITSVEEAVPYGKKLV
HLDE_YERPY      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPS      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPP      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPN      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPG      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPE      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPB      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERPA      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_YERP3      GALNSVQPMIQLARKANVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVA
HLDE_SHELP      ---------------------------------------LLTPNMSEFEQVVG-KVADEDLVTKAKELLK
INGK_ECOLI      EPMEATMKAIEYAKKYNVPVVLTLGTKFVIAENLKDHVSILAMNEDEAEALTG-----ESDPLLASDKAL
INGK_ECOL6      EPMEATMKAIEYAKKYNVPVVLTLGTKFVIAENLKDHVSILAMNEDEAEALTG-----ESDPLLASDKAL
INGK_ECO57      EPMEATMKAIEYAKKYNVPVVLTLGTKFVIAENLKDHVSILAMNEDEAEALTG-----ESDPLLASDKAL
HLDE_PSEU5      --------------------------------EIYRGASLITPNLGEFEAIVGHCADEAELVAKGAELMR
HLDE_PSEF5      -----------------------------------RGASLITPNLSEFETIVGGCADEHELVSKGAQLMH
HLDE_ERWCT      ---------------------------------------LLTPNLSEFEAVAGRSKTEEELVERGMQLVA
HLDE_EDWI9      GALASVQAMICLARDAGVPVLIDPK-GTDF--ERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALME
THIED_GEOSL     ---------------------------------------LVTPNIPEAERLTGANISDEESMREAARRLH
HLDE_PELPD      TP-GVISATLAAARPGAIPVLVDPK-GTDF--SRYSGATLLTPNRREAEAASGIAIHDIESLVRAAGVIM
HLDE_VIBVU      GALEHVEALIAKARAANVPVFIDPKGTNF---EPYRGATLLTPNMSEFEAVVGKVTSDDDLVEKALGLIE
HLDE_VIBSL      GALEHVQSFIQKARAANVPVFIDPKGADF---ERYRGATLLTPNMAEFELVAG-KVKSEDEMIEKGLALI
ADK_TOXGO       NALEVAGYAHGIPNTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHVAAEKTALSTANKLL
SCRK_SALTH      ----------------------------------------------------------------------
HLDE_VIBFM      GALEHVQSMIQEARKVNVPVFIDPKGADF---ERYRGATLLTPNMLEFETVVG-KVKDEDDLVAKGQQII
HLDE_PHOPR      --LEHVSAMIKLARDAGKPVFIDPK-GTDF--ERYRGATLLTPNLSEFELVAG-KVTSDDELVEKGFELI
SCRK_RHILT      SPCGETYEAL-LDREAASRVILDPNIRPGFIKDKPSHMARIKRMAAKSDI---VKFSDEDDHDALAAHWL
HLDE_HAHCH      DP-----QAFQLARSKQIPVLVDPK-GSDF--EKYRGATLITPNLSEFEAVVGHCTSEAELVQRGXXXXX
HLDE_GEOBB      ----VLSAVCRSGRELGIPVVVDPKGN----DYGKRGATILTPNRKEAEIASGVAITDQESLQCAASGLL
HLDE_SHESH      QPQEFIQKAIAKG----VKVLVDPK-GSDF--SRYRGASLITPNMGXXXXXXXXXXXXXXXXXKAQALLS
YZ37_SYNY3      SXXXXXXXXXXXXXQSGVKTCLDPNMAKFFQDGLKEGVDLLFANEAEALEMAGTSDLNQAICKSIA----
LACC_STAHJ      TSYYA--DIVKLANKQGLPTILDSS-GQSLMDVLENKPSVIKPNIDESQLLDTTVTTDIDSLKEAVTQPI
HLDE_VIBF1      GALEHVQLMIQEARKVNVPVFIDPKGADF---ERYRGATLLTPNMLEFETVVG-KVKDEDDLVAKGQQII
HLDE_AERHH      ------------ARAAGIPVLVDPK-GTDF--EKYRGATLLTPNMSEFEAVVGKVKSEEELVAKGLELVK
HLDE_PASMU      GTLNQVQKMIQLARQANIPVLIDPK-GTDF--ERYRGATLLTPNMSEFEAVVGKCDSXXXXXXXXXXXXX
HLDE_ERWT9      -----------LARKAGVPVLVDPK-GTDF--SRYHGATLLTPNLSEFEAVVGKCKSEADIVERGTALMQ
HLDE_YERE8      ----------QLARKAKVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGHCKNEEELVSRGMKLVA
HLDE_METCA      ---------------------------------------LLTPNLSEFEAVVGACCDDAEIERKGRALMT
HLDE_AERS4      ------------ARAAGIPVLVDPK-GTEF--EKYRGATLLTPNMSEFEAVVGKVKGEEDLVAKGLALVK
Y1655_HAEIN     TSMNSVQDIIAQAKQAGIKTLVGPL--------LKQNLDVILPNSRAIPQLCYYGLSPEDEAESAANKMW
HLDE_PECCP      ---------------------------------------LLTPNLSEFEAVAGRCKTEEELVERGMQLVA
HLDE_CAMFF      ---------------------------------------LLTPNKKEASEALGFGINDEDDLKHALKMLK
THID_MYCTU      ----------------------DPLLAPSALDSLRGQLTLLTPNLDEARLLVDIEVVDAESQRAAAKALH
THID_MYCBO      ----------------------DPLLAPSALDSLRGQLTLLTPNLDEARLLVDIEVVDAESQRAAAKALH
LACC_STRPC      LPAGMPDDYYKIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTDFEALKEVLQDEL
LACC_STRPB      LPAGMPDDYYKIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTDFEALKEVLQDEL
HLDE_RHOP5      LTARLIRETIDAAKKLGKRVIVDPKSPNFAL---YRGATLLTPNRKEFCEATRXXXXXXXXXXXXXXXXM
LACC_STRPM      LPAGMPDDYYKIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTDFEALKEVLQDEL
LACC_STRPD      LPAGMPDDYYKIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTDFEALKEVLQDEL
LACC_STRA5      SPSDYYARLISLANHFNKKVVLD-CSGEALRSVLKSSAKVIKPNLEELTQLIGKPIYSLDELKSTLQQDL
LACC2_STRA3     SPSDYYARLISLANHFNKKVVLD-CSGEALRSVLKSSAKVIKPNLEELTQLIGKPIYSLDELKSTLQQDL
HLDE_WOLSU      TP-RVCQTIIQMAKTLQKRVLVDPKGR----DYSKRGASLLTPNKKEAKEATGIEINDEASXXXXXXXXX
HLDE_SERP5      --LSQVQSMIQLARAAKVPVLIDPK-GSDF--ERYRGATLLTPNLSEFEAVVGHCKDEAELVERGMKLVA
PYRH_META3      VDGVYDKDPRKHAKQLTTKELLNEAGSSTIIDPLASKI--------------------------------
LACC_STAAR      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
HLDE_AZOVD      -----------------------------------RGADLITPNLAEFENVVGRCADEGELVARGARLMA
Y1336_METJA     AKGLITKELMDIKKEFKGKILIDPKPKNDFY----KDVYLIKPNLKEASQILGREIENDDELEKSGLESV
PDXK_SHEEP      --------------------------------------DIITPNQFEAELLTGRKIHSQEEALEVMDMLH
PDXK_BOVIN      --------------------------------------DIITPNQFEAELLTGRKIHTQEEALEVMDMLH
THID_STAAR      --------------------------------------DVVTPNLPEAEEITGLTIDSEEKIMQAGRIFI
HLDE_PSEFS      GALKNHQELIQAAKAKGIPVLADPK-GKDF--SIYRGASLITPNLSEFEAIVGGCADEHDLVTKXXXXXX
PYRH_METMP      ----------------------------------------------------------------------
PDXK_HUMAN      ----------------------------DLLPVYKEKVDIITPNQFEAELLSGRKIHSQEEALRVMDMLH
LACC1_STRA3     TEFYV--QLVEIAHQFGNKVVLD-CSGVALQAALGSPVKAIKPNNEELSQLLGREVSDLNELKEVLSEPL
HLDE_SHEPW      ------------AKSQGVKVLVDPKGS----DFSKRGATLLTPNLHEFELVAGAVTSEADLVEKAHKLLE
HLDE_NITOC      --LQEPQRLIALGREVGVPILIDPKGADF---SHYHGATIITPNLAEFEMVVGPCPDEASLVWKGEXXXX
FRLD_ECOLI      VHAAIWGHAEDAFPQLHAAGKLTAFDFSDKWDSLVPHLDFAFASAPQ----------EDETLRLKMKAIV
ADK_DICDI       TVSP--DSAVHLGKHANDKPFLYGLAAPFLIDELLPYVDIVFANESEAATLEDLTVIAEKLA--AWEKVN
THID_STAAW      --------------------------------------DVVTPNLPEAEEITGLTIDSEEKIMQAGRIFI
THID_STAAS      --------------------------------------DVVTPNLPEAEEITGLTIDSEEKIMQAGRIFI
