[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99261.1

[Show Plain Result]


## Summary of Sequence Search
    1::326
    1::324     2e-96  55%  324 aa  FABH_LACRJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::324     2e-96  55%  324 aa  FABH_LACRD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::327     2e-91  51%  327 aa  FABH_LACBA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::327     4e-87  50%  327 aa  FABH_LACH4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::322     4e-83  50%  324 aa  FABH_STRGC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::322     8e-83  50%  324 aa  FABH_STRSV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::322     2e-82  49%  323 aa  FABH_STRA5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::322     2e-82  49%  323 aa  FABH_STRA3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::322     2e-82  49%  323 aa  FABH_STRA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::326     7e-81  49%  326 aa  FABH_LACSS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     1e-80  48%  324 aa  FABH_STREM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     2e-80  48%  324 aa  FABH_STRS7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::324     3e-80  48%  325 aa  FABH_STRMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     3e-78  46%  323 aa  FABH_OENOB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     4e-78  44%  323 aa  FABH_CLOB8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     4e-77  47%  324 aa  FABH_STRE4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRZT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRZP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRZJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRR6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRPN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRPJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRPI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRP7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRP4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::298     8e-77  48%  324 aa  FABH_STRP2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     3e-76  45%  324 aa  FABH_CLONN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::328     7e-76  46%  328 aa  FABH2_LACPL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::297     3e-75  47%  325 aa  FABH_LACLA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     4e-75  44%  324 aa  FABH_CLOPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::333     2e-74  46%  334 aa  FABH_CLOTE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::297     1e-73  46%  325 aa  FABH_LACLM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     1e-73  43%  324 aa  FABH_CLOP1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     1e-73  43%  325 aa  FABH_CLOAB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::300     2e-73  46%  325 aa  FABH_STRSY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::300     2e-73  46%  325 aa  FABH_STRS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::297     2e-73  46%  325 aa  FABH_LACLS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     4e-73  45%  324 aa  FABH_STRU0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::327     5e-72  44%  328 aa  FABH_CALS8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     8e-72  42%  324 aa  FABH_CLOPE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::298     1e-71  49%  321 aa  FABH_ENTFA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     2e-71  45%  324 aa  FABH_STRP6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRPZ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRPM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRPF RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRPC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRPB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRP8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     7e-71  44%  324 aa  FABH_STRP3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     1e-70  45%  326 aa  FABH_CLOBM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     1e-70  46%  326 aa  FABH_CLOBH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     1e-70  46%  326 aa  FABH_CLOB1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     1e-70  44%  324 aa  FABH_STRPG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     1e-70  44%  324 aa  FABH_STRP1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     2e-70  45%  326 aa  FABH_CLOBK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::319     3e-70  46%  320 aa  FABH_STRTD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::319     3e-70  46%  320 aa  FABH_STRT1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     3e-70  45%  326 aa  FABH_CLOBJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::323     4e-70  44%  324 aa  FABH_STRPD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     4e-70  45%  326 aa  FABH_CLOBL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::319     1e-69  46%  320 aa  FABH_STRT2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::302     5e-69  45%  326 aa  FABH_CLOB6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::329     1e-67  43%  329 aa  FABH_NATTJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::278     6e-67  47%  319 aa  FABH_LACDB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::278     2e-66  47%  319 aa  FABH_LACDA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::326     2e-66  43%  328 aa  FABH_CLOD6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::334     5e-66  40%  335 aa  FABH_PROM2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::301     5e-66  44%  323 aa  FABH_CLOK5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::301     5e-66  44%  323 aa  FABH_CLOK1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::334     9e-65  39%  335 aa  FABH_PROM9 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::308     2e-64  45%  310 aa  FABH_ACHLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::328     1e-63  39%  330 aa  FABH_GRATL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::328     7e-63  37%  332 aa  FABH_SULDN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::334     9e-63  38%  335 aa  FABH_PROM0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::309     1e-62  41%  309 aa  FABH_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::318     2e-62  43%  319 aa  FABH_EHRCJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::326     3e-62  39%  331 aa  FABH_DESHY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::326     3e-62  39%  331 aa  FABH_DESHD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::322     3e-62  40%  322 aa  FABH_DICNV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::334     4e-62  39%  335 aa  FABH_PROMP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::320     1e-61  40%  320 aa  FABH_NITEC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::328     1e-61  39%  329 aa  FABH_THEEB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::308     1e-61  41%  310 aa  FABH1_BACAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::328     2e-61  40%  329 aa  FABH_CHLTE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::334     2e-61  40%  335 aa  FABH_PROM5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   15::313     2e-61  40%  313 aa  FABH_PERMH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::325     4e-61  38%  328 aa  FABH_CAMFF RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::325     8e-61  38%  325 aa  FABH_XANCP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::319     8e-61  39%  324 aa  FABH_CAMJJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::319     8e-61  39%  324 aa  FABH_CAMJE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::325     1e-60  43%  325 aa  FABH_POLSJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   17::330     2e-60  40%  330 aa  FABH_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::326     2e-60  41%  326 aa  FABH_BRAJA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::319     2e-60  39%  324 aa  FABH_CAMJ8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::328     3e-60  41%  338 aa  FABH_PROMT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::319     3e-60  39%  324 aa  FABH_CAMJR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   18::331     4e-60  40%  333 aa  FABH_MICAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   81::404     5e-60  39%  405 aa  FABH_SPIOL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::321     5e-60  38%  321 aa  FABH_METCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   15::328     7e-60  39%  329 aa  FABH_TRIEI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::319     9e-60  39%  324 aa  FABH_CAMJD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::325     1e-59  38%  325 aa  FABH_XANC8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::324     2e-59  38%  324 aa  FABH_XYLFA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::329     2e-59  40%  331 aa  FABH_THETN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::324     3e-59  38%  324 aa  FABH_XYLFT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::328     3e-59  36%  333 aa  FABH_ARCB4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::325     6e-59  37%  325 aa  FABH_XANC5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::317     6e-59  38%  317 aa  FABH_PASMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::322     6e-59  41%  323 aa  FABH1_LACPL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::325     8e-59  37%  325 aa  FABH_XANAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   79::403     8e-59  39%  404 aa  FABH_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::326     1e-58  39%  334 aa  FABH_CAMC1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::318     2e-58  39%  318 aa  FABH_RICRS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::318     2e-58  39%  318 aa  FABH_RICRO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::318     2e-58  39%  318 aa  FABH_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::308     2e-58  39%  310 aa  FABH1_BACCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAAT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAAE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAA8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     2e-58  40%  313 aa  FABH_STAA3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAAB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAA9 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAA2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::311     3e-58  40%  313 aa  FABH_STAA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   17::333     4e-58  35%  340 aa  FABH_SULNB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::325     5e-58  38%  326 aa  FABH_PORPU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::314     7e-58  39%  314 aa  FABH_VESOH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::335     1e-57  38%  339 aa  FABH_PROMM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     1e-57  39%  317 aa  FABH_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     1e-57  40%  320 aa  FABH_NEIMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::326     1e-57  38%  328 aa  FABH_FUSNN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::325     2e-57  39%  325 aa  FABH_POLNA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     2e-57  38%  317 aa  FABH_PHOLL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   78::401     2e-57  38%  402 aa  FABH2_CUPWR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::318     2e-57  41%  318 aa  FABH_WOLPM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     2e-57  39%  317 aa  FABH_RICM5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::319     2e-57  37%  319 aa  FABH_NITMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     6e-57  40%  325 aa  FABH_DIAST RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     6e-57  38%  324 aa  FABH_BRASO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     6e-57  40%  325 aa  FABH_ACISJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   18::330     6e-57  40%  