[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99260.1

[Show Plain Result]


## Summary of Sequence Search
    1::146
   37::136     5e-04  26%  144 aa  MARR_ECOLI RecName: Full=Multiple antibiotic resistance protein
   46::146     0.001  19%  157 aa  YVNA_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   37::136     0.001  26%  144 aa  MARR_SALTY RecName: Full=Multiple antibiotic resistance protein
   37::136     0.001  26%  144 aa  MARR_SALTI RecName: Full=Multiple antibiotic resistance protein
    1::146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
MARR_ECOLI      ---------------------------------DITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTR
YVNA_BACSU      ---------------------------------DWTLTQLHIVSCIHTSQNVNNSFLASRLHISKAAVSK
MARR_SALTY      ---------------------------------DITATQFKVLCSIRCAGCITPVELKKVLSVDLGALTR
MARR_SALTI      ---------------------------------DITATQFKVLCSIRCAGCITPVELKKVLSVDLGALTR


                         .         .         *         .         .         .         .:140
query           TIDRLCRKGYAEXXXXXXXXXXXXXXLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIExxxxxxxx
MARR_ECOLI      MLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAIEQCHQLVGQDLHQELTKNLTADEVATLE--------
YVNA_BACSU      AVHALLKHNIITVTKKPGNKKEIFYTLTDSGRKLAALHEQLHKEQYKQLFNEFSIDDLKTV---------
MARR_SALTY      MLDRLLCKGWIERLPNPNDKRGVLVKLTPDGAAIEQCHQRPGQDLHQELTKNLTADEVATLE--------
MARR_SALTI      MLDRLLCKGWIERLPNPNDKRGVLVKLTPDGAAIEQCHQRPGQDLHQELTKNLTADEVATLE--------


                         +         .         .         .         .         *         .:210
query           xxxxxx
MARR_ECOLI      ------
YVNA_BACSU      ------
MARR_SALTY      ------
MARR_SALTI      ------