THID_BACSU      --------------------VLYPEHAQALREQLAPLATVITPNLFEASQLSGLKTVDD--MIEAAKKIH
PYRH_METM7      ----------------------------------------------------------------------
PYRH_METM5      ----------------------------------------------------------------------
PDXK_PIG        --------------------------------------DIITPNQFEAELLTGRRIHSEEEALAVMDMLH
LACC_STRA1      SPSDYYARLISLANHFNKKVVLD-CSGEALRSVLKSSAKVIKPNLEELTQLIGKPIYSLDELKSTLQQDI
HLDE_SHEON      -----------LARSKGVKVLVDPK-GSDF--SRYHGASLITPNMSEFEAVVGAVTSEADLLEKARGLLN
HLDE_CAMJ8      ---------------------------------------LLTPNKKEALEALKFENLEGENLEKGIKKLK
HLDE_ALISL      ------------ARKAGVPVFIDPKGADF---ERYRGATLLTPNMLEFETVVG-KVKDEEDLVVKGQQII
AK3_BACSU       ALIMVVGEAMRH----NVGTTARAAKA---LSEAQVNIEMINQGSSEVSMMFGVKEAEE---RKAVQALY
SCRKL_DICDI     ----------------------------------------------------------------------
LACC_STAEQ      LPKGLNTDYYRLAKEQGILTILDSS-GQSLEEVLISNVKVIKPNIDELSQLLNYKVTNDKELKAAVSQPI
LACC_ENTFA      IPSDFYQELVQKAHAQEVKVLLDTSG-----DSLRQVLQLIKPNLEELEGLLGQDFSENPLAQTALTKPM
IOLC_BACSK      ----------------------------------------------------------------------
PYRH_METM6      ----------------------------------------------------------------------
PDXY_VIBF1      --------------------IVAPEVETFFKESALSSADIIAPNLLELESLTGMTINTLDQVIEANNQLL
PDXK_MOUSE      -------------------------------DKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLH
LACC_STRP3      LPAGMPDDYYQIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTKDFKALKAVDELF
LACC_STAAB      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
HLDE_PSEPK      -----------------------------------RGASLITPNLSEFETIVGRCVDEAELVAKXXXXXX
HLDE_PSEPG      -----------------------------------RGASLITPNLSEFETIVGRCTDEADLVAKXXXXXX
HLDE_PSEP1      -----------------------------------RGASLITPNLSEFETIVGRCVDEAELVAKXXXXXX
THID_AQUAE      -------------RSKSGRELLSEEGVEFLKSEFIKIVDLITPNVPEAEILCGEEIKSLEDVKNCAQKIY
LACC_STRPG      LPAGMPDDYYQIANLNGKKTVLDSGNALEAVLKGDSKPTVIKPNLEELSQLLGKEMTDFEALKEVLQDEL
LACC_STAES      LPKGLNTDYYRLAKEQGILTILDSSGQS--LEEVNEKPTVIKPNIDELSQLLNYKVTNDKELKAAVSQPI
LACC_STAAW      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAT      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAS      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAN      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAM      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAE      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAAC      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAA9      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAA8      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAA3      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAA2      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
LACC_STAA1      APKGLNQDYYERCQNKGVPVILDCSGATTVLENPYKPT-VIKPNISELYQLLN-QPLDEESLKQAVSQPL
FTSY_RICPR      ------------------------------------------------------KTIDSDTVKEAIAKLI
DNLJ_RICAE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
RBSK_ECOLI      EKGIRTVLITLGSRGV-WASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEXXXXXXXX
RBSK_ECO57      EKGIRTVLITLGSRGV-WASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEXXXXXXXX
RBSK_HAEIN      DKGIETVMITLGAKGVFVSRK-GKSRIIKGFCVQAIDTTAAGDTFNGGFVTALEKSFD---EAIRFGQAA
RBSK_SCHPO      SFGVRKVIITLGSQGAYYKSANGESALVSACKVKAVDTTAAGDTFIGAFSNSI-AHGQPLKDSLEFAAKC
RBSK_LACLA      KKYSNRLIVTLGSEGVIFHDGE-TLQKIPAIKAKVVDTTGAGDTFNGAFAFGLTENLS-ISDSIRLAVVA
RBSK_BACSU      -----KLFITEGKQGVRYSAGSKEV-LIPSFPVEPVDTTGAGDTFNAAFAVAL-AEGKDIEAALRFANRA
RBSK_BACHD      ----QKLIMTKGADGVQFYENDEQVQ-VESFRVEPVDTTGAGDTFNGAFAVAL--GGGTVKEAVRFANAA
RBSK_MOUSE      ERGCQVVVITLGASGCVILSQEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYL-AYYPNLEEMLKRSNFI
RBSK_HUMAN      KRGCQVVIITLGAEGCVVLSQEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYL-AYYPNLEDMLNRSNFI
RBSK_DICDI      KENFENIIVTLGGNGQLLVSKENNCHIELKEKVKVVDTSGAGDSFIGSFAHYLVTENKPLKDSIESASKV
RBSK_YEAST      NRKKRGIVVTLGSRGVLFCSHESEVQFLPAIQVSVVDTTGAGDTFLGGLVTQLYQG-ETLSTAIKFSTLA
SCRK5_ARATH     HDKLKLLIVTDGEKGCRYYTKKFKGR-VPGYAVKAVDTTGAGDSFVGAFLVSLGKDGSKLKEALAFANAC
SCRK2_SOLHA     HPNLKLLLVTLGEKGCNYYTKK-FHGTVGGFHVKTVDTTGAGDSFVGALLTKIDQTIARLKEVLRFSCAC
SCRK1_ORYSI     RPTMKLLLVTLGDQGCKYYARD-FRGAVPSYKVQQVDTTGAGDAFVGALLRRIVQDPSSLQEAIKFANAC
SCRK1_ORYSJ     RPTMKLLLVTLGDQGCKYYARD-FRGAVPSYKVQQVDTTGAGDAFVGALLRRIVQDPSSLQEAIKFANAC
SCRK2_SOLLC     HPNLKLLLVTLGEKGCNYYTKK-FHGTVGGFHVKTVDTTGAGDSFVGALLTKIDQTIARLKEVLRFSCAC
SCRK3_ARATH     HPNLKLLLVTLGEKGCTYFTKK-FHGSVETFHVDAVDTTGAGDSFVGALLQQIDQSVARLRKVLRFANAC
SCRK1_MAIZE     RPTMKLLLVTLGDQGCKYYARD-FHGAVPSFKVQQVDTTGAGDAFVGALLQRIVKDPSSLQESIKFANAC
SCRK2_ARATH     HPNLKLLLVTLGENGCRYYTKD-FHGSVETFHVDAVDTTGAGDSFVGALLNQIVDDQSXXXXXXXFANAC
SCRK4_ARATH     XXXXXXXXVTLGEKGCRYYTKSFRGSVDP-FHVDAVDTTGAGDSFVGALLCKIDRAVARLREVLRLANAC
SCRK1_ARATH     HPNLKLLLVTLGEKGCRYYTKTFKGAVDP-FHVNAVDTTGAGDSFVGALLNQIDRSVERLRKVLRFANAC
SCRK_SOLTU      HPNLKLLLVTLGEKGCNYYTKK-FHGSVGGFHVKTVDTTGAGDSFVGALLTKIDQAIARLKEVLRFSCAC
SCRK2_ORYSJ     FDGLKLLIVTDGEKGCRYFTKD-FKGSVPGFSVNTVDTTGAGDAFVGSLVAKDDSIFHNLREALKFSNAC
SCRK2_ORYSI     FDGLKLLIVTDGEKGCRYFTKD-FKGSVPGFSVNTVDTTGAGDAFVGSLVAKDDSIFHNLREALKFSNAC
SCRK2_MAIZE     FDGLKLLVVTDGDKGCRYFTKDFKGS-VPGFKVDTVDTTGAGDAFVGSLVAKDDSIFHNLREALKFSNAC
YDJE_BACSU      EIGANIVAVTLGKSGTLLSNKDR--EIIPSIPVTSIDSTGAGDAFVGAALYQLDADFVKLREIVAFANKV
YDJH_ECOLI      ACGVKTVVIKTGKDGCFIKRGDMTMKVPAVAGITAIDTIGAGDNFASGFIAAL-LEGKNLRECARFANAT
KDGK_BACSU      KKGASFVAIKLGKEGAYFKTGTSEGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLS-YKDAVQRGNAI
Y356_ARCFU      EMGIEIVAVKLGSEGCWIKKGDREVTVKPV-STKVVDTTGAGDAF-------------------------
K6PF2_ECOLI     NSGAKRVVVSLGPQGALGVDSENCIQVVPP-PVKSQSTVGAGDSMVGAMTLKLAEN-ASLEEMVRFGVAA
HLDE_THICR      EINIDALLVTRSEHGMALIEKDAGATILKSRAQEVFDVTGAGDTVIATLATAFGSGLS-MPKSVKLANEA