332 aa  FABH_ACAM1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::324     6e-57  37%  326 aa  FABH2_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::318     9e-57  39%  318 aa  FABH_NITEU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::322     9e-57  36%  322 aa  FABH_MARAV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::326     9e-57  36%  334 aa  FABH_CAMC5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     9e-57  38%  329 aa  FABH_BURS3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     1e-56  40%  325 aa  FABH_DELAS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     1e-56  38%  329 aa  FABH_BURCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     1e-56  38%  329 aa  FABH_BURCC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     1e-56  38%  329 aa  FABH_BURCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     2e-56  39%  320 aa  FABH_NEIG2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     2e-56  39%  320 aa  FABH_NEIG1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::328     2e-56  38%  329 aa  FABH_CHLPD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   76::399     2e-56  38%  400 aa  FABH1_CUPWR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::318     2e-56  40%  318 aa  FABH_WOLPP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     2e-56  38%  324 aa  FABH_BRASB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::323     2e-56  40%  325 aa  FABH_ACIAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::328     3e-56  38%  329 aa  FABH_PELLD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-56  37%  323 aa  FABH_BRUO2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUSI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUME RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUMB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUAB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUA2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-56  37%  323 aa  FABH_BRUA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::318     5e-56  38%  319 aa  FABH_EHRRG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::328     5e-56  38%  329 aa  FABH_CHLCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::331     6e-56  37%  333 aa  FABH_CAMHC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::326     8e-56  40%  326 aa  FABH_WOLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::328     8e-56  37%  333 aa  FABH_SYNR3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::318     8e-56  40%  319 aa  FABH_EHRCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     8e-56  37%  323 aa  FABH_BRUSU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     8e-56  37%  323 aa  FABH_BRUC2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::311     1e-55  38%  311 aa  FABH_NEOSM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::316     1e-55  37%  316 aa  FABH_ACTSZ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::316     1e-55  36%  316 aa  FABH_ACTP2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     1e-55  37%  312 aa  FABH_OCEIH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     1e-55  38%  320 aa  FABH_NEIMF RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     1e-55  38%  320 aa  FABH_NEIM0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::318     1e-55  38%  319 aa  FABH_EHRRW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     1e-55  37%  329 aa  FABH_BURP0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     2e-55  39%  320 aa  FABH_NEIMB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::317     2e-55  39%  317 aa  FABH_RICCK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::321     2e-55  37%  321 aa  FABH_AZOSE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     3e-55  39%  317 aa  FABH_RICAH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     3e-55  36%  316 aa  FABH_HAES1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     3e-55  38%  329 aa  FABH_BURTA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     3e-55  37%  329 aa  FABH_BURPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     3e-55  37%  329 aa  FABH_BURP6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     3e-55  37%  329 aa  FABH_BURP1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     3e-55  38%  364 aa  FABH2_VIBPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     5e-55  37%  329 aa  FABH_BURMS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     5e-55  37%  329 aa  FABH_BURMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     5e-55  37%  329 aa  FABH_BURM9 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     5e-55  37%  329 aa  FABH_BURM7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     5e-55  38%  362 aa  FABH2_VIBVY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::323     7e-55  38%  325 aa  FABH_VARPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-55  38%  317 aa  FABH_VIBF1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     9e-55  37%  316 aa  FABH_HAES2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     9e-55  36%  329 aa  FABH_BURP8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::321     2e-54  37%  322 aa  FABH_GRABC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     2e-54  35%  330 aa  FABH_HELPG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     2e-54  38%  324 aa  FABH_BARBK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     2e-54  38%  362 aa  FABH2_VIBVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::320     3e-54  37%  321 aa  FABH_SPHAL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-54  37%  323 aa  FABH_RHOCS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     3e-54  35%  331 aa  FABH_HELAH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::331     3e-54  33%  333 aa  FABH_ACIBL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     3e-54  35%  330 aa  FABH_HELPH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     3e-54  38%  324 aa  FABH_BART1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-54  38%  323 aa  FABH_MESSB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::322     6e-54  34%  322 aa  FABH_THISH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::319     6e-54  35%  319 aa  FABH_SPHWW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::328     6e-54  37%  330 aa  FABH_ANAVT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::328     6e-54  37%  330 aa  FABH_ANASP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::329     1e-53  36%  331 aa  FABH_SOLUE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::319     1e-53  36%  319 aa  FABH_PSEA6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     1e-53  34%  331 aa  FABH_HELPJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     1e-53  34%  330 aa  FABH_HELP2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     1e-53  38%  324 aa  FABH_BARHE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::323     1e-53  36%  323 aa  FABH_ALHEH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     1e-53  34%  331 aa  FABH_HELPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     2e-53  35%  317 aa  FABH_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::322     2e-53  34%  323 aa  FABH_HYPNA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-53  37%  316 aa  FABH1_VIBPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::328     2e-53  34%  331 aa  FABH_HELPY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-53  37%  323 aa  FABH_OCHA4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     4e-53  34%  323 aa  FABH_SILST RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     4e-53  39%  362 aa  FABH2_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::325     5e-53  35%  325 aa  FABH_XANOM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::324     5e-53  39%  325 aa  FABH_VEREI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   23::333     5e-53  37%  337 aa  FABH_SYNPW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::325     5e-53  36%  326 aa  FABH_PORUM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::329     5e-53  36%  346 aa  FABH_DEIGD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::329     5e-53  36%  329 aa  FABH_BURVG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     6e-53  35%  317 aa  FABH_RICB8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     6e-53  36%  317 aa  FABH_ERWCT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::288     8e-53  40%  313 aa  FABH_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::328     8e-53  35%  329 aa  FABH_PROVI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     8e-53  38%  317 aa  FABH_BAUCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::288     8e-53  40%  313 aa  FABH1_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     1e-52  37%  317 aa  FABH_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::300     1e-52  38%  319 aa  FABH_COXBU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::316     1e-52  36%  316 aa  FABH_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::316     1e-52  36%  316 aa  FABH_HAEIG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::316     1e-52  36%  316 aa  FABH_HAEI8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     1e-52  38%  324 aa  FABH_BARQU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     2e-52  36%  324 aa  FABH_MAGSA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::305     2e-52  35%  332 aa  FABH_HELHP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     3e-52  37%  317 aa  FABH_SALPB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     3e-52  37%  317 aa  FABH_SALCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     3e-52  36%  316 aa  FABH1_VIBVY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     3e-52  36%  316 aa  FABH1_VIBVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     4e-52  36%  317 aa  FABH_SODGM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     4e-52  37%  317 aa  FABH_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     4e-52  37%  317 aa  FABH_SALAR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::308     4e-52  38%  310 aa  FABH_GEOKA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::300     4e-52  38%  319 aa  FABH_COXBN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::322     5e-52  35%  341 aa  FABH1_DEIRA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::321     7e-52  34%  359 aa  FABH_PSEHT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::300     7e-52  38%  319 aa  FABH_COXBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     7e-52  36%  317 aa  FABH_CITK8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::325     7e-52  34%  332 aa  FABH2_BACHD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_SHISS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_SHIF8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_SHIBS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOUT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOLC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOL6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOL5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOK1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECOHS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECO57 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     9e-52  35%  317 aa  FABH_ECO24 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::300     9e-52  38%  319 aa  FABH_COXB2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     1e-51  35%  317 aa  FABH_SHIDS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     1e-51  36%  317 aa  FABH_SALPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::300     1e-51  38%  319 aa  FABH_COXB1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::319     1e-51  35%  319 aa  FABH_CHRVO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::288     2e-51  39%  313 aa  FABH_STAHJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::318     2e-51  38%  318 aa  FABH_BLOFL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::328     2e-51  37%  338 aa  FABH2_DEIRA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::327     3e-51  35%  335 aa  FABH2_BACTN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::328     3e-51  37%  328 aa  FABH_POLNS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     5e-51  36%  317 aa  FABH_ENTS8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::327     5e-51  36%  334 aa  FABH_BACV8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::320     5e-51  35%  320 aa  FABH_ACICJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::321     8e-51  35%  321 aa  FABH_ERYLH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     1e-50  36%  323 aa  FABH_SILPO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     1e-50  35%  316 aa  FABH1_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::321     2e-50  37%  322 aa  FABH_ANAMM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     3e-50  36%  317 aa  FABH_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::323     3e-50  35%  328 aa  FABH_BORA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     3e-50  37%  317 aa  FABH_BLOPB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::316     4e-50  33%  316 aa  FABH_HAEDU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::321     9e-50  36%  321 aa  FABH_AZOSB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     1e-49  35%  317 aa  FABH_KLEP7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::326     1e-49  34%  326 aa  FABH_JANSC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   16::333     1e-49  35%  335 aa  FABH_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::306     2e-49  37%  329 aa  FABH_BORBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     2e-49  34%  323 aa  FABH_AGRVS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::327     2e-49  37%  329 aa  FABH_ROSS1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::318     2e-49  35%  319 aa  FABH_PSYIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::324     2e-49  34%  325 aa  FABH_NOVAD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    6::306     2e-49  37%  329 aa  FABH_BORPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::288     3e-49  39%  313 aa  FABH_STAS1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-49  34%  323 aa  FABH_RHOS4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-49  34%  323 aa  FABH_RHOS1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     6e-49  35%  317 aa  FABH_ENT38 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::325     7e-49  36%  332 aa  FABH_SYNWW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::327     7e-49  37%  330 aa  FABH_ROSCS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::305     7e-49  37%  328 aa  FABH_BORPE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   19::321     2e-48  35%  350 aa  FABH_DEIDV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERPP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERPN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERPE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::316     2e-48  36%  316 aa  FABH_YERP3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::296     3e-48  37%  335 aa  FABH1_BACTN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     4e-48  36%  312 aa  FABH_BACP2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::317     1e-47  35%  317 aa  FABH_SERP5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     1e-47  34%  323 aa  FABH_SINMW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::298     2e-47  37%  325 aa  FABH_RHOFD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::326     2e-47  34%  326 aa  FABH_RALPJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::322     2e-47  37%  328 aa  FABH_JANMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::324     2e-47  32%  324 aa  FABH_DESPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::331     2e-47  33%  335 aa  FABH_CHLCV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::321     3e-47  35%  321 aa  FABH_YERE8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::331     4e-47  32%  335 aa  FABH_SYNP6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::331     4e-47  32%  335 aa  FABH_SYNE7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::325     4e-47  36%  326 aa  FABH_RALEH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     5e-47  35%  312 aa  FABH_LISW6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     5e-47  35%  312 aa  FABH_LISMO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     5e-47  35%  312 aa  FABH_LISMF RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     7e-47  34%  323 aa  FABH_AGRT5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::326     9e-47  33%  329 aa  FABH_GLOVI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    4::345     1e-46  36%  345 aa  FABH_RHOBA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     1e-46  34%  323 aa  FABH_RHIME RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::325     1e-46  36%  326 aa  FABH_CUPTR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::321     1e-46  37%  322 aa  FABH_CAUCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::292     1e-46  36%  327 aa  FABH2_BACAN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::305     2e-46  37%  328 aa  FABH_BORPD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   11::317     2e-46  34%  317 aa  FABH_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::334     2e-46  33%  338 aa  FABH_PROMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::322     2e-46  35%  328 aa  FABH_HERAR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::298     2e-46  34%  327 aa  FABH2_BACCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::325     3e-46  34%  326 aa  FABH_RALEJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    2::310     3e-46  35%  312 aa  FABH_LISIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     7e-46  34%  323 aa  FABH_RHIL3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::340     7e-46  35%  343 aa  FABH1_STRCO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::328     1e-45  35%  333 aa  FABH_AZOPC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::327     2e-45  35%  335 aa  FABH_PORGI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::327     2e-45  35%  335 aa  FABH_PORG3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::323     3e-45  31%  323 aa  FABH_ROSDO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::328     4e-45  35%  328 aa  FABH_POLSQ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   14::308     4e-45  33%  335 aa  FABH3_STRCO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::301     4e-45  35%  325 aa  FABH2_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::324     1e-44  30%  324 aa  FABH_DINSH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::325     5e-44  32%  327 aa  FABH_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     3e-43  32%  323 aa  FABH_RHOS5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::352     3e-43  37%  355 aa  FABH_KOCRD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    3::324     6e-43  35%  324 aa  FABH_PORYE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    5::327     6e-43  33%  334 aa  FABH_PARD8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::325     6e-43  31%  327 aa  FABH_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::325     6e-43  31%  327 aa  FABH_CHLTA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     8e-43  33%  323 aa  FABH_RHILO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   20::314     8e-43  37%  330 aa  FABH2_STRCO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::319     1e-42  30%  319 aa  FABH_THIDA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::324     1e-42  31%  324 aa  FABH_RHOCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::323     5e-42  34%  324 aa  FABH_RHORT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::333     5e-42  34%  340 aa  FABH_MYCA9 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   29::352     7e-42  35%  355 aa  FABH1_STRAW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::323     1e-41  31%  323 aa  FABH_PARDP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::323     1e-41  32%  323 aa  FABH_AGRRK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    8::319     4e-41  30%  319 aa  FABH_SHEON RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::326     6e-41  33%  326 aa  FABH_RALSO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::312     6e-41  30%  330 aa  FABH_DESDG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   18::321     1e-40  34%  332 aa  FABH5_STRCO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::287     2e-40  35%  312 aa  FABH1_BACHD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    9::292     5e-40  32%  319 aa  FABH_LARHH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::330     8e-40  33%  333 aa  FABH_STRGA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::331     1e-39  33%  335 aa  FABH_MYCPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   12::331     2e-39  32%  335 aa  FABH_MYCA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   20::323     9e-39  32%  339 aa  FABH_STRLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   10::310     1e-38  31%  312 aa  FABH1_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::322     2e-38  31%  330 aa  FABH_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::322     2e-38  31%  330 aa  FABH_PSEAB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::322     2e-38  31%  330 aa  FABH_PSEA8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     2e-38  32%  335 aa  FABH_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     2e-38  32%  335 aa  FABH_MYCTA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     2e-38  32%  335 aa  FABH_MYCBT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     2e-38  32%  335 aa  FABH_MYCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     2e-38  32%  335 aa  FABH_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   15::328     6e-38  32%  330 aa  FABH_SYMTH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     6e-38  34%  335 aa  FABH_MYCMM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   21::331     1e-37  34%  335 aa  FABH_MYCUA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   17::310     5e-37  30%  330 aa  FABH_DESVM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::310     1e-36  31%  330 aa  FABH_DESVV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   13::310     1e-36  31%  330 aa  FABH_DESVH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    1::313     1e-36  31%  315 aa  FABH2_STRAW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   20::312     1e-35  34%  322 aa  FABH_TROWT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   20::312     1e-35  34%  322 aa  FABH_TROW8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
    7::314     2e-33  29%  316 aa  FABH4_STRCO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   22::314     6e-33  30%  315 aa  FABH_RUBXD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase
   47::338     7e-31  32%  353 aa  FABHL_CAMJE RecName: Full=Putative 3-oxoacyl-[acyl-carrier-protein]
   13::328     4e-30  27%  337 aa  PQSD_PSEAE RecName: Full=PQB biosynthetic
   49::301     3e-09  22%  349 aa  Y526_METVS RecName: Full=UPF0219 protein Mevan_0526;
   29::298     3e-09  26%  348 aa  Y1349_SULTO RecName: Full=UPF0219 protein ST1349;
   10::297     4e-09  23%  345 aa  Y1546_METJA RecName: Full=UPF0219 protein MJ1546;
   47::297     7e-09  23%  346 aa  Y117_METST RecName: Full=UPF0219 protein Msp_0117;
   49::303     1e-08  23%  349 aa  Y1211_METMP RecName: Full=UPF0219 protein MMP1211;
  158::458     2e-08  25%  521 aa  KCS3_ARATH RecName: Full=3-ketoacyl-CoA synthase 3;       
   49::303     5e-08  22%  349 aa  Y379_METM5 RecName: Full=UPF0219 protein MmarC5_0379;
   49::303     6e-08  22%  349 aa  Y458_METM7 RecName: Full=UPF0219 protein MmarC7_0458;
   49::303     8e-08  22%  349 aa  Y1461_METM6 RecName: Full=UPF0219 protein MmarC6_1461;
   10::297     2e-07  23%  351 aa  Y132_THEVO RecName: Full=UPF0219 protein TV0132;
  220::391     2e-07  31%  396 aa  CHSA_IPOPU RecName: Full=Chalcone synthase A;       
  183::476     3e-07  27%  509 aa  KCS11_ARATH RecName: Full=3-ketoacyl-CoA synthase 11;       