YEIC_ECOLI      QHGLNRLVLSMGGDGVYYSDISGESGWSAPIKTNVINVTGAGDAMMAGLASCWVDGMP-FAESVRFAQGC
IOLC_LISMO      QHQAKIVVIKHGVEGSFAYTKAGETFQAQAYKTKVLKTFGAGDSYASAFLYGL-FSDESIETALKYGSAA
IOLC_LISMH      QHQAEIVVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGL-FSGESIETALKYGSAA
IOLC_LISMF      QHQAEIVVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGL-FSGESIETALKYGSAA
IOLC_LISMC      QHQAEIVVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGL-FSGESIETALKYGSAA
IOLC_CLOPE      DYGNKIVVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEGW-DMMDALEFGSAS
IOLC_CLOP1      DYGNKIVVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEGW-DMMDALEFGSAS
YEII_ECOLI      QQGVQQLFVYLPDESVYCSEKDGEQFLLTAPAHTTVDSFGADDGFMAGLVYSFLEGYS-FRDSARFAVAC
IOLC_LISIN      KHKAEIIVIKHGVEGSFAYTKAGETFRAQAYKTKVLKTFGAGDSYASAFLYGL-FSGENIETALKFGSAA
IOLC_CLOTE      GYGNKIVVIKHGKDGSTAYLHDGTSYKIKPFPVKLLKSFGGGDAYASAFIYGIMEGW-DVIDALEFGSAS
SCRK_VIBAL      AMNIALVLVTQGAKGVW-RVFESQSELITGQVVSPIDTTGAGDAFVGGLLACLSADWKNVSSAIQWANGC
ADK_PHYPA       AGGTHKAVITQGTDPTIVAEDGKVTEVTPIPKEKLVDTNAAGDSFVGGFLSQLVLG-KDIAQCVRAGNYA
IOLC_PHOPR      RANTQVVIVKAGELGSKVYCKDGHKFQQGIFRVEVKKPFGSGDSFAGGLIWTL-VNGGELEDGVKHGSAA
IOLC_CLOBA      GFGNKIVVIKHGKEGSTAYTNDGKSYKIKPFPVKLLKSFGGGDAYASAFIYGILEEW-DIMDALEFGSAS
YIHV_ECOLI      N---GHVYVTQGSAGCDW-LENGGRQHQPAFKXXXXXXXXXXXXFHGALAVALATS-GDLAESVRFASGV
Y406_METJA      -------IVTKGSKGSVIYTKDKKIE-IPCIKAKVIDPTGAGDSYRAGFLSAYVKGY-DLEKCGLIGAAT
IOLC_CLOB8      DYGNKIVVIKHGKEGSTAYTSDGKSYNIKPFPVKLLKSFGGGDAYASAFLYGLLEGWS-IIDSLEFGSAS
IOLC2_BACCZ     SHHAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC_MYCH7      DDDVDLIIIKNGKKGSYQKDKKLVAKIVP---VKMLKGYGGGDAYASLFLDHYLKNESDLENGLALATSA
IOLC_MYCH2      DDDVDLIIIKNGKKGSYQKDKKLVAKVVP---VKMLKGYGGGDAYASLFLDHYLKNESDLENGLALATSA
YURL_BACSU      GYGAKMVCMTRGGQGAILSAGDRVYH-QPIVEADIIDTLGAGDSFIAGFLTKQDITYA-LRQAAETAAK-
IOLC_MYCHJ      DDDVDLIIIKNGKKGSYQKDKKLVAKIVP---VKMLKGYGGGDAYASLFLDHYLKNESDLENGLALATSA
Y1544_METTH     EMGPGVVVKTYGKEGSIIYSDDVI--KIDAIPREAVDPTGAGDSYRAGFM-RAYLRGADLKTCGRFASAV
HLDE_ACTSZ      DYDLTALLITRSEKGMTLLRPNQPAFHLPTEAKEVYDVTGAGDTVISVLATAL-ADGRTVEEACYLANVA
IOLC_BACHK      SHHAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC_BACAN      SHHAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC_BACAC      SHHAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC_BACAA      SHHAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC1_BACCZ     SHYAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLIQGL-EIPQAMRLGGAS
HLDE_BLOPB      DYNLSALLITRSERGMTLCTRYAAPLYFSTQKKKVYHVTGAGDTVVGVLSAAL-SSGKSLEKACFLANLA
HLDE_ACTP2      DFELTALLVTRSEKGMTLLRPNQAPFHLPTQAKEVYDVTGAGDTVISVLATAI-ADGRPYEEACYLANAA
K1PF_HAEIN      AEGIENVIISMGAKGSLWINNEGVLKAEPAQCENVVSTVGAGDSMVAGLIYGFEKGLS------------
IOLC_CLOBB      GFGNKIVVIKHGKEGSTAYTNDRKSYKIKPFPVKLLKSFGGGDAYASAFIYGILEEW-DIMDALEFGSAS
HLDE_SALDC      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_ARCB4      EKDLEVSLITLSEQGI--AIFDENLTIKPTVAREVYDVTGAGDTVIASIAFALGNDL-NINEAVSFANLA
HLDE_GEOMG      ATALTALVITRSEEGMSLFLRDGGVVHIPTFAREVFDVTGAGDTVLAIL---------------------
HLDE_GEOLS      STGLDNLLITRSEEGMSLFCGNGETVHIPTVAREVFDVTGAGDT-VXXXXXXXXXXXXXXXESARLANVA
HLDE_CAMC5      NENLKYSIVTLSEEGIALFDKE--LEIFPAEAKEVFDVTGAGDTVLATLGFML-ASKKDIKEAIKMANLA
IOLC_BACC3      SHYAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
IOLC_BACAH      SHYAKIVVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGL-EIPQAMRLGGAS
HLDE_SALTY      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALTI      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALSV      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALPK      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALPC      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALPB      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALPA      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALNS      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALHS      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALG2      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALEP      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALCH      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_SALA4      DYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_HAEIE      DIELTALLVTRSEKGMTLLRPNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRS-FEESCYLANVA
HLDE_HAEI8      DIELTALLVTRSEKGMTLLRPNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRS-FEESCYLANVA
HLDE_GEOSL      ETALTALVITRSEEGMSLFLRGGQVVHIPTYAREVFDVTGAGDT--------------------------
ADK1_ARATH      TQGADPVVVAEGKVKKY--------PVIPLPKEKLVDTNGAGDAFVGGFLSQL-VHGKGIEECVRAGCYA
HLDE_SULDN      DANLAISLITLSEDGAIY---DDEMKIFPTVAKEVFDVTGAGDTVIASIAFAISAG-KSIEESAKFANLA
HLDE_CITK8      DFEFSALLVTRSEQGMTLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACYFANAA
HLDE_ACTPL      DFELTALLVTRSEKGMTLLRPNQAPFHLPTQAKEVYDVTGAGDTVISVLATAI-ADGRPYEEACYLANAA
K1PF_SHIFL      EQGIAHVVISLGAEGALWVNASGEWIAKPP-SVDVVSTVGAGDSMVGGLI--------------------
K1PF_ECOLI      EQGIAHVVISLGAEGALWVNASGEWIAKPP-SVDVVSTVGAGDSMVGGLI--------------------
K1PF_ECOL6      EQGIAHVVISLGAEGALWVNASGEWIAKPP-SVDVVSTVGAGDSMVGGLI--------------------
K1PF_ECO57      EQGIAHVVISLGAEGALWVNASGEWIAKPP-SVDVVSTVGAGDSMVGGLI--------------------
HLDE_NITSB      KEDLQSLIVTLSEEGMAIFEEEMM--RIPTVAKEVYDVTGAGDTVLAALGYAV-AKGKNLKEAAVFAN--
Y1459_PYRHO     NQGVELTAITLGPKGCRLIKNETVVD-VPSYNVNPLDTTGAGDAFMAAXXXXXXXXXXXXXXXXXFANLV
IOLC_LACCA      QYDANLIVIKSGIQGSNAYTKAGETYHFGVFKTKVLKSFGAGDSFAAGFLYAYQHQL-GLETALKYGSAA
HLDE_SALAR      NYDLSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNTLEEACYFANAA
HLDE_MANSM      DIELSALLVTRSEKGMTLLRPGQEAYHLPTEAKEVFDVTGAGDTVISVLATALADGRS-FEEACFLSNVA
HLDE_DICNV      DAGISAFLITQSEKGMTYVTAQQHYHL-PAQAREVFDVTGAGDTVIATLACALASGY-DCESAMIFANAA
HLDE_HAEIG      DIELTALLVTRSEKGMTLLRPNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRS-FEESCYLANVA