   47::297     5e-07  24%  351 aa  Y1455_THEAC RecName: Full=UPF0219 protein Ta1455;
  281::390     7e-07  34%  395 aa  CHSY_PINST RecName: Full=Chalcone synthase;       
  276::384     7e-07  33%  389 aa  CHS6_TRISU RecName: Full=Chalcone synthase 6;       
  276::384     7e-07  33%  389 aa  CHS5_TRISU RecName: Full=Chalcone synthase 5;       
   11::298     9e-07  23%  348 aa  Y1362_SULAC RecName: Full=UPF0219 protein Saci_1362;
  281::390     9e-07  32%  396 aa  CHSY_PINSY RecName: Full=Chalcone synthase;       
  281::390     9e-07  32%  395 aa  CHS7_PICMA RecName: Full=Chalcone synthase 7;       
  271::384     9e-07  32%  389 aa  CHS5_PEA RecName: Full=Chalcone synthase 5;       
  271::384     9e-07  32%  389 aa  CHS4_PEA RecName: Full=Chalcone synthase 4;       
  271::384     9e-07  32%  389 aa  CHS3_PEA RecName: Full=Chalcone synthase 3;       
  276::384     9e-07  32%  389 aa  CHS2_TRISU RecName: Full=Chalcone synthase 2;       
  276::385     1e-06  33%  389 aa  CHSY_PUELO RecName: Full=Chalcone synthase;       
  275::384     2e-06  33%  388 aa  CHS5_SOYBN RecName: Full=Chalcone synthase 5;       
  275::384     2e-06  33%  388 aa  CHS3_SOYBN RecName: Full=Chalcone synthase 3;       
  275::384     2e-06  33%  388 aa  CHS1_SOYBN RecName: Full=Chalcone synthase 1;       
  276::383     2e-06  33%  388 aa  CHSY_VIGUN RecName: Full=Chalcone synthase;       
  269::384     2e-06  39%  395 aa  CHSY_BETVE RecName: Full=Chalcone synthase;       
  220::390     2e-06  31%  403 aa  CHS3_GERHY RecName: Full=Chalcone synthase 3;       
  276::384     2e-06  32%  389 aa  CHS1_TRISU RecName: Full=Chalcone synthase 1;       
  276::384     3e-06  33%  389 aa  CHS7_SOYBN RecName: Full=Chalcone synthase 7;       
  276::384     3e-06  31%  389 aa  CHS1_MEDSA RecName: Full=Chalcone synthase 1;       
  221::300     3e-06  37%  350 aa  Y1695_SULIL RecName: Full=UPF0219 protein LS215_1695;
  221::300     3e-06  37%  350 aa  Y1591_SULIY RecName: Full=UPF0219 protein YG5714_1591;
  221::300     3e-06  37%  350 aa  Y1245_SULIN RecName: Full=UPF0219 protein YN1551_1245;
  271::384     3e-06  32%  389 aa  CHSA_PEA RecName: Full=Chalcone synthase 1A;       
  221::300     4e-06  37%  350 aa  Y535_SULSO RecName: Full=UPF0219 protein SSO0535;
  221::300     4e-06  37%  350 aa  Y1703_SULIA RecName: Full=UPF0219 protein M1627_1703;
  221::300     4e-06  37%  350 aa  Y1587_SULIM RecName: Full=UPF0219 protein M1425_1587;
  221::300     4e-06  37%  350 aa  Y1584_SULIK RecName: Full=UPF0219 protein M164_1584;
  275::384     4e-06  33%  388 aa  CHS2_SOYBN RecName: Full=Chalcone synthase 2;       
  276::384     4e-06  31%  389 aa  CHS1_CICAR RecName: Full=Chalcone synthase 1;       
   32::391     6e-06  27%  396 aa  DPS1_PINST RecName: Full=Pinosylvin synthase 1;       
  172::280     6e-06  31%  285 aa  CHS6_MEDSA RecName: Full=Chalcone synthase 6-4;       
  276::384     8e-06  31%  390 aa  CHSY_ONOVI RecName: Full=Chalcone synthase;       
  276::384     8e-06  31%  389 aa  CHS3_MEDSA RecName: Full=Chalcone synthase 4-1;       
  276::385     8e-06  30%  389 aa  CHS2_MEDSA RecName: Full=Chalcone synthase 2;       
  276::384     8e-06  33%  389 aa  CHS1_CASGL RecName: Full=Chalcone synthase;       
  213::298     1e-05  33%  348 aa  Y1646_METS5 RecName: Full=UPF0219 protein Msed_1646;
  281::389     1e-05  34%  398 aa  CHSY_PETCR RecName: Full=Chalcone synthase;       
  276::384     1e-05  31%  389 aa  CHS9_MEDSA RecName: Full=Chalcone synthase 9;       
  276::384     1e-05  32%  389 aa  CHS2_SOLLC RecName: Full=Chalcone synthase 2;       
   73::422     1e-05  28%  464 aa  KCS20_ARATH RecName: Full=Probable 3-ketoacyl-CoA synthase 20;     
  188::477     1e-05  26%  528 aa  KCS17_ARATH RecName: Full=3-ketoacyl-CoA synthase 17;       
  276::385     1e-05  30%  389 aa  CHS4_MEDSA RecName: Full=Chalcone synthase 4;       
  276::384     1e-05  31%  389 aa  CHS3_TRISU RecName: Full=Chalcone synthase 3;       
  276::384     1e-05  32%  389 aa  CHS2_SOLTU RecName: Full=Chalcone synthase 2;       
  278::387     1e-05  33%  393 aa  CHS2_RUTGR RecName: Full=Chalcone synthase 2;       
  280::388     1e-05  34%  397 aa  CHS2_DAUCA RecName: Full=Chalcone synthase 2;       
  278::387     1e-05  33%  393 aa  CHS1_RUTGR RecName: Full=Chalcone synthase 1;       
  276::384     2e-05  32%  389 aa  CHSY_PHAVU RecName: Full=Chalcone synthase 17;       
  276::384     2e-05  29%  389 aa  CHSY_HYDMC RecName: Full=Chalcone synthase;       
  276::384     2e-05  32%  389 aa  CHS2_CAMSI RecName: Full=Chalcone synthase 2;       
  282::390     2e-05  32%  395 aa  CHS1_SINAL RecName: Full=Chalcone synthase 1;       
  299::384     2e-05  39%  391 aa  CHSY_DIAMO RecName: Full=Chalcone synthase;       
  276::384     2e-05  29%  419 aa  CHSD_PETHY RecName: Full=Chalcone synthase D;       
  276::384     2e-05  30%  389 aa  CHS6_PEA RecName: Full=Chalcone synthase 6;       
  272::387     3e-05  37%  398 aa  CHSY_CALCH RecName: Full=Chalcone synthase;       
  276::384     3e-05  32%  390 aa  CHSY_ANTMA RecName: Full=Chalcone synthase;       
  152::261     3e-05  29%  265 aa  CHS7_MEDSA RecName: Full=Chalcone synthase;       
  276::385     3e-05  29%  389 aa  CHS5_MEDSA RecName: Full=Chalcone synthase 4-2;       
  275::383     3e-05  32%  389 aa  CHS1_CITSI RecName: Full=Chalcone synthase 1;       
  219::390     4e-05  31%  395 aa  CHSY_ARATH RecName: Full=Chalcone synthase;       
  219::390     4e-05  36%  395 aa  CHS3_SINAL RecName: Full=Chalcone synthase 3;       
  281::389     5e-05  31%  394 aa  CHSY_RAPSA RecName: Full=Chalcone synthase;       
  218::390     5e-05  31%  394 aa  CHSY_MATIN RecName: Full=Chalcone synthase;       
  220::391     5e-05  27%  396 aa  CHSB_IPOPU RecName: Full=Chalcone synthase B;       
  276::385     5e-05  29%  389 aa  CHS2_PEA RecName: Full=Chalcone synthase 2;       
  211::381     6e-05  28%  389 aa  THS3_VITVI RecName: Full=Stilbene synthase 3;       
  219::390     6e-05  36%  395 aa  CHSY_CARAN RecName: Full=Chalcone synthase;       
  223::304     8e-05  30%  350 aa  Y1379_METKA RecName: Full=UPF0219 protein MK1379;
  270::391     8e-05  31%  396 aa  DPS2_PINST RecName: Full=Pinosylvin synthase 2;       
  276::384     8e-05  32%  390 aa  CHSY_HYPAN RecName: Full=Chalcone synthase;       
  268::384     8e-05  35%  388 aa  CHS6_SOYBN RecName: Full=Chalcone synthase 6;       
   23::310     1e-04  21%  361 aa  Y1873_AERPE RecName: Full=UPF0219 protein APE_1873.1;
  214::384     1e-04  28%  392 aa  THS2_VITVI RecName: Full=Stilbene synthase 2;       
  300::355     1e-04  43%  397 aa  THIC_MOUSE RecName: Full=Acetyl-CoA acetyltransferase, cytosolic;  
  299::384     1e-04  38%  391 aa  CHSY_DIACA RecName: Full=Chalcone synthase;       
  279::388     1e-04  33%  401 aa  CHS1_SORBI RecName: Full=Chalcone synthase 1;       
   64::390     1e-04  24%  402 aa  2PS_GERHY RecName: Full=2-pyrone synthase;         Short=2-PS;     
  300::355     1e-04  43%  397 aa  THIC_RAT RecName: Full=Acetyl-CoA acetyltransferase, cytosolic;    
  267::388     1e-04  29%  393 aa  DPSS_PINSY RecName: Full=Dihydropinosylvin synthase;       
  276::384     1e-04  32%  391 aa  CHSY_PERFR RecName: Full=Chalcone synthase;       
  217::388     1e-04  30%  396 aa  CHSY_CHRAE RecName: Full=Chalcone synthase;       
  215::386     1e-04  35%  391 aa  CHSY_ARAAL RecName: Full=Chalcone synthase;       
  214::384     2e-04  27%  392 aa  THS4_VITVI RecName: Full=Stilbene synthase 4;       
  272::387     2e-04  33%  398 aa  CHSY_ORYSJ RecName: Full=Chalcone synthase;       
  272::387     2e-04  33%  398 aa  CHSY_ORYSI RecName: Full=Chalcone synthase;       
  279::388     2e-04  33%  401 aa  CHS4_SORBI RecName: Full=Chalcone synthase 4;       
   10::306     2e-04  19%  346 aa  Y792_METTH RecName: Full=UPF0219 protein MTH_792;
  119::227     2e-04  29%  232 aa  CHSY_MALDO RecName: Full=Chalcone synthase;       
  276::384     2e-04  30%  389 aa  CHSY_CATRO RecName: Full=Chalcone synthase;       
  270::386     2e-04  36%  394 aa  CHS8_BROFI RecName: Full=Chalcone synthase 8;       
  279::388     2e-04  32%  401 aa  CHS5_SORBI RecName: Full=Chalcone synthase 5;       
  270::386     2e-04  36%  394 aa  CHS4_BROFI RecName: Full=Chalcone synthase 4;       
  279::388     2e-04  32%  401 aa  CHS3_SORBI RecName: Full=Chalcone synthase 3;       
  270::386     2e-04  36%  394 aa  CHS3_BROFI RecName: Full=Chalcone synthase 3;       
  279::388     2e-04  32%  401 aa  CHS2_SORBI RecName: Full=Chalcone synthase 2;       
  276::384     2e-04  28%  389 aa  CHS1_PEA RecName: Full=Chalcone synthase 1;       
  299::385     2e-04  34%  391 aa  ACS4_RUTGR RecName: Full=Probable acridone synthase 4;       
  299::385     2e-04  34%  391 aa  ACS3_RUTGR RecName: Full=Probable acridone synthase 3;       
  228::298     3e-04  39%  349 aa  Y1240_CALMQ RecName: Full=UPF0219 protein Cmaq_1240;
  275::385     3e-04  35%  389 aa  THS3_ARAHY RecName: Full=Stilbene synthase 3;       
  344::424     3e-04  32%  460 aa  KCS7_ARATH RecName: Full=3-ketoacyl-CoA synthase 7;       
  308::399     3e-04  35%  405 aa  CHSY_EQUAR RecName: Full=Chalcone synthase;       
  276::384     3e-04  29%  389 aa  CHSJ_PETHY RecName: Full=Chalcone synthase J;       
  276::384     3e-04  29%  389 aa  CHSB_SOLTU RecName: Full=Chalcone synthase 1B;       
  276::384     3e-04  29%  389 aa  CHSA_SOLTU RecName: Full=Chalcone synthase 1A;       
  199::309     4e-04  35%  313 aa  THS2_ARAHY RecName: Full=Putative stilbene synthase 2;       
  275::385     4e-04  35%  389 aa  THS1_ARAHY RecName: Full=Stilbene synthase 1;       
  276::384     4e-04  27%  389 aa  CHSB_PEA RecName: Full=Chalcone synthase 1B;       
  276::384     4e-04  30%  389 aa  CHS9_DAUCA RecName: Full=Chalcone synthase 9;       
  556::644     4e-04  33%  652 aa  ACSA_BARHE RecName: Full=Acetyl-coenzyme A synthetase;       
  138::233     5e-04  26%  638 aa  DXS_RHILW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  138::233     5e-04  26%  638 aa  DXS_RHIE6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
    9::94      5e-04  38%   99 aa  CHSY_FRAAN RecName: Full=Chalcone synthase RJ5;       
  279::388     5e-04  32%  401 aa  CHS6_SORBI RecName: Full=Chalcone synthase 6;       
  278::387     5e-04  34%  398 aa  CHS1_HORVU RecName: Full=Chalcone synthase 1;       
  276::384     5e-04  30%  389 aa  CHS1_DAUCA RecName: Full=Chalcone synthase 1;       
  299::385     5e-04  34%  391 aa  ACS2_RUTGR RecName: Full=Acridone synthase 2;       
  279::388     7e-04  32%  400 aa  CHS7_SORBI RecName: Full=Chalcone synthase 7;       
  303::388     7e-04  34%  400 aa  CHS2_MAIZE RecName: Full=Chalcone synthase C2;       
  278::387     7e-04  33%  400 aa  CHS1_MAIZE RecName: Full=Chalcone synthase WHP1;       
  300::355     0.001  39%  397 aa  THIC_HUMAN RecName: Full=Acetyl-CoA acetyltransferase, cytosolic;  
  293::349     0.001  40%  391 aa  FADA_BACSU RecName: Full=3-ketoacyl-CoA thiolase;       
    1::326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
FABH_LACRJ      MQNLRITSTASYHPPLNITNQQLSTIMDTSDEWIKTRTGIHQRYISNIENTSDLALNVGNQLLTNANLKT
FABH_LACRD      MQNLRITSTASYHPPLNITNQQLSTIMDTSDEWIKTRTGIHQRYISNIENTSDLALNVGNQLLTNANLKT
FABH_LACBA      -ENFNILATAGYTPERVVPNSELTTMMTTSDEWIVQRTGIHQRHVVTAERTSDLCTRVAQQLLQRSGLQA
FABH_LACH4      -EDFKIMATASSAPDHVVTNDELATMMDTSDEWITQRTGIKRRRIATEETTSSMCTDVATQLIAQSDLTA
FABH_STRGC      MKFAKISQVAHYAPEQVVTNDDLAQIMDTSDEWISSRTGIKKRHISHHESTSDLATRVALDLLKKSEISA
FABH_STRSV      MNYAKISQVAHYAPRQVVSNDDLAEIMDTSDEWISSRTGIKNRHLSSDETTSDLATKVAENLLQKSGISA
FABH_STRA5      ----KISQLAHYAPSQIIKNEDLSLIMDTSDDWISSRTGIKQRHISKNETTADLANKVAEQLIEKSGYSA
FABH_STRA3      ----KISQLAHYAPSQIIKNEDLSLIMDTSDDWISSRTGIKQRHISKNETTADLANKVAEQLIEKSGYSA
FABH_STRA1      ----KISQLAHYAPSQIIKNEDLSLIMDTSDDWISSRTGIKQRHISKNETTADLANKVAEQLIEKSGYSA
FABH_LACSS      ----KIIETASALPANIVTNDDLTAIMETSNEWIESRTGILERRISETENTSDLCLRVAQTLLDKSGIAV
FABH_STREM      ----KISQVAHYTPKQVISNDDLSQIMDTSHEWISSRTGIEKRHISTVEMTSDLAIRVAEQLLAGSGYDA
FABH_STRS7      ----KISQVAHYTPKQVISNDDLSQIMDTSHEWISSRTGIEKRHISTVEMTSDLAIRVAEQLLAGSGYDA
FABH_STRMU      ----KISQAAYYVPSQVVTNDDLSKIMDTSDEWITSRTGIRERRISQSEDTSDLASQVXXXXXXXXXXXX