Y057_BUCAP      SENLSALLVTRSKNGMTLFQPEKQPIHFPALSKTASDVTGAGDTVISIIASSLATGYS-LEEACFYANVG
IOLC_GEOTN      DYHAKIVVIKHGKDGSIAYTKTGETFVGTIFPANIVKTFGAGDSYAAGFI--------------------
Y060_BUCAI      XXXXXXXXVTRSKNGMTLFQKEKKPIHFPAASKIASDVTGAGDTVIAIIAASLATGYS-LEEACFYANIG
HLDE_ENT38      DFDFSALLVTRSEQGMTLLQPGKPPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACYFANAA
IOLC_GEOKA      DYNAKIVVIKHGKDGSIAYTKTGETFVGTIFPANIVKTFGAGDSYAAGFI--------------------
HLDE_KLEP3      AEELSALLVTRSEQGMTLLQPGRPPLHMPTQAQEVYDVTGAGDTVIGVLAATL-ASGNTLEEACYFANAA
SCRK_ECOLX      AM----LLVTKGAEGVVVCYRGQVHHFA-GMSVNCVDSTGAGDAFVAXXXXXXXXXXXEMRRIIDLAQRC
LACC_LACLA      FSGIEWIVVSLGRNGAFAKHGD-VFYKXXXXXXXXXXXXGSGDSTVAGIASALNSKKSD-----------
HLDE_SHEPA      AFDLTAMLVTRSEKGMTLITKDQPELHIPTVAREVYDVTGAGDTVISALATAI-AAGSDLPQACAIANTA
HLDE_ECOHS      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
IOLC_BACHD      KHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYAL-ISGKGIETALKYGXXX
HLDE_SHISS      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_SHIF8      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_SHIBS      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_SHIB3      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_KLEP7      AEELSALLVTRSEQGMTLLQPGRPPLHMPTQAQEVYDVTGAGDTVIGVLAATL-ASGNTLEEACYFANAA
HLDE_HAEDU      DLELSALLVTRSEKGMTLLRPNHPPFHLPTQAKEVYDVTGAGDTVISILATAI-ADGRPYEEACYLANAA
HLDE_ECOUT      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOSM      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOSE      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOLU      DYELSALLVTRSEQGMSLLQPGKTPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOLI      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOLC      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOL6      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOL5      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOK1      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECODH      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECOBW      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO8A      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO81      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO7I      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO5E      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO57      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO55      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO45      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO27      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_ECO24      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_DESAA      EAGAEKILITLGKDGMALFSPGEEPFRVHAQARQVFDVSGAGDTVISVL---------------------
HLDE_SHIFL      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_HAES1      DLDLSALLVTRSEKGMTLLRPNNAPFHLPTEAKEVFDVTGAGDTVISVLATALADGRS-YEEACYLANVA
IOLC_BACSU      GHSADLVVIKHGVEGSYAYSKSGEVFRAQAYKTKVLKTFGAGDSYASAFIYGL-VSGKDIETALKYGXXX
HLDE_ESCF3      DYELSALLVTRSEQGMSLLQPGKEPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_SHEHH      AYDFTAMLVTRSEKGMTLITRDQPELHIPTVAREVFDVTGAGDTVISALATAI-AAGSDLPQACAIANTA
HLDE_SHEFN      KHDFEAILVTRSEKGMTLVSQNQPELHIPTVAREVHDVTGAGDTVISALATSI-AAGASLAQACAIANTA
HLDE_MAGSM      QSDVAFLAVTLSEQGIALVDGSEHPRRIPAMAQEVYDVSGAGDTVI------------------------
HLDE_HAEIN      DIELTALLVTRSEKGMTLLRPNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRS-FEESCYLANVA
HLDE_SHIDS      DYELSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVYDVTGAGDTVIGVLAATL-AAGNSLEEACFFANXX
HLDE_PELCD      QRDLETLMVTRSEEGISIFFRNGEEVHLPTQAREVYDVTGAGDT--------------------------
HLDE_ENTS8      DFDLSALLVTRSEQGMTLLQPGKAPFHLPTQAQEVYDVTGAGDTVIGVLAATL-ASGNSLEEACFFANXX
IOLC_BACLD      AHSADLVVIKHGVEGSYAYSKSGDVFRAKAYKTKVLKTFGAGDSYASAFLYGL-VSGKDIETALKY----
HLDE_PSEHT      DAGIKAMLLTRSEQGMSLISATEKYDFA-AQELEVSDVTGAGDTVIATLAVMLGAGMTP-KNAVEIANLA
HLDE_COXBN      QYRFEAILITRGKQGMMLIQKEGAAINLVAHAREVYDVTGAGDTVIAVMAASL-AAGGDFYEAAQLANLA
ADK_HUMAN       SKRQRIVIFTQGRDDTIMATESEVTAVLDQDQKEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYA
ADK2_ARATH      TQGADPVVVAEGKVKKY--------PVIPLPKEKLVDTNGAGDAFVGGFMSQL-VKEKSIEECVKAGCYA
HLDE_PSEU2      ELDLGALLVTRGEHGMTLLRPDQQALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEELPHAVALANLA
HLDE_SHESR      KHQFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGAELPQACAIANTA
HLDE_SHESM      KHQFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGAELPQACAIANTA
HLDE_SHESA      KHQFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGAELPQACAIANTA
HLDE_COXBU      QYRFEAILITRGKQGMMLIQKEGAAINLVAHAREVYDVTGAGDTVIAVMAASL-AAGGDFYEAAQLANLA
HLDE_COXBR      QYRFEAILITRGKQGMMLIQKEGAAINLVAHAREVYDVTGAGDTVIAVMAASL-AAGGDFYEAAQLANLA
PDXK_DICDI      KMGVKNVVIT------------------------------------------------------------
HLDE_SHESW      EHHFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_SHEPC      EHHFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_SHEB8      QHNFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_PSE14      ELDLGALLVTRGEHGMTLLRPDQQALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEELPHAVALANLA
HLDE_SHEB9      QHHFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_SHEB5      QHHFDAILVTRSEKGMTLVTTNAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_SHEB2      QHHFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGADLPQACAIANTA
HLDE_PROMH      DLALDALLITRSERGMSLLQANEAPLHLPTQAQEVYDVTGAGDTVIGVLATAL-----------------
HLDE_HELAH      ETHIAMPLVTLSEQGIAFLEKNELINC-PTIAKEVYDVTGAGDTVIASLTLSLLES-KNLKEA-------
HLDE_PSESM      ELDLGALLVTRGEHGMTLLRPDQQALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEELPHAVALANLA
HLDE_MARAV      DAGIDTMLLTRSEQGMSLITPTEHHHF-PAEVLEVSDVTGAGDTVIATLGTLLSAGF-DLKDAAWLSNLA
ADK_RAT         SKRQRTVIFTQGRDDTIVATGNDVTAVLDQNQEEIVDTNGAGDAFVGGFLSQL-VSNKPLTECIRAGHYA