FABH_OENOB      MRTIKIIQTASQLPEKIVSNDDLAGMMDTSDEWIRSRTGIFKRHIAVDETTASLAASVLQKLLKGSGISA
FABH_CLOB8      MSNIKIAGIGAYLPSLVVTNDRISEFVETSDEWIVQRTGMRERRISEGENTSDISTKAAKLALERAGIDA
FABH_STRE4      ----KISQVAHYTPKQVISNDDLSQIMDTSHEWISSRTGIEKRHISTVEMTSDLAIRVAEQLLAGSGYDA
FABH_STRZT      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRZP      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRZJ      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRR6      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRPS      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRPN      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRPJ      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRPI      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRP7      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRP4      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_STRP2      ----KISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHISRTESTSDLATEVAKKLMAKAGITG
FABH_CLONN      MYNVKIENTGRYVPDNIVTNEDISKIVDTNDKWIRERTGIKERRISKGENTSHMAIKSAKDVLRKSSIKA
FABH2_LACPL     --NFSILASAKALPTTKVTNQELTQLMATSDDWIKQRTGIRSRHVATDETTTXXXXXXXXXXXXXXXXXX
FABH_LACLA      ----KITQVAHYVPENVVSNDDLSKIMDTNDEWIYSRTGIKNRHISTGENTSDLAAKVAKQLISDSNLSP
FABH_CLOPS      MENAKIIGFGLYTPKNLVENERLQEFLETSDEWIRSRTGIERRYISLDENTSDLAVEASKKALNQAGLSA
FABH_CLOTE      -KEVRILSTGKYLPPISISNHDLSKIIDTNDNWIKTRTGIEKRRITKGENTSDLGTKAALDALRKGGISP
FABH_LACLM      ----KITQAAHYVPENVVSNDDLSKIMDTNDEWIYSRTGIKNRHISTGENTSDLATKVAKQLIENSGVDP
FABH_CLOP1      MKNAKMIGFGLYTPKNLVENERLQEFLETSDEWIRTRTGIERRYISLDENTSDLAVEASKKALNQAGLSA
FABH_CLOAB      MNSVEIIGTGSYVPEKIVTNEDMSKIVDTSDEWISSRTGIKERRISINENTSDLGAKAALRAIEDSNIKP
FABH_STRSY      ----KISQVAHYLPKKIVTNDDLAQRMETSDEWIRSRTGIGQRHIVTGETTSDLASQVARKLLEKSQLDA
FABH_STRS2      ----KISQVAHYLPKKIVTNDDLAQRMETSDEWIRSRTGIGQRHIVTGETTSDLASQVARKLLEKSQLDA
FABH_LACLS      ----KITQAAHYVPENVVSNDDLSKIMDTNDEWIYSRTGIKNRHISTGENTSDLATKVAKQLIENSGVDP
FABH_STRU0      ----KISQAAHHLPEQVISNDDLSLILETNDQWISSRTGIKERRISRSENTSDLASRVAEKLLEKANIDA
FABH_CALS8      -QNVKILSTGRYVPDRVLTNYDLEKMVDTSDEWITQRTGIKERRIDGTTSTTDLAVRAAKNAMDKAGILP
FABH_CLOPE      MKNAKMIGFGLYTPKNLVENERLQEFLETSDEWIRTRTGIERRYISLDENTSDLAVEASKKALSQARLSA
FABH_ENTFA      -----ISCTSRYVPENCVTNHQLSEMMDTSDEWIHSRTGISERRIVTQENTSDLCHQVAKQLLEKSGKQA
FABH_STRP6      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRPZ      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRPM      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRPF      ----KISQVAHYVPQQLVTNNDLANIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRPC      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRPB      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRP8      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRP3      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_CLOBM      MSNISVIGTGSYVPNDIITNDFLSTIVDTSDEWIRTRTGILERRISKEENTIYMATESAKEAIKNANIDA
FABH_CLOBH      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKGENTIYMATESAKEAIKNANIEA
FABH_CLOB1      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKGENTIYMATESAKEAIKNANIEA
FABH_STRPG      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_STRP1      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_CLOBK      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKGENTIYMATESAKEAIKNANIEA
FABH_STRTD      ----KISQVAHYAPAQVVTNDDLSKIMDTSDEWIRSRTGIQERRISLNENTSDLATNVAYQLLEKSGLSP
FABH_STRT1      ----KISQVAHYAPAQVVTNDDLSKIMDTSDEWIRSRTGIQERRISLNENTSDLATNVAYQLLEKSGLSP
FABH_CLOBJ      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKGENTIYMATESAKEAIKNANIEA
FABH_STRPD      ----KISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVADQLLTQSGLKA
FABH_CLOBL      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKGENTIYMATESAKEAIKNANIEA
FABH_STRT2      ----KISQVAHYAPAQVVTDDDLSKIMDTSDEWIRSRTGIQERRISLNENTSDLATNVAYQLLEKSGLSP
FABH_CLOB6      MSNISVIGTGSYVPNNIITNDFLSTIVDTSDEWIRTRTGILERRISKEENTIYMAIESAKEAIKNANIEA
FABH_NATTJ      MSNAKILATGKSVPDSIFTNEDLEKMVETSDSWITSRTGIKERRIAENTATSHLSVQAAEIALNKSGIEP
FABH_LACDB      MTYARIAKSSRYLPEFAVSNDDLSQIMETSDEWIKTRTGISSRRISQQENTSDLAIQVAKQLL--AGEDP
FABH_LACDA      MTYARIAKSSRYLSEFAVSNDDLSQIMETSDEWIKTRTGISSRRISQQENTSDLAIQVAKQLL--AGEDP
FABH_CLOD6      -----------YLPEQSYDNFHFEKIMDTSDEWISTRTGIKERRFAKSEATSDLASKAALKAIECAKLNV
FABH_PROM2      -----------YVPDQILTNEEISQKVDTSDEWIKSRTGISERRISVEDNVADMGYKAALTAIEMANWDI
FABH_CLOK5      MNKVEIAGLGSYVPPKILDNNDLSLIVDTNDEWIRCRTGIRQRRISQGENTSEMATKAAINAMKSANIKA
FABH_CLOK1      MNKVEIAGLGSYVPPKILDNNDLSLIVDTNDEWIRCRTGIRQRRISQGENTSEMATKAAINAMKSANIKA
FABH_PROM9      -----------YVPDQILTNETISQKVDTSDEWIKSRTGISERRISLGDNVNDMAYEAALSAIEMTNWDI
FABH_ACHLI      ---IKIVSTGRYAPDNIMTNDDFSKILDTNDEWITTRTGIKRRHIAQGETAIDMAYKAALKAVENKNYDK
FABH_GRATL      MQGAQIISIGSAVPDLCINNKEISQIVETSDEWIVTRTGIQERRVGTNKSVVDLAYSAAMKALDKIHMDP
FABH_SULDN      -----------YVPSKILSNEDLSKMVDTTDEWITKRTGIKERHIAADEFTSDMGAKAAQIAIERSGIEK
FABH_PROM0      -----------YVPDQILTNQKISQKVDTSNEWIKSRTGISERRISLGDNVNEMGYKAALTAIEMANWDI
FABH_AQUAE      --------TGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKEETITYMATQAAKEALREANLSP
FABH_EHRCJ      -----------YLPKKVVTNDELTLTIETSDEWIVKRTGIKQRHIAENEMTSDMATSAAKLALDNAGIDK
FABH_DESHY      MVSVGIVGTGSYVPDKVLTNFDLEQMVDTNDQWIVSRTGIKERHIAEPETVSELCYQAAVRALEDAKLAP
FABH_DESHD      MVSVGIVGTGSYVPDKVLTNFDLEQMVDTNDQWIVSRTGIKERHIAAPETVSELCYQAALRALEDAKLAP
FABH_DICNV      --------TGGYLPSRIVSNDELSQSMQTSDEWIYSRTGIRQRHLSPDESCSDMAFYAAKRALENAHIEA
FABH_PROMP      LNQIGVSFSGSYVPNQILTNQEISKKVETSDEWIKSRTGISQRRISLSENVSEMGYKAALGAIEMARWDI
FABH_NITEC      --------TGSYLPEKILTNLELESMVDTSDEWIQARTGIKQRHIAAGQMASDLALEASRNAIEAAGIQA
FABH_THEEB      VQGVKFSGVGAATPRQCLTNAHLSALVDTSDEWIQSRTGIQERHVAADQRLVDLASEAAGAALQMAGLDP
FABH1_BACAN     --NVGILGIGRYVPEKVVTNHDLEKIMDTSDEWIRTRTGIAERRIADDTDTSYMAVEASKKALEDAGISG
FABH_CHLTE      -----ITTTAKYLPEEIMSNQDLERILDTNDEWITTRTGIKERRILRDKATSYMCTEVARQLLEKRGISA
FABH_PROM5      -----------YVPHQILTNHEISKKVDTSDEWIKSRTGISQRRISLSENVSEMGYKAGLAAIEMAKWDI
FABH_PERMH      ------------IPERILTNFDLEKFLDTSDEWITTRTGIKERRIAEEEKASDIALPAAKEAIENAGLTP
FABH_CAMFF      MKKASIISVGAYIPKDILTNFDLEKMVDTSDEWIVKRTGIKTRHLAKNEVTSDLAYKAALMAIQRAGIDK
FABH_XANCP      -----IAGTGSYLPEKVLTNDDMSKIVDTSDEWIRSRTGIRERHIVADDTTSDLAYFASLKAMEAAGVTA
FABH_CAMJJ      ---------ASYIPEKILSNADLEKMVDTTDEWITRRTGIKERRISENENTSDLGTKAALKAIERANLKP
FABH_CAMJE      ---------ASYIPEKILSNADLEKMVDTTDEWITRRTGIKERRISENENTSDLGTKAALKAIERANLKP
FABH_POLSJ      -----ITGTGSYLPPRRLTNXXXTKGVETSDEWIVERTGIRARHFAAPDSSSDLAVKAARHALEAAGRQA
FABH_SYNY3      ------------IADQSLTNQDLSNIVETSDEWIQSRTGMRQRYISAQENLASLGVKAGQKALAMAGLQP
FABH_BRAJA      -----------YLPEQVVTNAQLAARIDTSDEWIVQRTGIRERHIAAEEFTSHLAIKAAQAALTDAGVDA
FABH_CAMJ8      ---------ASYIPEKILSNADLEKMVDTTDEWITRRTGIKERRISENENTSDLGTKAALKAIKRANLKP
FABH_PROMT      -------------PQKIIKNDQLGQRVDTNDEWIQTRTGIQRRVIGENESLIDLATDAAVNAVKMADWDV
FABH_CAMJR      ---------ASYIPEKILSNADLEKIVDTTDEWITRRTGIKERRISENENSSDLGTKAALKAIERANLKP
FABH_MICAN      -------------PAQFLSNEELSQIVETSDEWIKSRTGIGKRHLADRXXXXXXXXXXXXXXXXXXXXSP
FABH_SPIOL      ------------VPKLQISNDDLSKFVETSDEWIATRTGIRQRHVSGKDSLVDLAAEAARNALQMANVNP
FABH_METCA      -----IAGTGGYLPRQVVTNDDLAMRVETSDEWIVERTGIRRRHIAAADETASSMAEIASRALEAAAIDP
FABH_TRIEI      ------------IPKTSLDNQQLSQIVETSDEWIISRTGINKRQVDTTESLCSLATQASLAALNQANITP
FABH_CAMJD      ---------ASYIPEKILSNTDLEKMVDTTDEWIARRTGIKERRIANNENTSDLGTKAALKAIERANLKP
FABH_XANC8      -----IAGTGSYLPEKVLTNDDMSKIVDTSDEWIRSRTGIRERHIVADDTTSDLAYFASLKAMEAAGVTA
FABH_XYLFA      -----IAGTGGYLPEKVLTNDDLAHIVDTSDEWIRTRTGIRERHIAAEETTSDLXXXXXXXXXXXXXVRS
FABH_THETN      --------TGSYLPEKILTNFDLEKMVDTSDEWITTRTGIKERRIAPSQATSDLATEASKRALEDANLKP
FABH_XYLFT      -----IAGTGGYLPEKVLTNNDLAHIVDTSDEWIRTRTGIRERHIAAEETTSDLXXXXXXXXXXXXXVRS
FABH_ARCB4      -----------YIPPKIMSNADFEKIIDTSDEWITKRTGIKERRIANEEASSDLGARAGELAIERAAISK
FABH_XANC5      -----IAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDTTSDLAYFASLKAMEAAGVTA
FABH_PASMU      ----KILSTGSYLPKHIRTNADLEKMVDTSDEWISERTGIKERRIAASETVATMGFEAAQNCLAVSPMDV
FABH1_LACPL     ----KLTAMGQYVPGRVVDNDELAAIMDTSDEWIQAHTGIKTRHYAMNENTSDLATQVAQQLLQKSGLAA
FABH_XANAC      -----IAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDTTSDLAYFASLRAMEAAGVTA
FABH_ARATH      ------------VPSLLISNDDLAKIVDTNDEWIATRTGIRNRRVSGKDSLVGLAVEAATKALEMAEVVP
FABH_CAMC1      ---------ASYVPEKILTNFDFEKMVDTSDEWIVKRTGIEQRHIATTEITSDLGTKAAELAIKRSGLEK
FABH_RICRS      -----------YLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDEYTSHLALKSAEKAIADAGISV
FABH_RICRO      -----------YLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDEYTSHLALKSAEKAIADAGISV
FABH_RICCN      -----------YLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDEYTSHLALKSAEKAIADAGISV
FABH1_BACCR     --NVGILGIGRYVPEKVVTNHDLEKIMETSDEWIRTRTGIAERRIADDTDTSYMAVEASKKALEDAGISG
FABH_STAAW      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAAT      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAAS      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAAE      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAAC      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAA8      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAA3      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASLKAIADAGIQP
FABH_STAAR      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAAN      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAAM      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAAB      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAA9      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAA2      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_STAA1      --NVGIKGFGAYAPEKIIDNAYFEQFLDTSDEWISKMTGIKERHADDDQDTSDLAYEASVKAIADAGIQP
FABH_SULNB      -----------YVPSKILSNADLEKMVDTTDEWIVKRTGIKERHIAADEYTSDMGAKAAKLAIERAGIEK
FABH_PORPU      ---VHILSTGSSVPNFSVENQQFEDIIETSDHWISTRTGIKKRHLAPSSSLTKLAAEAANDALSKASINA
FABH_VESOH      --------TGSYLPPTVITNDDLSKTINTTNEWIVARTGIKQRHKVTNETTCDLAEKAANRALEMAGINV
FABH_PROMM      -------------PSQRISNDQLGQRVDTSDAWIRSRTGISARRIGPDETLTGLSHQAAANALTMAGWEP
FABH_RICFE      -----------YLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDEYTSHLALKSAEKAIADARVSV
FABH_NEIMA      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXGLNG
FABH_FUSNN      MQSIGIKGMGYYVPENVFTNFDFEKIIDTSDEWIRTRTGIERRFASKDQATSDLATEASLKAIKNAKISK
FABH_POLNA      -----ITGTGSYLPPNRLTNAQLAKGVETSDEWIVERTGIKARHFAAPDVTSDLGLEAAKRAIEAAGLQA
FABH_PHOLL      --------TGSYLPAQVRTNADLEKMVDTSDEWIVTRTGVRERRLATDDETAVMGFRAAKKAIEMSGIDK
FABH2_CUPWR     ------------MPALQVSNDDLSKIVDTNDEWISVRTGIRNRRVLTGESLTNLATVAARKALEMAQVDA
FABH_WOLPM      --------TGSYLPRKMLSNNEIASIVETSDEWIRQRTGIVQRHIAEGELTSDLAVNXXXXXXXXXXXXV
FABH_RICM5      -----------YLPSKIVSNDELAKFVDTNDAWIRTRTGITQRHIAGDEYTSHLALESAEKAIADAGISV
FABH_NITMU      MKYARVIGTGSYLPEKILTNHDLERMVDTSDEWIRTRTGIAQRHIAADEMASDLALNASREAIKAGGIDA
FABH_DIAST      -----ITGTGSYLPPHRVTNDDLVQGIETSDEWIVERTGIRARHFADRDVTXXXXXXXXXXXXXXXGCQA
FABH_BRASO      -----------YLPQRVVTNAELASRIETSDEWIVQRTGIRERHVAADEFTSHXXXXXXXXXXXXXDVDP
FABH_ACISJ      -----ITGTGSYLPPHRVTNDDLVQGIETSDEWIVERTGIRARHFADRDVTXXXXXXXXXXXXXXXGCQA
FABH_ACAM1      -------------PETSLDNHGLSQIVDTSDEWIASRTGIRSRHLAGPDDTAKLGAIAAQNALEMAQVEA
FABH2_STAES     ----KITAQGTYVPEKVMDNNDFEKIVETSDEWIQQRTGIIERRIAENEYTSDLSYKAVLDLQEKYQVDL
FABH_NITEU      --------TGSYLPEKVLTNQDLESMVDTSDEWIRTRTGIERRHIAAEQMASDLALEASRNAIEAADIQA
FABH_MARAV      -----IAGTGSYLPDNIVTNRDLEQKVETSDQWIRERTGIEQRHIALGQSTVDXXXXXXXXXXXXXXXXX
FABH_CAMC5      ---------ASYVPEKILTNFDLEKMVDTSDEWIVKRTGIKERHIAEGEITSDLGTKAAKLAIKRAGLEK
FABH_BURS3      --------TGSYLPPDRVTNQQLTEGIETSDEWIVARTGIHARHFAAPDTTSDLALEASRRAIEAAGIDP
FABH_DELAS      -----ITGTGSYLPPRRLTNHDLAAELETSDEWIVERTGIHARHFAAPDXXXXXXXXXXXXXXXXXGCQP
FABH_BURCH      --------TGSYLPPDRVTNQQLTEGIETSDEWIVARTGIHARHFAAPDTTSDLALEASRRAIEAAGVDP
FABH_BURCC      --------TGSYLPPDRVTNQQLTEGIETSDEWIVARTGIHARHFAAPDTTSDLALEASRRAIEAAGVDP
FABH_BURCA      --------TGSYLPPDRVTNQQLTEGIETSDEWIVARTGIHARHFAAPDTTSDLALEASRRAIEAAGVDP
FABH_NEIG2      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXKLNI
FABH_NEIG1      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXKLNI
FABH_CHLPD      -----ITATAKYLPQSVLSNHDLEQMLETNDEWIRSRTGIGERRIMNDPSTAYMCGEVALQLLEARKMKP
FABH1_CUPWR     ------------IPSLQISNDDLAKIVDTNDEWISVRTGIRNRRVLTGDSLTNLASEAARKALEMAQIDA
FABH_WOLPP      --------TGSYLPKKILSNNEIALIVETNDEWIRQRTGIVQRHIAEGELTSDLXXXXXXXXXXXXXXXX