SCRK_SALTY      AYGIASVLVTRGKAGVLAAFQQKFTHF-NARPVASVDTTGAGDAFVAGLLASLPTDMTALEPTLTLAQTC
LACC_STRSV      FDGIEWIIVSLGADGAFAKHWETFYK-VDIPKIQVVNPVGSGDSTVAGISSAL----SHQADDVSLLKKA
HLDE_PHOLL      GLDLQALLITRSEQGMSLLSVDQPPLHLPTQAQEVFDVTGAGDTVIGVLATAI-AAGKPLNEACFLANAA
IOLC_BACA2      AHSADLVVIKHGVDGSYAYSRSGEVFRAHAYKTKVLKTFGAGDSYASAFI--------------------
HLDE_SODGM      DYQLSALLITRSEQGMTLLQPGKDPLHLPTQAQEVYDVTGAGDTVIGVXXXXXXXG-NSLEDSCFLANAA
HLDE_SHEDO      THEFSAMLVTRSEKGMTLITADEPELHIPTVAREVYDVTGAGDTVISALATSLGAG-STLAQACAIANTA
ADK_MOUSE       SKRQRTVIFTQGRDDTIVAAENDVTAVLDQNQEEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYA
HLDE_VIBVY      KFELGALLVTRSEHGMTLVRPDQKPFHLPTQAKEVYDVTGAGDTVISVLAASV-----------------
KDGK_HAEIN      KIGIPKVIVKCGKNGAIFSDRSQYGQVIPEPILNVVDTTSAGDSFNAGFLNGYLRN-KSLEICCQQGNRI
HLDE_PSEPF      DLDLGALLVTRGEHGMTLLRPDHPALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEELPHAVALANLA
HLDE_HELHP      TQQLDISLITLSEDGIGIFDNNQI-HIIPTRAKEVYDVTGAGDTVIAAL---------------------
ADK_CRIGR       SKRPRTVVFTQGRDDTVVATENEVMAVLDQNQKEIIDTNGAGDAFVGGFLSQLVYN-KPLTECIRAGHYA
LACC_STRU0      FDGVEWVIVSLGSKGAFAKHIDSYYQ-VTIPKIEVVNPVGSGDSTVAGITSAL-----------------
K1PF_BACSU      EQGAEHVIVSMAGDGALLFTNEAV-YFANVPKGKLVNSVGAGDSVVAGFLA-------------------
HLDE_YERPY      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPS      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPP      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPN      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPG      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPE      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPB      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERPA      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_YERP3      DFELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_SHELP      EFDFEALLVTRSEKGMTLITADAPELHIPTVAHEVYDVTGAGDTVISALATSLAVG-CELPVACALANTA
INGK_ECOLI      D-WVDLVLCTAGPIGLY-----------------------------------------------------
INGK_ECOL6      D-WVDLVLCTAGPIGLY-----------------------------------------------------
INGK_ECO57      D-WVDLVLCTAGPIGLY-----------------------------------------------------
HLDE_PSEU5      QLELGALLVTRGEHGMTLLRPEHAPLHLPARAREVFDVTGAGDTVISTLAASL-AAGEELPQAVALANLA
HLDE_PSEF5      DLELGALLVTRGEHGMTLLRPDHPAMHLPARAREVFDVTGAGDTVISTLAAAI-AAGEELPHAVGLANLA
HLDE_ERWCT      DYELSALLITRSEQGMTLLQPGKAPLHLPTLAQEVYDVTGAGDTVIGVXXXXXXXG-NSLEEACFLANAA
HLDE_EDWI9      RFDLTALLVTRSEQGMTLLQR-GIAPLMPTQAQEVYDVTGAGDTVIGMLAASI-AAGASLDEACFLANAA
THIED_GEOSL     RLGARNVLL----KGGHLLAGDSVDILFAAFRILSKNTHGTGCTFASAIATYL-AQGDPLREAIARAKRY
HLDE_PELPD      ERGLEHLLITRSEEGMSLFSRSAAPMHIPTVAREVFDVSGAGDTVLASL---------------------
HLDE_VIBVU      KFELGALLVTRSEHGMTLVRPDQKPFHLPTQAKEVYDVTGAGDTVISVLAASV-----------------
HLDE_VIBSL      EEDFEALLVTRSEHGMTLLRKGVEPFHLPTQAKEVYDVTGAGDTVISVLAASV-----------------
ADK_TOXGO       TAGQNTVVMTRGHNPAAEQTADGTXXXXXXXXXKIVDTNGAGDAFVGGFLYALSQG-KTVKQCIMCGNAC
SCRK_SALTH      ------LLVTRGKAGVLAAFQQKFTHF-NARPVASVDTTGAGDAFVAGLLASLPTDMTALEPTLTLAQTC
HLDE_VIBFM      EEDFEALLVTRSEHGMTLLRRNMEPLHLPTQAREVFDVTGAGDTVISVLAASVST---------------
HLDE_PHOPR      ERDFEALLVTRSEHGMTLLQKGQAPLHLPTLAQEVYDVTGAGDTVISVLASSV-----------------
SCRK_RHILT      NHGAKLVVITKGAEGASGYTKD------------------------------------------------
HLDE_HAHCH      XXXXXXXXVTRSEQGMTL-LRAGRSELLPAQAKEVFDVTGAGDTVISVLAAAL-AAGSEMGQAVALANIA
HLDE_GEOBB      SLELDALLITRSEAGMSLFPAAGGAVHIPTVAREVFDVTGAGDTVISVL---------------------
HLDE_SHESH      EFDIEAILVTRSEKGMTLITADAPELHIPTVAREVYDVTGAGDTVISALATSL-AAGSDLPQACAIANTA
YZ37_SYNY3      ----KNFALTRGGAGSLIFDGENLL-TIGTPKVQPIDTVGAGDMYAGGFL--------------------
LACC_STAHJ      FKGIEWIIVSLGGDGAFAKHHQTFYKVIP--KIEVVNPVGSGDSTVAGIASGL-----------------
HLDE_VIBF1      EEDFEALLVTRSEHGMTLLRRNMEPLHLPTQAREVFDVTGAGDTVISVLAASVST---------------
HLDE_AERHH      RFELEALLVTRSENGMTL-IREGQPELLPAQAHEVYDVTGAGDTVISTLATSL-AAGKSLDEACALANTA
HLDE_PASMU      XXDLSALLVTRSEKGMTLLRPNQPAFHLATEAKEVFDVTGAGDTVISVLATGLADGRS-FEEACYLANVA
HLDE_ERWT9      QHALSALLVTRSEHGMTLLQPGKAPFHMPTQAQEVFDVTGAGDTVIGVLATAL-AAGNTLEESCFLANAA
HLDE_YERE8      DFELSALLVTRSEQGMTLLQPGKPPLHLPTQAQEVFDVTGAGDTVIGVXXXXXXXG-NSLEESCFLANAA
HLDE_METCA      RLDLEALLVTRGEHGMSLLRPTAGALHLPAHGKEVYDVTGAGDTVISVLAAALAVG-RPLTDAVALANLA
HLDE_AERS4      RFELEALLVTRSENGMTL-IREGQPELLPAQAHEVYDVTGAGDTVISTLATSLAAGMS-LDEACALANTA
Y1655_HAEIN     NDGVRNPLVAM-----------------------------------------------------------
HLDE_PECCP      DYELSALLITRSEQGMTLLQPGKAPLHLPTQAQEVYDVTGAGDTVIGVXXXXXXXG-NPLEEACFLANAA
HLDE_CAMFF      DKKLNYSLITLSEDGIALLDED--VKKFPALAKEVFDVTGAGDSVLATLGYCLASKMS-LEESIEIAN--
THID_MYCTU      ALGPQWVLV----KGGHLRSSDGSCDLL------------------------------------------
THID_MYCBO      ALGPQWVLV----KGGHLRSSDGSCDLL------------------------------------------
LACC_STRPC      FEGIEWIIVSLGADGVFAKHKDTFYN-VDIPKIKIVSAVGSGDSTVAGIASGL-----------------
LACC_STRPB      FEGIEWIIVSLGADGVFAKHKDTFYN-VDIPKIKIVSAVGSGDSTVAGIASGL-----------------
HLDE_RHOP5      DVACEALLVTQSERGMTLVVREGEAIHVPAHPVKVRDVSGAGDT--------------------------
LACC_STRPM      FEGIEWIIVSLGADGVFAKHKDTFYN-VDIPKIKIVSAVGSGDSTVAGIASGL-----------------
LACC_STRPD      FEGIEWIIVSLGADGVFAKHKDTFYN-VDIPKIKIVSAVGSGDSTVAGIASGL-----------------
LACC_STRA5      FRGIDWVIVSLGARGAFAKHGNHYYQ-VTIPKIEVINPVGSGDATVAGIASALE----------------
LACC2_STRA3     FRGIDWVIVSLGARGAFAKHGNHYYQ-VTIPKIEVINPVGSGDATVAGIASALE----------------
HLDE_WOLSU      XXXXXXFVITLSEDGI--GIFDQALERIPTIAQEVYDVTGAGDTVIASLAYGLSLGYP-LRECALF----
HLDE_SERP5      DFELSALLVTRSEHGMTL-LQPGIAPLLPTLAQEVFDVTGAGDTVIGVXXXXXXXG-NTLEESCFLANAA
PYRH_META3      ----------------------------------------------------------------------
LACC_STAAR      FEGIEWIIVSLGAQGAFAKHNHTFYRVIP--KISVLNPVGSGDSTVAGITSAI-----------------
HLDE_AZOVD      DLELGALLVTRGEHGMTLMRPGHPPLHLPARAREVFDVTGAGDTVISTXXXXXXXG-EELPQAVALANLA