FABH_BRASB      -----------YLPQRVVTNAELASRIETSDDWIVQRTGIRERHVAAEEFTSHLXXXXXXXXXXXXDVDP
FABH_ACIAC      -----ITGTGSSLPPRRLTNADLVAELETSDQWIVERTGIRARHFAERDCSSDLGLEAARQALDAAGVQP
FABH_PELLD      --NAAISATARYLPEGVLSNLDLERMLDTNDEWIRSRTGISERRILRDKATSYMCGEVASQLLRKRGLAA
FABH_BRUO2      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAKGETTVSLGXXXXXXXIENAGLQP
FABH_BRUSI      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUME      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUMB      ------------LPKRVMKNTDFEGIIETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUAB      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUA2      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUA1      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_EHRRG      -----------YLPKSLVTNDELACTVETSDEWIVKRTGIRQRYIAADDQTSDMAVEAAKLALNDSGINK
FABH_CHLCH      -----ITATANYLPPDILSNHDLELMLDTNDEWIRSRTGIGERRILKDKATSYMCGEVARQLLEKRQLAA
FABH_CAMHC      MKNAAMLSIGAYVPPYELSNFDLEKMVETSDEWIVKRTGIHTRHIAKNETXXXXXXXXXXXXISRSGISK
FABH_WOLTR      --------TGSYLPKKKLGNDEIALMVETSDEWIRQRTGITQRYIADEELTSDLAVNSAKNAIEKAQISV
FABH_SYNR3      MKGIRLCGSGAAVPRLRISNDDLSGRVETSDEWIRTRTGIAARRVAESESLTSLXXXXGKQALERAGWDA
FABH_EHRCR      -----------YLPKKIVTNDELALTVETSDEWIVKRTGIKQRHIAENEMTSDMXXXXXXXXXXXXCVHK
FABH_BRUSU      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_BRUC2      ------------LPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAEGETTVSLGXXXXXXXIENAGLQP
FABH_NEOSM      -----------YLPKKVLTNFDLEELVDTSDEWILRRTGIKTRYIAEEEDVCELAFRASLNCLERAHFSQ
FABH_ACTSZ      --NSRILATGSYLPTRVRTNADLEKMVETSDEWIVTRSGIRERRLAAHETVATMGFEAAKKALETAKIDP
FABH_ACTP2      ----KILATGSYLPAQIRTNADLEKMVDTSDEWIFTRSGMKERRIAADETVATMGAQAAKNALEIANIDH
FABH_OCEIH      --NIGILGTGHYLPTNVVTNNDLEKIVDTNDEWIRTRTGIRERRLATEEDTSDMAFHXXXXXXXXXXXXX
FABH_NEIMF      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXGLDS
FABH_NEIM0      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXGLDS
FABH_EHRRW      MRSSRILGIGSYLPKSLVTNDDLACTVATSDEWIVKRTGIRQRYIAADDQTSDMAVEAAKLALNDSGINK
FABH_BURP0      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAASDTTSDLALVAAQRAIEAADVDP
FABH_NEIMB      MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAANEKTSXXXXXXXXXXXXXXXXXS
FABH_RICCK      ----------QYLPSKIVSNDELTKFVDTNDEWIRTRTGITQRHIADDEYTSHLALKSAEKAIEDAGISA
FABH_AZOSE      -----IAGTGSFLPGEPITNDDLVRGIDTSDQWIIERTGIRSRHLASAESSSDLAKTASERALDAAGVRP
FABH_RICAH      -----------YLPSKIVSNDELAKFVETNDEWIRTRSGISQRHIADNEYTSHLALKSAEQAIADARVSA
FABH_HAES1      --------TGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIAENETVATMGFKAAKNALQLANICP
FABH_BURTA      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIHARHFAAPDTTSDLAFVAAQRAIEAADVDP
FABH_BURPS      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH_BURP6      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH_BURP1      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH2_VIBPA     ----EITGWGKCVPPTVLSNDDLSTFLDTSDEWIRTRTGIENRRIS-HVNTSDMATVAAQHALARAGVEA
FABH_BURMS      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH_BURMA      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH_BURM9      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH_BURM7      --------TGSYLPPDRVTNQELADRLETSDEWIVARTGIRARHFAAPDTTSDLALVAAQRAIEAADVDP
FABH2_VIBVY     ----EITGWGKCLPPAVLSNDDLSTFLDTSDEWIRTRTGIENRRIS-HVNTSDLATVAAKQALARAGITA
FABH_VARPS      -----ITGTGSYLPPRRVTNDDLTRGIETSDQWIVERTGIHARHFAAPEVTSDXXXXXXXXXXXXXXXXX
FABH_VIBF1      --------TGSYLPAQIRSNADLEKMVDTSDEWILARTGISERRIAEDESVATMAHLASVNAIEMAGIDK
FABH_HAES2      --------TGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIAENETVATMGFEAAKNALQLANICP
FABH_BURP8      --------TGSYLPPNRVSNQDLAQGIETSDEWIVARTGIHARHFAEPDTTSDLALIASQRAIEAADVDP
FABH_GRABC      MKRSIIAGVGAYLPSTVVSNDELAKRVDTSDAWIRERTGIEQRYLATDESCXXXXXXXXXXXXXXXGMTA
FABH_HELPG      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFASNEESSDLGVIAAKQAIERAHLTP
FABH_BARBK      ------------LPKKKLSNDEIAKFVETSDSWIVQRTGIHQRYISENETTVSLGIEAAQVALTNAGMTI
FABH2_VIBVU     ----EITGWGKCLPPAVLSNDDLSTFLDTSDEWIRTRTGIENRRIS-HVNTSDLATVAAKQALARAGITA
FABH_SPHAL      --------TGSALPRTRVSNAELAERVDTSDEWIVERTGIRFRHIAEDETTATXXXXXXXXXXXXXXXQP
FABH_RHOCS      -----------YLPARVLTNEDLTRIVETSDEWIVERTGIKSRHIAADENTSDLXXXXXXXXXXXXXXXX
FABH_HELAH      ---------AMHAPSECIKNVAFQEFLDTSDEWIEKRTGIKERRFSVGEKSSDLGVIAAKQAIERAHLTP
FABH_ACIBL      ----KITALGTYVPPRVLSNFDLEKMVDTTNQWILERTGIRERHVDKGVAASDLAVEAAKKCLANRGIEA
FABH_HELPH      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFASNEESSDLGVIAAKQAIERAHLTP
FABH_BART1      ------------LPKRSLSNDELAKFVETSDAWIVQRTGIHQRYIANNETTVSLGVKAAQAALINAGLTI
FABH_MESSB      ------------LPRRVVTNKDLETRLETSDEWIVQRTGIRQRHISDDETTASLGEXXXXXXXXXXXXXX
FABH_THISH      MTYARITGTGGCLPEKILTNHDLEKMVETTDEWIQERTGIKKRHVAPEETTCDLXXXXXXXXXXXXXXXX
FABH_SPHWW      --------TGSALPRRQVSNAELARTVDTSDEWIVERTGIRNRYVAEGETTSTLXXXXXXXXXXXXXXXP
FABH_ANAVT      MQNLGIAITGSAAPETSLHNEELSQLVETSDEWISTRTGIRQRRXXXXXXXXXXXXXXXXXXXXXXGITA
FABH_ANASP      MQNLGIAITGSAVPETSLHNEELSQLVETSDEWISTRTGIRQRRXXXXXXXXXXXXXXXXXXXXXXGITA
FABH_SOLUE      MPKAKISALGCYTPPRVLTNQDLEKLVDTNDQWIMERTGIRERHIAAPEATSDMAIEAARCALLQRGIDA
FABH_PSEA6      --NSRIIGTGSYYPSDVRTNADLSLMVDTSDEWITDRTGIKERRIGEHETAATMGFEASKKALEAAGIDA
FABH_HELPJ      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFANDEESSDLGVIAAKQAIERAHLTP
FABH_HELP2      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFANDEESSDLGVIAAKQAIERAHLTP
FABH_BARHE      ------------LPKKSLSNDDIAKFVETSDSWIVQRTGIRQRYIANEETTVSLGVEAAQAALINAGLTI
FABH_ALHEH      MSYARIIGTGSYLPDEVITNHDLERLIDTSDEWXXXXXXXXXXXVAPDQTCGDXXXXXXXXXXXXXDVSL
FABH_HELPS      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFANDEESSDLGVIAAKQAIERAHLTP
FABH_RICBR      -----------YLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDEYTSHXXXXXXXXXXXXXXXSV
FABH_HYPNA      --------TGSYLPERVLTNDELSEMVETTDAWIQERTGIKKRHVAADELTSDIXXXXXXXXXXXXXXXX
FABH1_VIBPA     --------TGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETADMAFYAAENAIDMAGIDK
FABH_HELPY      ---------AMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFANDEESSDLGVIAAKQAIERAHLTP
FABH_OCHA4      ------------LPKRVMKNTDFEGIIETSDEWIVQRTGIRERHIAGDETTVSLGTAAARAAIENAGLQP
FABH_SILST      -----------YLPDRIVENAEFEATLDTSDEWIRSRSGIERRHFAAEETTSHMATRAAEAALKSAGRSA
FABH2_VIBCH     ----EITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRIS-HVNTSDLATVAAQHAIACAGVSV
FABH_XANOM      -----IAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDATSDLAYFASLKAMEAAGVTA
FABH_VEREI      --------TGSYLPPRRLTNADLVAELETSDEWIVERTGIRARHFAAPDSSSDXXXXXXXXXXXXXXXXX
FABH_SYNPW      ---------------QVISNDQLSQRVDTNDEWXXXXXXXXXXXVSTADQTVDLAAEAGRSALTMAGRSP
FABH_PORUM      ---VHILSTGSSVPNFSVENQQFEDIIETSDHWISTRTGXXXXXXXXXXXXTKLAAEAANDALSKASINA
FABH_DEIGD      --SIGITALGTYVPPRVVTNKDFEAHMDTSDEWIVSRTGIRERRFAANEFTSDLGVRAVQDLLARDPDGL
FABH_BURVG      --------TGSYLPPDRVTNQQLAEGIETSDEWIVARTGIHARHFAAPDTTSDLAYQXXXXXXXXXXXXP
FABH_RICB8      -----------YLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDEYTSHXXXXXXXXXXXXXXXSV
FABH_ERWCT      --------TGSYLPEEIRTNADLEKMVETTDEWIVTRTGIRERRIAADENVATMGYRAAQKALEMANVDA
FABH_STAEQ      --NVGIKGFGAYAPKNIIDNAYFEQFLETSDEWISKMTGIKERHADEDQDTSDLAYNASIKAIEDAGIQP
FABH_PROVI      --NAAITATAKYLPDGILSNLDLERMLDTNDEWIRTRTGISERRILRDKATSYICGEVARQLLEKRGMKA
FABH_BAUCH      --------TGSYLPTQIRSNTDLANMVDTSDEWIIARTGIRERRISANETVFSMGSSAAEQALHMAGISA
FABH1_STAES     --NVGIKGFGAYAPKNIIDNAYFEQFLETSDEWISKMTGIKERHADEDQDTSDLAYNASIKAIEDAGIQP
FABH_SALTY      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRKRHIAANETVATMGFTAANRAIEMAGIDK
FABH_COXBU      MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANDNTTTMAVDAAKRAIEMAGIDP
FABH_HAEIN      --NSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETATMGFEAAKNAIEAAQINP
FABH_HAEIG      --NSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETATMGFEAAKNAIEAAQINP
FABH_HAEI8      --NSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETATMGFEAAKNAIEAAQINP
FABH_BARQU      ------------LPKKSLSNDEIAKFVETSDSWIVQRTGIRQRYIANNETTVSLGVEAARVALINANLTI
FABH_MAGSA      -----------YLPSRLVTNAELAAQVDTSDEWIVERSGIRQRHIAAEETTSDXXXXXXXXXXXXXGISG
FABH_HELHP      ---------ASYIPPTCISNVDFEKTLDTNDEWITKRTGIKTRYFALSQQTSDLAYEAGKKAIERAGIEP
FABH_SALPB      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAANETVATMGFTAANRAIEMAGIDK
FABH_SALCH      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAANETVATMGFTAANRAIEMAGIDK
FABH1_VIBVY     --------TGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAANETVADMGFYAAQNAIEMAGIDK
FABH1_VIBVU     --------TGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAANETVADMGFYAAQNAIEMAGIDK
FABH_SODGM      --------TGSYLPAHIRSNADLEKMVDTSDEWIVTRTGIRERRIAADETVSSMGRDAAEQALTMAGIAV
FABH_SALTI      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAANETVATMGFTAANRAIEMAGIDK
FABH_SALAR      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAANETVATMGFTAANRALEMAGIDK
FABH_GEOKA      ----------RYVPEKVLTNFDLEKMMDTSDEWXXXXXXXXXXXXAADDDTSDMAYFAAKRALQDAGMEA
FABH_COXBN      MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANDNTTTMAVDAAKRAIEMAGIDP
FABH1_DEIRA     MKSIGITAIGMYVPERVVHNHEFESRMGIEDGWIESRSGIRERRFSAGEFASHIGAKAVQDMLARDPDAL
FABH_PSEHT      MPYAHITGWGKCIPPASISNDEISKIVDTTDEWITSRTGIKSRRVS-HVSTAELATVAAKHAIACAGIDA
FABH_COXBR      MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANDNTTTMAVDAAKRAIEMAGIDP
FABH_CITK8      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAANETVATMGYTAANRALEMAGIDK
FABH2_BACHD     -----ITAIGSYVPERRLTNDDLEKMVDTNDEWIVKRTGIRERRIAADEFTSDIGYKAVQDLIARYEKSV
FABH_SHISS      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_SHIFL      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_SHIF8      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_SHIBS      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOUT      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOLI      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOLC      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOL6      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOL5      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOK1      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECOHS      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECO57      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_ECO24      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_COXB2      MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANDNTTTMAVDAAKRAIEMAEIDP
FABH_SHIDS      --------TGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAANETVSTMGFEAATRAIEMAGIEK
FABH_SALPA      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAADETVATMGFTAANRAIEMAGIDK
FABH_COXB1      MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANDNTTTMAVDAAKRAIEMAGIDS
FABH_CHRVO      --------TGSFLPSQVLTNAQLAERVETSDEWIVSRTGIRARHIAEGHKTSDLXXXXXXXXXXXXGIDK
FABH_STAHJ      --NVGIKGFGAYAPEKVVDNAYFESFLETSDEWISKMTGIKERRASENQDTSDLAFEASKKAIKDAGITP
FABH_BLOFL      --------TGSYLPKYIRSNIILEKMVDTSNAWIIARTGIKERRISSSETVAKMGYFASKKALDMSCIEA
FABH2_DEIRA     ---IGILAVGAYAPAAVITNAHYATRLDTSDDWITSRTGIRRRHAAPDESSSVLGIRATQDLAGRFPGAL
FABH2_BACTN     --NAVITGVGGYVPDYILTNEEISKMVDTNDEWIMTRIGVKERHI-LNEESSYMARKAAKQLMKKTGANP
FABH_POLNS      -----VAGTGSYLPELRLTNQDLVERLETSDEWIKTRSGISARHFAANELTSDLAVRAAEAALSSTGINS
FABH_ENTS8      --------TGSYLPEHVRTNADLEKMVETSDEWIVTRTGIRERRIAAGETVATMGYEAALRAIDMAGIDK
FABH_BACV8      --NAVITGVGGYVPDYVLTNEEISRMVDTNDEWIMTRIGVKERRI-LNEETSYMARKAAKQLMQKTASNP
FABH_ACICJ      MQRTVLEGVGSYLPERIVTNHELATRIDTSDAWIRERTGIGQRHIAAAHETATMXXXXXXXXXXXXXXXX
FABH_ERYLH      ------------LPRKVVTNEELAARVDTSDEWIVERTGIRQRYIAADEFTSTLAMEASRKALEAAGITP
FABH_SILPO      -----------YLPERVVPNAAFEKTLDTTDEWIRSRSGIERRHFAAEETTSDLXXXXXXXXXXXXXXXX
FABH1_VIBCH     --------TGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAANETVADMAFFAAQNAINMAGIDK
FABH_ANAMM      -----------FLPAKVITNDDLSLMVDTTDEWVFRRTGIKRRHVVEEGDTVSMATEAAKIALEDAGVSA
FABH_RICTY      -----------YLPQKIISNDELTKFVDTNDKWIRTRTGIFQRHIAGDEYTSHLALKSAQKAIEDAMISV
FABH_BORA1      -----IAGSGSYLPERVVSNDELARGIQTSDEWIVERTGIRQRHLARGVTTSVLXXXXXXXXXXXXGVGP
FABH_BLOPB      --------TGSYLPKNIRSNIVLEKMVDTSHEWIVARTGIQERRISTSDETAKMGYFAAKRALDMSCVHS
FABH_HAEDU      ----KILATGSYLPKQVRSNADLEKMVDTTDEWIFTRSGMKERRIAADETVATMGXXXXXXXXXXXXIDV
FABH_AZOSB      MIHARIAGTGSYLPGNPVSNDDLVRGIDTSDDWVVSRTGIRTRYLAPPDGSSDLALVAAQRAIEAAGCAA