Y1336_METJA     DKYNSNFVITRGEKGATLITVDEI----------------------------------------------
PDXK_SHEEP      SMGPDTVVIT------------------------------------------------------------
PDXK_BOVIN      SMGPDTVVIT------------------------------------------------------------
THID_STAAR      NEGSKGVIIKGGHSNDYLFTKEGV-QTFENERFKTKHTHGTGCTFSAVITAEL-AKGRPLFEAVHKAKKF
HLDE_PSEFS      XXXXXXXXVTRGEHGMTLLRPGHPAMHLPARAREVFDVTGAGDTVISTLAASI-AAGEELPHAVALANLA
PYRH_METMP      ----------------------------------------------------------------------
PDXK_HUMAN      SMGPDTVVIT------------------------------------------------------------
LACC1_STRA3     FEGIEWIIVSLGADGAFAKHWDTFYK-VDIPKIEVVNPVGSGDSTVAGISSAL-----------------
HLDE_SHEPW      EFDLEALLVTRSEQGMTLITAENKELHIPTVAREVHDVTGAGDTVI-XXXXXXXXXXXXXXEACAIANTA
HLDE_NITOC      XXXXXXXXITRGEQGMTLLEQGHSPVHLPTEAREVFDVTGAGDTVISVLGAAL-AAGGTFKEATLLANQA
FRLD_ECOLI      ARGAGTVIVTLGENGSIAWDGAQFWRQAPE-PVTVIDTMGAGDSFIAGFLCGWSAGMT-LPQAIAQGTAC
ADK_DICDI       TKRTRTVVFTQGPD-ATLVFQNGVLTKYNPIKVATLDLNAAGDSFCGGFLA----AYSNGQE--------
THID_STAAW      NEGSKGVIIKGGHSNDYLFTNEGV-QTFENERFKTKHTHGTGCTFSAVITAEL-AKGRRLFEAVHKAKKF
THID_STAAS      NEGSKGVIIKGGHSNDYLFTNEGV-QTFENERFKTKHTHGTGCTFSAVITAEL-AKGRRLFEAVHKAKKF
THID_BACSU      ALGAQYVVITGGGKLKHEKAVDVLYETAEVLESEMIDTPGAGCTFSAAVTAEL-AKGAEVKEAIYAAKEF
PYRH_METM7      ----------------------------------------------------------------------
PYRH_METM5      ----------------------------------------------------------------------
PDXK_PIG        AMGPDTVVIT------------------------------------------------------------
LACC_STRA1      FRGIDWVIVSLGAKGAFAKHGNHYYQ-VTIPKIEVINPVGSGDATVAGIASALE----------------
HLDE_SHEON      KYQFDAILVTRSEKGMTLVTANAPELHIPTVAREVYDVTGAGDTVI------------------------
HLDE_CAMJ8      DFALRYSIITLSEAGI--ALFDEGLKIAPAKALEVYDVTGAGDSVIAVLAFCL-ASGIEIFKACELANEA
HLDE_ALISL      EEDFEALLVTRSEHGMTLLRSDMAPLHLPTQAREVFDVTGAGDTVISVLAASVST---------------
AK3_BACSU       QEFFAGVLIS------------------------------------------------------------
SCRKL_DICDI     ---------------------------------KVVDTTGAGDSFRAGLIFSLVHKNQSLSDSLEFASAC
LACC_STAEQ      FNDIEWIIVSLGSEGAFAK---------------------------------------------------
LACC_ENTFA      FAGIEWIVISLGKDGAIAKHHDQFYRVIPTIQAK--NPVGSGDATIAGL---------------------
IOLC_BACSK      ----------------------------------------------------------------------
PYRH_METM6      ----------------------------------------------------------------------
PDXY_VIBF1      EKGVKMVVVKHLSRAGIQKTEDGVSRPLYDFDAKR-QPVGAGDLISGVMLANLMAGYS------------
PDXK_MOUSE      CMGPDTVVIT------------------------------------------------------------
LACC_STRP3      E-GIEWIIVSLGADGVFAKHKDTFYN-VDIPKIKIVSAVGSGDSTVAGIASGL-----------------
LACC_STAAB      FEGVEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
HLDE_PSEPK      XXXXXXXXVTRGEHGMTLLRVGQPALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEDLPHAVALANLA
HLDE_PSEPG      XXXXXXXXVTRGEHGMTLLRVGQPALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEDLPHAVALANLA
HLDE_PSEP1      XXXXXXXXVTRGEHGMTLLRVGQPALHLPARAREVFDVTGAGDTVISTLAAAI-AAGEDLPHAVALANLA
THID_AQUAE      SLGAKSVLIKGG----------------------------------------------------------
LACC_STRPG      FEGIEWIIVSLGADGVFAKHNDTFYN-VDIPKIEIVSAVGSGDSTVAGIASGL-----------------
LACC_STAES      FNDIEWIIVSLGSEGAFAK---------------------------------------------------
LACC_STAAW      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAT      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAS      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAN      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTINV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAM      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTINV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAE      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAAC      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAA9      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTINV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAA8      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAA3      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTISV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAA2      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTINV--LNPVGSGDSTVAGITSAI-----------------
LACC_STAA1      FEGIEWIIVSLGAQGAFAKHNHTFYRVIPTINV--LNPVGSGDSTVAGITSAI-----------------
FTSY_RICPR      EQQLSNIILVCGVNGVGKTTTIGKLSALYSAEGKKV-AVAACDTFRAAAINQL-SSWVHRANALLITGKA
DNLJ_RICAE      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSK
RBSK_ECOLI      XXXXVTRKGAQPSVPWREEIDAFLD--
RBSK_ECO57      XXXXVTRKGAQPSVPWREEIDAFLD--
RBSK_HAEIN      AAISVTKKGAQSSIPTRQE--------
RBSK_SCHPO      SAITVQRKGAASSIPSLLEVDGSFNLK
RBSK_LACLA      SHLSIQKFGAQGGMPKLSEVKAKL---
RBSK_BACSU      ASLSVCSFGAQGGMPTRNEVEELLS--
RBSK_BACHD      AALSVQSFGAQGGMPTKAQVQSFLQEQ
RBSK_MOUSE      AAVSVQATGTQSSYPYKKDL-------
RBSK_HUMAN      AAVSVQAAGTQSSYPYKKDL-------
RBSK_DICDI      ASISVTRHGTQTSYPKSNEI-------
RBSK_YEAST      SSLTIQRKGAAESMPLYKDVQK-----
SCRK5_ARATH     GAVCTTQKGAIPALPTPADAQKLMKSK
SCRK2_SOLHA     GAITTTKKGAIPALP------------
SCRK1_ORYSI     GAITATKKGAIPSLPTEVEVLKLMES-
SCRK1_ORYSJ     GAITATKKGAIPSLPTEVEVLKLMES-
SCRK2_SOLLC     GAITTTKKGAIPALP------------
SCRK3_ARATH     GAITTTKKGAIPALPLKDQKKRQTNLK
SCRK1_MAIZE     GAITTTKKGAIPSLPTEAEV-------
SCRK2_ARATH     GAITTTKKGAIPALP------------
SCRK4_ARATH     GAITTTKKGAIPALPTESEVQSLL---
SCRK1_ARATH     GAITTTKKGAIPALPSDAEVRSFLEKK
SCRK_SOLTU      GAITTTKKGAIPALPTESE--------
SCRK2_ORYSJ     GAICTTKKGAIPALP------------
SCRK2_ORYSI     GAICTTKKGAIPALP------------
SCRK2_MAIZE     GAICTTKKGAIPALP------------
YDJE_BACSU      GALVCTKIGAIDALPSLDEI-------
YDJH_ECOLI      AAISVLSVGATTGVKNRKLVEQLL---
KDGK_BACSU      GALQVQAPGDMDGLPTREKLASFLSAQ
Y356_ARCFU      ---------------------------
K6PF2_ECOLI     GSAATLNQGT--RLCSHDDTQK-----