FABH_KLEP7      --------TGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERRIAAHETVATMGFEAAKQALAMAGVSA
FABH_JANSC      -----------YLPERVVPNAEFEEGLETSDEWIRARSGIERRHFAAEETTSQMAVTAARKALDHAALNP
FABH_CHLPN      --------TGSYLPEKVLSNADLEKMVDTSDEWIVTRTGIKERRIAPQEYTSLMGXXXXXXXXXXXGLSK
FABH_BORBR      MKYAKIAGSGGYLPERVVTNDDLTRQISTSDEWIVERTGIRQRHLARGVTTSQLATEAARRAMDDAGVQA
FABH_AGRVS      ------------LPKRLLSNREMETLVDTSDDWIVQRTGIKQRYIAEGETTXXXXXXXXXXXXXXXXXXX
FABH_ROSS1      ------------VPERVLTNADLERIVETSDEWIQTRTGIRERRVAPGEYTSTLSIXXXXXXXXXXXXXX
FABH_PSYIN      --NSKIIGTGGYLPVTVRSNDDLEKMVDTSDEWITTRTGIKERRIANQQETAFMGKXXXXXXXXXXXXXX
FABH_NOVAD      ------------LPRRAVSNAEMTTMVDTTDEWIVERTGIRNRYIAEGETTSXXXXXXXXXXXXXXGVDA
FABH_BORPA      MKYAKIAGSGGYLPERVVTNDDLTRQISTSDEWIVERTGIRQRHLARGVTTSQLATEAARRAMDDAGVQA
FABH_STAS1      -----------YAPEKVVENTYFESFLETSDEWISQMTGIKERRAGEDEETSDMAYQASLKAIEDAGIEA
FABH_RHOS4      -----------YLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEQTTSXXXXXXXXXXXXXXGLQP
FABH_RHOS1      -----------YLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEQTTSXXXXXXXXXXXXXXGLQP
FABH_ENT38      --------TGSFLPKQVRTNADLEKMVDTSDEWIVTRTGIRERRIAADETVSTMGYEAGLRALEMAGVDK
FABH_SYNWW      ---VQILGMGHSLPERILNNQELEQMVDTSNEWIVERTGILERRIADKDTTSDLCWQAAKMALERSATEA
FABH_ROSCS      ------------VPERVLTNADLERMVETSDEWIQTRTGIRERRIAPGEHTSALSIXXXXXXXXXXXXXX
FABH_BORPE      MKYAKIAGSGGYLPERVVTNDDLTRQISTSDEWIVERTGIRQRHLARGVTTSQLATEAARRAMDDAGVQA
FABH_DEIDV      -----------YTPERIVRNEDFEARMDTNAAWIESRTGIRERRFAAHEYTSDMGVRAVQDMLRRDPQAL
FABH_YERPS      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKALEMAGIDK
FABH_YERPP      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKTLEMAGIDK
FABH_YERPN      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKALEMAGIDK
FABH_YERPE      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKALEMAGIDK
FABH_YERPA      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKALEMAGIDK
FABH_YERP3      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIALDETVATMGFQAAEKALEMAGIDK
FABH1_BACTN     --NAVITGVGGYVPDYVLTNDEISKMVDTTDEWIMGRIGIKERHI-LNEETSYMARKAAKQLMQRTKSRP
FABH_BACP2      --NAGIIGLGRYIPEKVLTNLDLEKMVETSDEWXXXXXXXXXXXXASDDNTSHMXXXXXXXXXXXXXXXX
FABH_SERP5      --------TGSYLPVQVRTNADLEKMVDTSDEWIVSRTGIRERRIAADETVATMGFHAAEKALEMAGVAK
FABH_SINMW      ------------LPKRVMTNKEMESKVDTSDEWIVQRTGIRQRYIAGDETTASXXXXXXXXXXXXXXLTP
FABH_RHOFD      -----ITGTGSYLPPRRLTNSDLTQGVETSDDWIVERTGIRARHFAAPECSSDLXXXXXXXXXXXXXXXX
FABH_RALPJ      --------TGSYLPPKRVTNDELAKGIETSDEWIVSRSGIRARHFAEPDVTSDLXXXXXXXXXXXXGIDR
FABH_JANMA      --------TGSYLPPNRVTNQELTAQLETSDEWIVSRSGISARHYAAGVQSSDLAVEAAKRALEMAKLGV
FABH_DESPS      --SVVILGTGSCLPEKIVTNKDLEKIVETNDEWIRTRTGICERRIAPGEQAYILASRAAKNALDAAGLVA
FABH_CHLCV      --------TGSYLPEKILSNSDLEQMVDTSDEWIVTRTGIKERRIAAGEYASIMGXXXXXXXXXXXGLTK
FABH_YERE8      --------TGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGPDETVQAAKKALEMAVIDEGIDK
FABH_SYNP6      ---VAITGSGSAVPSTTLSNDQLSQLVETSDEWIRSRTGIGQRRVAQPQXXXXXXXXXXXXXXXXXXXXX
FABH_SYNE7      ---VAITGSGSAVPSTTLSNDQLSQLVETSDEWIRSRTGIGQRRVAQPQXXXXXXXXXXXXXXXXXXXXX
FABH_RALEH      --------TGSYLPPRRVTNHDLAKGIETSDDWIVSRSGISARHWAEPDVTSDLXXXXXXXXXXXXGIDR
FABH_LISW6      --NAGILGVGKYVPERILTNFDLEKMMETSDXXXXXXXXXXXXXXXXDEYTHDLAYEAAKVAIENAGLTP
FABH_LISMO      --NAGILGVGKYVPEKIVTNFDLEKIMDTSDXXXXXXXXXXXXXXXXDEYTHDLAYEAAKVAIKNAGLTP
FABH_LISMF      --NAGILGVGKYVPEKIVTNFDLEKIMDTSDXXXXXXXXXXXXXXXXDEYTHDLAYEAAKVAIKNAGLTP
FABH_AGRT5      ------------LPKRVMTNSEIEGVVETSDEWIVQRTGIRQRYIAEGEXXXXXXXXXXXXXXXXXXXXP
FABH_GLOVI      MPAVQMTGVGGAVPAQVLTNYHLSELVTTSDEWIASRTGIRSRRIAPGQSLTQLAARAATDALSQAGRSP
FABH_RHOBA      LKGVRIAGTGSYVPERIVTNEDLAALGCDSD-WIVRRTGIQRRHAEPGQATSDLCYEAALRCLENANVSV
FABH_RHIME      ------------LPKRVMTNKEIESRVDTSDEWIVQRTGIRQRYIAEGETXXXXXXXXXXXXXXXXXLTP
FABH_CUPTR      --------TGSYLPPRRVTNHELAKGIETSDEWIVSRSGISARHWAEPDVTSSLXXXXXXXXXXXXGIDR
FABH_CAUCR      -----------YLPSKVVTNDDLAKFVDTSDEWIVERTGIRQRHQAADDQVSDXXXXXXXXXXXXXXXXX
FABH2_BACAN     -----ITAIGTHVPNQILSNNDLEKMIDTNDEWIVQRTGMKERRISEDEYSSNLAIKAVENLCTTYKKNL
FABH_BORPD      -----IAGSGSFLPERVVSNDELTRNISTSDEWIVERTGIRQRHLARGVTTSFLXXXXXXXXXXXXXXXX
FABH_RICPR      -----------YLPPKIISNDELTKFVDTNDKWIRTRTGILQRHIAGDEYTSHLAFKSAQKAIEDAMISV
FABH_PROMA      -------------PSQIVSNDQLALRVDTNDEWVKXXXXXXXXXXXXDESLTDLCVXXXXXXVDMAGWGV
FABH_HERAR      --------TGSYLPPNRVTNQDLIERLETSDEWIVSRSGISARHYAADMQSSDLAVEAAKRALDMAKLAA
FABH2_BACCR     -----ITAIGTYVPDQILSNNDLEKMVHTNDEWIVQRTGMRERRIASEEESSNLAIKAIENLCTTYKKNL
FABH_RALEJ      --------TGSYLPPRRVTNQDLAKGIETSDEWIFSRSGISARHADPDVASSDLXXXXXXXXXXXXGIDR
FABH_LISIN      --NAGILGVGKYVPEKILTNFDLEKMMETSDXXXXXXXXXXXXXXXXDEYTHDLAYEAAKVAIENAGLTP
FABH_RHIL3      ------------LPKRVMTNRDMEAIVDTSDEWIVQRTGIRQRYVAGDEXXXXXXXXXXXXXXXXXXXXP
FABH1_STRCO     -----------YRPTRVVPNEVILEKIDSSDEWIRSRSGIETRHWAGPEETAAMSVEASGKALADAGIDA
FABH_AZOPC      -----------YVPEYKLTNEEISTMVDTSDEWILKRIGIKERRILKPEEGKGLALKAIEDLKSRHDFDP
FABH_PORGI      --NAAITAVGAYLPEDVITNDDLEKMVDTNDEWIMTRVGIKERRIDKNKGASYLAIRAAQDLFERHGIDP
FABH_PORG3      --NAAITAVGAYLPEDVITNDDLEKMVDTNDEWIMTRVGIKERRIDKNKGASYLAIRAAQDLFDRHGIDP
FABH_ROSDO      -----VTGVGHYLPDRIVPNSEFEKTLDTNDEWIRARSGIERRHFXXXXXXXXXXXXXXXXXXXXXXXXX
FABH_POLSQ      -----IAGTGSYLPELRLTNQDLVERLETSDEWIATRSGISARHFAANELTXXXXXXXXXXXXXXXGITS
FABH3_STRCO     ------------LPSRCVTNAELERTMDTSDEWIRARTGIAQRYVAEEGTTSDLAVGAAERALKSARLTP
FABH2_BACSU     MSKAKITAIGTYAPSRRLTNADLEKIVDTSDEWIVQRTGMRERRIAEHQFTSDLCIEAVKNLKSRYKGTL
FABH_DINSH      -----VTGVGHYLPSRVVPNSELETLVDTTDEWIRTRSGIERRHFAADEQTSXXXXXXXXXXXXXXXXXX
FABH_CHLMU      --------TGSYLPKKVLTNADLEKMVETSDEWISTRTGIKERRISAEEFSSFMGXXXXXXXXXXXXXXX
FABH_RHOS5      -----------YLPDRIVPNSELEALVETTDEWIRTRSGIERRHFAAEQTTSXXXXXXXXXXXXXXGLQP
FABH_KOCRD      -----------YRPSEIVTNDDVCQWIESSDEWIVKRTGIHTRHRAPEDSVLDMAEHAAREALENSGLTG
FABH_PORYE      ---VHILSTGSSVPNFSVENQQFEDMIETSDHWISTRTGIKKRHLAPSSSLTXXXXXXXXXXXXXXXXXP
FABH_PARD8      --NAVITGVGGYVPEDVLTNEDISKMVDTTDEWIMTRVGIKERRILKGEGVSYMGIRAVKQLLEKTNLNP
FABH_CHLTR      --------TGSYLPKKILTNADLEKIVETSDEWISTRTGIKERRISAEEFSSFMGXXXXXXXXXXXXXXX
FABH_CHLTA      --------TGSYLPKKILTNADLEKIVETSDEWISTRTGIKERRISAEEFSSFMGXXXXXXXXXXXXXXX
FABH_RHILO      ------------LPRRIMKNADFEGMVETSDEWIVQRTGIRQRHIAADEXXXXXXXXXXXXXXXXXXXXP
FABH2_STRCO     ------------LPETVVDNDEVSRHLDTDHAWIHSRTGIRRRRVSPGTTTGDLAVTAGAAALKSAG--R
FABH_THIDA      --------TGGYLPARILTNADLEKLVDTNDQWIVDRTGIRERHIAADEFTSXXXXXXXXXXXXXXXXXX
FABH_RHOCA      -----------YLPARVVENAEFEGKLDTTDEWIRSRTGIERRHFAAEETTSQXXXXXXXXXXXXXXXXX
FABH_RHORT      -----------YLPANKVTNANLAERVETTDAWIRERTGILVRHFAAEEKTSXXXXXXXXXXXXXXXXXX
FABH_MYCA9      -----------YRPERVVTNDEICERIESSDEWIYTRTGIKTRRFAADEETAQLAIEAGRKAIANALLTG
FABH1_STRAW     -------------------NDVILEKIDSSDEWIRSRSGIETRHWASDEETAAMSIEASGKAIADAGITA
FABH_PARDP      --------TGHYLPERVVENSWFEDKLDTSDEWIRARTGIERRHFAAEDQTSXXXXXXXXXXXXXXXXXX
FABH_AGRRK      ------------LPKRVMTNRDMEQVVDTSDDWIVQRTGIRQRYIAEGETTASLGEQXXXXXXXXXXXXX
FABH_SHEON      --------TGSYVPVQVRSNQDLEKMVETSDQWIVERTGISERRIAAQDETVSMGYLAALNALEMAGIEA
FABH_RALSO      --------TGSYLPPKRVTNHELAQGIETSDEWIVTRSGIRARHYAEPDVTSDLXXXXXXXXXXXXXXXX
FABH_DESDG      -----------HAPERILTNTDMEAFVDTTDEWITTRTGIKQRHIAAEETTSDXXXXXXXXXXXXXXXXX
FABH5_STRCO     ----------------LVTNEELSRHLDTDDEWIRSRTGIGQRYWSDGASTGDLAVEAGQRALKAAGXXX
FABH1_BACHD     -----------YVGEHVVTNKDFEKRIDTSDEWIRTRTGIEERRFAPNVDTSDMAYEASVKALKAAGVSA
FABH_LARHH      --------TGSYLPDTILTNTELAKRVETTDEWIVSRTGIQERRLAAEQLTSDLXXXXXXXXXXXXXXXX
FABH_STRGA      -----------YRPTRVVPNEVILETIDSSDEWIRSRSGIQTRHWANDEETAAMSIEASGKAIADAGITA
FABH_MYCPA      --NIGLLSVGSYRPQRVVTNDELCQNIDSSDEWIYSRTGIKTRRFAADESTASMATEAGREAIAKAGLEA
FABH_MYCA1      --NIGLLSVGSYRPQRAVTNDELCQNIDSSDEWIYSRTGIKTRRFAADESTASMATEAGREAIAKAGLEA
FABH_STRLI      -----------YRPRREVSNKEVCTWIDSTEEWIETRTGIRSRRIAEPDETIQVMGVAASRALEHAGVDP
FABH1_BACSU     ----------RYIPEKVLTNHDLEKMVETSDEWXXXXXXXXXXXXAADDVSSHMAVAAAKNALEQAEVAA
FABH_PSEAE      -----------YLPEAVLSNDMLAAELDTSDAWISSRTGVRQRHIXXXXXXXXXXXXXXXXXXXXXXXE-
FABH_PSEAB      -----------YLPEAVLSNDMLAAELDTSDAWISSRTGVRQRHIXXXXXXXXXXXXXXXXXXXXXXXE-
FABH_PSEA8      -----------YLPEAVLSNDMLAAELDTSDAWISSRTGVRQRHIXXXXXXXXXXXXXXXXXXXXXXXE-
FABH_MYCTU      -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
FABH_MYCTA      -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
FABH_MYCBT      -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
FABH_MYCBP      -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
FABH_MYCBO      -----------YRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
FABH_SYMTH      ------------VPERVLTNHDLERMVDTSDEWXXXXXXXXXXXXAAHEASSDYXXXXXXXXXXXXGVTP
FABH_MYCMM      -----------YRPTRVVTNDEICENIDSSDEWIYSRTGIKRRFXXXXXXXXXXXXXXXXXXXXKAALTG
FABH_MYCUA      -----------YRPTRVVTNDEICENIDSSDEWIYSRTGIKRRFXXXXXXXXXXXXXXXXXXXXKAALTG
FABH_DESVM      -----------YTPVDVLTNFDLEKFVETTDEWITTRTGIRQRHLAEGQNXXXXXXXXXXXXXXXXGMEP
FABH_DESVV      -----------YAPERILTNADIESMVETTDEWITTRTGIRQRHVAPGQTTSXXXXXXXXXXXXXXXXXX
FABH_DESVH      -----------YAPERILTNADIESMVETTDEWITTRTGIRQRHVAPGQTTSXXXXXXXXXXXXXXXXXX
FABH2_STRAW     MNGSRIAAVGHYQPAKVLTNEDLASLVDTSDEWIRSRVGIRTRHFAPDEPVDEXXXXXXXXXXXXXXXXX
FABH_TROWT      -------------------NDELIGPINSSDEWIRRRTGIISRKRALSGTTVDMAYAASKEALNDAQMRP
FABH_TROW8      -------------------NDELIGPINSSDEWIRRRTGIISRKRALSGTTVDMAYAASKEALNDAQMRP
FABH4_STRCO     -----ITAVGHYQPARILTNEDLAGMVDTSDEWIRSRVGIRTRRIAPDEPVDEXXXXXXXXXXXXXXXXX
FABH_RUBXD      -------------------NRDLEAVLDTSDEWISTRTGIRERRVAEGQSCVTLAVEAARRALEHAGVPG
FABHL_CAMJE     --------------------------------------GLNTRYIDENTCVSDLGKHAANTLLQGLNIDK
PQSD_PSEAE      ------------LPKRQVSNHDLVGRINTSDEFIVERTGVRTRHVEPEQAVSALMVPAARQAIEAAGLLP
Y526_METVS      -----------------------------------------------DEDSATIAVQAARRALSRSGINP
Y1349_SULTO     ------------------------------DEGVVKSLGLMEKAVSHDEDSTTMAWEAARNALMRAKIDP
Y1546_METJA     -----------YIPKYRIKVEEIARVWNKDPESIKKGLLVYEKAVSLDEDTATIAVEAARNALKRAEIDP
Y117_METST      -----------------------------------------------DEDTITISVEAARRALQRAEIDP
Y1211_METMP     -----------------------------------------------DEDTATIAVQSARRALSRAGINP
KCS3_ARATH      -----------------------------------------------------------EKVLKRNKISP
Y379_METM5      -----------------------------------------------DEDTATISVQAARRALSRAGINP
Y458_METM7      -----------------------------------------------DEDTATISVQAARRALSRAGINP
Y1461_METM6     -----------------------------------------------DEDTATISVQAARRALSRAGINP
Y132_THEVO      -----------YIPRYRIKPDEIARVWGENPERIKNGIFILSKSVPADEDVATISVEAARNALKRKKINP
CHSA_IPOPU      ----------------------------------------------------------------------
KCS11_ARATH     -----------------------------------------------------------DELLAKTNVNP
Y1455_THEAC     -----------------------------------------------DEDVATISVEAARNALKRKKIDP
CHSY_PINST      ----------------------------------------------------------------------
CHS6_TRISU      ----------------------------------------------------------------------
CHS5_TRISU      ----------------------------------------------------------------------
Y1362_SULAC     -----------YIPRYRINVNEIANLWGLESQVVKNLGLSEKAVPDVDEDSTTMAWESSKNALRRANIDP
CHSY_PINSY      ----------------------------------------------------------------------
CHS7_PICMA      ----------------------------------------------------------------------
CHS5_PEA        ----------------------------------------------------------------------
CHS4_PEA        ----------------------------------------------------------------------
CHS3_PEA        ----------------------------------------------------------------------
CHS2_TRISU      ----------------------------------------------------------------------
CHSY_PUELO      ----------------------------------------------------------------------
CHS5_SOYBN      ----------------------------------------------------------------------
CHS3_SOYBN      ----------------------------------------------------------------------
CHS1_SOYBN      ----------------------------------------------------------------------
CHSY_VIGUN      ----------------------------------------------------------------------
CHSY_BETVE      ----------------------------------------------------------------------
CHS3_GERHY      ----------------------------------------------------------------------