HLDE_THICR      ASIVVRKVGT--STVSKVELEEQLNA-
YEIC_ECOLI      SSMAL----------------------
IOLC_LISMO      ASIVVSKHSSSDAMPTADEIK------
IOLC_LISMH      ASIVVSKHSSSDAMPTADEIK------
IOLC_LISMF      ASIVVSKHSSSDAMPTADEIK------
IOLC_LISMC      ASIVVSKHSSSDAMPTADEIK------
IOLC_CLOPE      AAMLV----------------------
IOLC_CLOP1      AAMLV----------------------
YEII_ECOLI      AAIS-----------------------
IOLC_LISIN      ASIVVSKHSSSDAMPTADEIK------
IOLC_CLOTE      AAMLVASHSCSEAMP------------
SCRK_VIBAL      GALATTQKGAMTALPTQTEL-------
ADK_PHYPA       ASVIIQRSGC--TFPSKPSFESQ----
IOLC_PHOPR      AAINVSGNSCTEAMPTKE---------
IOLC_CLOBA      AAMLV----------------------
YIHV_ECOLI      AALKCTRPGGRAGIPDCDQTRSFLS--
Y406_METJA      ASFVVEAKGCQTNLPTWDKVVERL---
IOLC_CLOB8      AAMLV----------------------
IOLC2_BACCZ     ASIVISKHSCSDAMPTRAEI-------
IOLC_MYCH7      ASIMVQSHSSFDLPDYQKILEFKDNA-
IOLC_MYCH2      ASIMVQSHSSFDLPDYQKILEFKDNA-
YURL_BACSU      ---------------------------
IOLC_MYCHJ      ASIMVQSHSSFDLPDYQKILEFKDNA-
Y1544_METTH     ASFIVEDEGTQTNIPDTGEAVKRFTAQ
HLDE_ACTSZ      AGIVVGKLG------------------
IOLC_BACHK      ASIVISKHSCSDAMPTRAEI-------
IOLC_BACAN      ASIVISKHSCSDAMPTRAEI-------
IOLC_BACAC      ASIVISKHSCSDAMPTRAEI-------
IOLC_BACAA      ASIVISKHSCSDAMPTRAEI-------
IOLC1_BACCZ     ASIVISKHSCSDAMPTRAEI-------
HLDE_BLOPB      ASAVIKKSGTSTS--------------
HLDE_ACTP2      AGVVVGKLGTSTVTP------------
K1PF_HAEIN      ---------------------------
IOLC_CLOBB      AAMLV----------------------
HLDE_SALDC      AGVVVGKLG------------------
HLDE_ARCB4      AGVVVGKLGS-----------------
HLDE_GEOMG      ---------------------------
HLDE_GEOLS      AGIAVAKLGTSTVTP------------
HLDE_CAMC5      AAVVVAKIGS-----------------
IOLC_BACC3      ASIVISKHSCSDAMPTRAEI-------
IOLC_BACAH      ASIVISKHSCSDAMPTRAEI-------
HLDE_SALTY      AGVVVGKLG------------------
HLDE_SALTI      AGVVVGKLG------------------
HLDE_SALSV      AGVVVGKLG------------------
HLDE_SALPK      AGVVVGKLG------------------
HLDE_SALPC      AGVVVGKLG------------------
HLDE_SALPB      AGVVVGKLG------------------
HLDE_SALPA      AGVVVGKLG------------------
HLDE_SALNS      AGVVVGKLG------------------
HLDE_SALHS      AGVVVGKLG------------------
HLDE_SALG2      AGVVVGKLG------------------
HLDE_SALEP      AGVVVGKLG------------------
HLDE_SALCH      AGVVVGKLG------------------
HLDE_SALA4      AGVVVGKLG------------------
HLDE_HAEIE      AGIVVGKLG------------------
HLDE_HAEI8      AGIVVGKLG------------------
HLDE_GEOSL      ---------------------------
ADK1_ARATH      SNVVIQRSGC--TYPEKPD--------
HLDE_SULDN      AGVVVGKIGATVSISEIEEYEASLH--
HLDE_CITK8      AGVVVGKLG------------------
HLDE_ACTPL      AGVVVGKLGTSTVTP------------
K1PF_SHIFL      ---------------------------
K1PF_ECOLI      ---------------------------
K1PF_ECOL6      ---------------------------
K1PF_ECO57      ---------------------------
HLDE_NITSB      ---------------------------
Y1459_PYRHO     AALSTQKRGAW-STPRKDELLK-----
IOLC_LACCA      ASIVISQLSSSEAMPNLDQL-------
HLDE_SALAR      AGVVVGKLG------------------
HLDE_MANSM      AGIVVGKLG------------------
HLDE_DICNV      ASVVVGKLGTATLTP------------
HLDE_HAEIG      AGIVVGKLG------------------
Y057_BUCAP      ASIVIQKIG------------------
IOLC_GEOTN      ---------------------------
Y060_BUCAI      ASIVIQKIG------------------
HLDE_ENT38      AGVVVGKLG------------------
IOLC_GEOKA      ---------------------------
HLDE_KLEP3      AGVVVGKLG------------------
SCRK_ECOLX      GALAVTAKGAMTALPCRQELESE----
LACC_LACLA      ---------------------------
HLDE_SHEPA      AGIVVAKLG------------------
HLDE_ECOHS      XXXXXXKLG------------------
IOLC_BACHD      XXXXXXXXXXXDAMPSVEEIE------
HLDE_SHISS      XXXXXXKLG------------------
HLDE_SHIF8      XXXXXXKLG------------------
HLDE_SHIBS      XXXXXXKLG------------------
HLDE_SHIB3      XXXXXXKLG------------------
HLDE_KLEP7      AGVVVGKLG------------------
HLDE_HAEDU      AGIVVGKLG------------------
HLDE_ECOUT      XXXXXXKLG------------------
HLDE_ECOSM      XXXXXXKLG------------------
HLDE_ECOSE      XXXXXXKLG------------------
HLDE_ECOLU      XXXXXXKLG------------------
HLDE_ECOLI      XXXXXXKLG------------------
HLDE_ECOLC      XXXXXXKLG------------------
HLDE_ECOL6      XXXXXXKLG------------------
HLDE_ECOL5      XXXXXXKLG------------------
HLDE_ECOK1      XXXXXXKLG------------------
HLDE_ECODH      XXXXXXKLG------------------
HLDE_ECOBW      XXXXXXKLG------------------
HLDE_ECO8A      XXXXXXKLG------------------
HLDE_ECO81      XXXXXXKLG------------------
HLDE_ECO7I      XXXXXXKLG------------------
HLDE_ECO5E      XXXXXXKLG------------------
HLDE_ECO57      XXXXXXKLG------------------
HLDE_ECO55      XXXXXXKLG------------------
HLDE_ECO45      XXXXXXKLG------------------
HLDE_ECO27      XXXXXXKLG------------------
HLDE_ECO24      XXXXXXKLG------------------
HLDE_DESAA      ---------------------------
HLDE_SHIFL      XXXXXXKLG------------------
HLDE_HAES1      AGIVVGKLG------------------
IOLC_BACSU      XXXXXXXXXXXEAMPTAEEIEQLIEAQ
HLDE_ESCF3      XXXXXXKLG------------------
HLDE_SHEHH      AGIVVAKLG------------------
HLDE_SHEFN      AGVVVGKLG------------------
HLDE_MAGSM      ---------------------------
HLDE_HAEIN      AGIVVGKLG------------------
HLDE_SHIDS      XXXXXXKLG------------------
HLDE_PELCD      ---------------------------
HLDE_ENTS8      XXXXXXKLG------------------
IOLC_BACLD      ---------------------------
HLDE_PSEHT      AGIAVSKLGAATVSP------------
HLDE_COXBN      AGLVVRKLGA-----------------
ADK_HUMAN       ASIIIRRTGC--TFPEKPD--------
ADK2_ARATH      SNVVIQRSGC--TYPEKPD--------
HLDE_PSEU2      AGIVVGKLG------------------
HLDE_SHESR      AGVVVGKLG------------------
HLDE_SHESM      AGVVVGKLG------------------
HLDE_SHESA      AGVVVGKLG------------------
HLDE_COXBU      AGLVVRKLGA-----------------
HLDE_COXBR      AGLVVRKLGA-----------------
PDXK_DICDI      ---------------------------
HLDE_SHESW      AGVVVGKLG------------------
HLDE_SHEPC      AGVVVGKLG------------------
HLDE_SHEB8      AGVVVGKLG------------------
HLDE_PSE14      AGIVVGKLG------------------
HLDE_SHEB9      AGVVVGKLG------------------
HLDE_SHEB5      AGVVVGKLG------------------
HLDE_SHEB2      AGVVVGKLG------------------
HLDE_PROMH      ---------------------------
HLDE_HELAH      ---------------------------
HLDE_PSESM      AGIVVGKLG------------------
HLDE_MARAV      AGIVVAKLGAATVSP------------
ADK_RAT         ASVIIRRTGC--TFPEKPD--------
SCRK_SALTY      GALATTAKGAMTALPYQRDLNRQ----
LACC_STRSV      NVLAQEKMTGHVNVENYDDLYNQITVK
HLDE_PHOLL      AGVVVGKLG------------------
IOLC_BACA2      ---------------------------
HLDE_SODGM      AGVVVGKLG------------------
HLDE_SHEDO      AGVVVGKLG------------------
ADK_MOUSE       ASVIIRRTGC--TFPEKPD--------
HLDE_VIBVY      ---------------------------
KDGK_HAEIN      AGIVIQHKGAI----------------
HLDE_PSEPF      AGIVVGKLG------------------
HLDE_HELHP      ---------------------------
ADK_CRIGR       ASVIIRRTGC--TFPEKPD--------
LACC_STRU0      ---------------------------
K1PF_BACSU      ---------------------------
HLDE_YERPY      AGVVVGKLG------------------
HLDE_YERPS      AGVVVGKLG------------------
HLDE_YERPP      AGVVVGKLG------------------
HLDE_YERPN      AGVVVGKLG------------------
HLDE_YERPG      AGVVVGKLG------------------
HLDE_YERPE      AGVVVGKLG------------------
HLDE_YERPB      AGVVVGKLG------------------
HLDE_YERPA      AGVVVGKLG------------------
HLDE_YERP3      AGVVVGKLG------------------
HLDE_SHELP      AGIVVGKLG------------------
INGK_ECOLI      ---------------------------
INGK_ECOL6      ---------------------------
INGK_ECO57      ---------------------------
HLDE_PSEU5      AGIVVGKLG------------------
HLDE_PSEF5      AGIVVGKLG------------------
HLDE_ERWCT      AGVVVGKLGTSTVTP------------
HLDE_EDWI9      AGVVVGKLG------------------
THIED_GEOSL     ITAAIR---------------------
HLDE_PELPD      ---------------------------
HLDE_VIBVU      ---------------------------
HLDE_VIBSL      ---------------------------
ADK_TOXGO       AQDVIQHVG------------------
SCRK_SALTH      GALATTAKGAMTALPYQRDLNRQ----
HLDE_VIBFM      ---------------------------
HLDE_PHOPR      ---------------------------
SCRK_RHILT      ---------------------------
HLDE_HAHCH      AGIVVGKLG------------------
HLDE_GEOBB      ---------------------------
HLDE_SHESH      AGIVVAKLG------------------
YZ37_SYNY3      ---------------------------
LACC_STAHJ      ---------------------------
HLDE_VIBF1      ---------------------------
HLDE_AERHH      AGIVVGKLG------------------
HLDE_PASMU      AGIVVGKLG------------------
HLDE_ERWT9      AGVVVGKLG------------------
HLDE_YERE8      AGVVVGKLG------------------
HLDE_METCA      AGIVVGKLGTASVSP------------
HLDE_AERS4      AGIVVGKLG------------------
Y1655_HAEIN     ---------------------------
HLDE_PECCP      AGVVVGKLGTSTVTP------------
HLDE_CAMFF      ---------------------------
THID_MYCTU      ---------------------------
THID_MYCBO      ---------------------------
LACC_STRPC      ---------------------------
LACC_STRPB      ---------------------------
HLDE_RHOP5      ---------------------------
LACC_STRPM      ---------------------------
LACC_STRPD      ---------------------------
LACC_STRA5      ---------------------------
LACC2_STRA3     ---------------------------
HLDE_WOLSU      ---------------------------
HLDE_SERP5      AGVVVGKLG------------------
PYRH_META3      ---------------------------
LACC_STAAR      ---------------------------
HLDE_AZOVD      AGIVVGKLGATISVP------------
Y1336_METJA     ---------------------------
PDXK_SHEEP      ---------------------------
PDXK_BOVIN      ---------------------------
THID_STAAR      ISMSIQ---------------------
HLDE_PSEFS      AGIVVGKLG------------------
PYRH_METMP      ---------------------------
PDXK_HUMAN      ---------------------------
LACC1_STRA3     ---------------------------
HLDE_SHEPW      AGIVVAKLG------------------
HLDE_NITOC      AGIVVGKLGT--ASVTRDELQQALHPR
FRLD_ECOLI      AAKTIQYHGA-----------------
ADK_DICDI       ---------------------------
THID_STAAW      ISMSIQ---------------------
THID_STAAS      ISMSIQ---------------------
THID_BACSU      ITAAIK---------------------
PYRH_METM7      ---------------------------
PYRH_METM5      ---------------------------
PDXK_PIG        ---------------------------
LACC_STRA1      ---------------------------
HLDE_SHEON      ---------------------------
HLDE_CAMJ8      AAVVVSKIGSM-SVSFDEDFEKKIKSK
HLDE_ALISL      ---------------------------
AK3_BACSU       ---------------------------
SCRKL_DICDI     GALNCLSIGGCSSTPTLNSINQKLNNK
LACC_STAEQ      ---------------------------
LACC_ENTFA      ---------------------------
IOLC_BACSK      ---------------------------
PYRH_METM6      ---------------------------
PDXY_VIBF1      ---------------------------
PDXK_MOUSE      ---------------------------
LACC_STRP3      ---------------------------
LACC_STAAB      ---------------------------
HLDE_PSEPK      AGIVVGKLG------------------
HLDE_PSEPG      AGIVVGKLG------------------
HLDE_PSEP1      AGIVVGKLG------------------
THID_AQUAE      ---------------------------
LACC_STRPG      ---------------------------
LACC_STAES      ---------------------------
LACC_STAAW      ---------------------------
LACC_STAAT      ---------------------------
LACC_STAAS      ---------------------------
LACC_STAAN      ---------------------------
LACC_STAAM      ---------------------------
LACC_STAAE      ---------------------------
LACC_STAAC      ---------------------------
LACC_STAA9      ---------------------------
LACC_STAA8      ---------------------------
LACC_STAA3      ---------------------------
LACC_STAA2      ---------------------------
LACC_STAA1      ---------------------------
FTSY_RICPR      SA-------------------------
DNLJ_RICAE      ---------------------------