CHS1_TRISU      ----------------------------------------------------------------------
CHS7_SOYBN      ----------------------------------------------------------------------
CHS1_MEDSA      ----------------------------------------------------------------------
Y1695_SULIL     ----------------------------------------------------------------------
Y1591_SULIY     ----------------------------------------------------------------------
Y1245_SULIN     ----------------------------------------------------------------------
CHSA_PEA        ----------------------------------------------------------------------
Y535_SULSO      ----------------------------------------------------------------------
Y1703_SULIA     ----------------------------------------------------------------------
Y1587_SULIM     ----------------------------------------------------------------------
Y1584_SULIK     ----------------------------------------------------------------------
CHS2_SOYBN      ----------------------------------------------------------------------
CHS1_CICAR      ----------------------------------------------------------------------
DPS1_PINST      -------------PPNVVDQSRVTNNEDNTDKRICERSAIKKRHMYLTEEILKLGKEAAEKAIEEWGQPK
CHS6_MEDSA      ----------------------------------------------------------------------
CHSY_ONOVI      ----------------------------------------------------------------------
CHS3_MEDSA      ----------------------------------------------------------------------
CHS2_MEDSA      ----------------------------------------------------------------------
CHS1_CASGL      ----------------------------------------------------------------------
Y1646_METS5     ----------------------------------------------------------------------
CHSY_PETCR      ----------------------------------------------------------------------
CHS9_MEDSA      ----------------------------------------------------------------------
CHS2_SOLLC      ----------------------------------------------------------------------
KCS20_ARATH     ---IETIYLDDKLDQESIDFQ--ARILERS--WLSNQTSIKKSLSSVKIETMTTIFTSVEDLLRKNKLSP
KCS17_ARATH     -----------------------------------------------------------DAVLEKTGVNP
CHS4_MEDSA      ----------------------------------------------------------------------
CHS3_TRISU      ----------------------------------------------------------------------
CHS2_SOLTU      ----------------------------------------------------------------------
CHS2_RUTGR      ----------------------------------------------------------------------
CHS2_DAUCA      ----------------------------------------------------------------------
CHS1_RUTGR      ----------------------------------------------------------------------
CHSY_PHAVU      ----------------------------------------------------------------------
CHSY_HYDMC      ----------------------------------------------------------------------
CHS2_CAMSI      ----------------------------------------------------------------------
CHS1_SINAL      ----------------------------------------------------------------------
CHSY_DIAMO      ----------------------------------------------------------------------
CHSD_PETHY      ----------------------------------------------------------------------
CHS6_PEA        ----------------------------------------------------------------------
CHSY_CALCH      ----------------------------------------------------------------------
CHSY_ANTMA      ----------------------------------------------------------------------
CHS7_MEDSA      ----------------------------------------------------------------------
CHS5_MEDSA      ----------------------------------------------------------------------
CHS1_CITSI      ----------------------------------------------------------------------
CHSY_ARATH      ----------------------------------------------------------------------
CHS3_SINAL      ----------------------------------------------------------------------
CHSY_RAPSA      ----------------------------------------------------------------------
CHSY_MATIN      ----------------------------------------------------------------------
CHSB_IPOPU      ----------------------------------------------------------------------
CHS2_PEA        ----------------------------------------------------------------------
THS3_VITVI      ----------------------------------------------------------------------
CHSY_CARAN      ----------------------------------------------------------------------
Y1379_METKA     ----------------------------------------------------------------------
DPS2_PINST      ----------------------------------------------------------------------
CHSY_HYPAN      ----------------------------------------------------------------------
CHS6_SOYBN      ----------------------------------------------------------------------
Y1873_AERPE     -----------YVPVYRIPTREIARVWGWPDHQWKALDVYEKAVGGVDEDSTTMGVEAARNAIARARVDP
THS2_VITVI      ----------------------------------------------------------------------
THIC_MOUSE      ----------------------------------------------------------------------
CHSY_DIACA      ----------------------------------------------------------------------
CHS1_SORBI      ----------------------------------------------------------------------
2PS_GERHY       ---------------------------------ICEKTAIKKRYLALTEDYLQLGKEAAVKAIDEWGLPK
THIC_RAT        ----------------------------------------------------------------------
DPSS_PINSY      ----------------------------------------------------------------------
CHSY_PERFR      ----------------------------------------------------------------------
CHSY_CHRAE      ----------------------------------------------------------------------
CHSY_ARAAL      ----------------------------------------------------------------------
THS4_VITVI      ----------------------------------------------------------------------
CHSY_ORYSJ      ----------------------------------------------------------------------
CHSY_ORYSI      ----------------------------------------------------------------------
CHS4_SORBI      ----------------------------------------------------------------------
Y792_METTH      -----------YIPSYRIKVEEIARVWGDDPQAISRGLVVEEKSVGPDEDTATISVEAARNALRRSQIDP
CHSY_MALDO      ----------------------------------------------------------------------
CHSY_CATRO      ----------------------------------------------------------------------
CHS8_BROFI      ----------------------------------------------------------------------
CHS5_SORBI      ----------------------------------------------------------------------
CHS4_BROFI      ----------------------------------------------------------------------
CHS3_SORBI      ----------------------------------------------------------------------
CHS3_BROFI      ----------------------------------------------------------------------
CHS2_SORBI      ----------------------------------------------------------------------
CHS1_PEA        ----------------------------------------------------------------------
ACS4_RUTGR      ----------------------------------------------------------------------
ACS3_RUTGR      ----------------------------------------------------------------------
Y1240_CALMQ     ----------------------------------------------------------------------
THS3_ARAHY      ----------------------------------------------------------------------
KCS7_ARATH      ----------------------------------------------------------------------
CHSY_EQUAR      ----------------------------------------------------------------------
CHSJ_PETHY      ----------------------------------------------------------------------
CHSB_SOLTU      ----------------------------------------------------------------------
CHSA_SOLTU      ----------------------------------------------------------------------
THS2_ARAHY      ----------------------------------------------------------------------
THS1_ARAHY      ----------------------------------------------------------------------
CHSB_PEA        ----------------------------------------------------------------------
CHS9_DAUCA      ----------------------------------------------------------------------
ACSA_BARHE      ----------------------------------------------------------------------
DXS_RHILW       ----------------------------------------------------------------------
DXS_RHIE6       ----------------------------------------------------------------------
CHSY_FRAAN      ----------------------------------------------------------------------
CHS6_SORBI      ----------------------------------------------------------------------
CHS1_HORVU      ----------------------------------------------------------------------
CHS1_DAUCA      ----------------------------------------------------------------------
ACS2_RUTGR      ----------------------------------------------------------------------
CHS7_SORBI      ----------------------------------------------------------------------
CHS2_MAIZE      ----------------------------------------------------------------------
CHS1_MAIZE      ----------------------------------------------------------------------
THIC_HUMAN      ----------------------------------------------------------------------
FADA_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
FABH_LACRJ      TELDLIIIATMSPDAYTPSTAAIVQGELGAKNAIAFDISAACTGFIYAMNTAELMLKSSNWQNAMVIGAE
FABH_LACRD      TELDLIIIATMSPDAYTPSTAAIVQGELGAKNAIAFDISAACTGFIYAMNTAELMLKSSNWQNAMVIGAE
FABH_LACBA      TDIDYIVVATMSPDYQTPAVSAQVQGNIGATKAVALDVNAACSGFVYGLQVVHRLLMGDSPKTALLIGGE
FABH_LACH4      KDIDLIAVATMSPDYLTPSVSAMVQGNXXXXXXXXXXXXXXCSGFVYGLHLVKQMLIANQQKNAILIGGE
FABH_STRGC      QDLDFIIVATITPDSLMPSTAARVQANIGAKKAFAYDLVAACSGFVFALSTAEKLISSGAYQKGLVIGSE
FABH_STRSV      QDLDFIIVATITPDSLMPSAAARVQANIGAKNAFAFDLTAACSGFIFALSTGEKFISSGRYQKGLVIGSE
FABH_STRA5      SQIDFIIVATMTPDSMMPSTAARVQAHIGASNAFAFDLSAACSGFVFALSTAEKLISSGSYQKGLVIGAE
FABH_STRA3      SQIDFIIVATMTPDSMMPSTAARVQAHIGASNAFAFDLSAACSGFVFALSTAEKLISSGSYQKGLVIGAE
FABH_STRA1      SQIDFIIVATMTPDSMMPSTAARVQAHIGASNAFAFDLSAACSGFVFALSTAEKLISSGSYQKGLVIGAE
FABH_LACSS      SQIKAIIVATMTPDYYTPSTAAIVQGRLGADQAFAFDISAACSGFTYALSAARGYVQTPD-DYVLVIGGE
FABH_STREM      TALDFIIVATISPDASMPSTAAKVQAAIGATNAFAFDMTAACSGFVFALAMADKLIASGAYQRGLVIGAE
FABH_STRS7      TALDFIIVATISPDASMPSTAAKVQAAIGATNAFAFDMTAACSGFVFALAMADKLIASGAYQRGLVIGAE
FABH_STRMU      XXIDFIIVATITPDAMMPSTAACVQAKIGAVNAFAFDLTAACSGFIFALSAAEKMIKSGQYQKGLVIGAE
FABH_OENOB      DQIDFVLVATMSPDXXXXXXXXXXXXXXXXXXXFAMDINVACSGFVYGLTLAHGLVNTLGSHYGVVIGAE
FABH_CLOB8      KDLELIIVATISPDMFIPSVACLVQSNLDASKAACFDISVACSGFVYGLETAKALMMSMNYKNALVVGAE
FABH_STRE4      TALDFIIVATISPDASMPSTAAKVQAAIGATNAFAFDMTAACSGFVFALAMADKLIASGAYQRGLVIGAE
FABH_STRZT      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRZP      KELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRZJ      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRR6      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRPS      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRPN      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRPJ      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRPI      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRP7      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRP4      KELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_STRP2      EELDFIILATITPDSMMPSTAARVQANIGANKAFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSE
FABH_CLONN      DELDLIIVATCTPDCFVPSTACIVQDAIGATKATCFDINAACTGFMYALSVASQFIKSGQSKNALVIGAE
FABH2_LACPL     TAIDLIIVATMSPDYLTPATAPQVQAAIGAEKAIAFDINVACAGFVYGMQLVHQYLQPG--QTALLIGSE
FABH_LACLA      ETIDFIIVATVTPDSLMPSTAARVQAQVGAVNAFAYDLTAACSGFVFALSTAEKLISSGAYQRGLVIGAE
FABH_CLOPS      EEIDLIIVATVTPDNFTPSTACIVQDKLGAKNAWAFDINAACTGFIYALKLGRSLIRSGEAKNALIIGAE
FABH_CLOTE      EELDLIIVATITPDYFTPSTACIIQRNIKAYNAFAFDISAACSGFTYGISIASQFIRNGVAKKVLVIGVE
FABH_LACLM      ELIDFIIVATVTPDSMMPSTAARVQAQVGATNAFAYDLTAACSGFVFALSTAEKLISSGAYQRGIVIGAE
FABH_CLOP1      EDIDLIILATVTPDNFTPSTACIVQDKLGAKNAWAFDINAACTGFIYALKLGRSLIRSGEAKNALIIGAE
FABH_CLOAB      EEIDLIIVATTSPDSYTPSVACIVQEKIGAKNAACFDLNAACTGFIFALNTASQFIKTGEYKTALVVGTE
FABH_STRSY      SEIDFIIVATITPDASMPSTAAMVQAAIGAKNAFAYDLVAACSGFVFALSTAEKLLASGVYKRGLVIGAE
FABH_STRS2      SEIDFIIVATITPDASMPSTAAMVQAAIGAKNAFAYDLVAACSGFVFALSTAEKLLASGVYKRGLVIGAE
FABH_LACLS      ELIDFIIVATVTPDSMMPSTAARVQAQVGATNAFAYDLTAACSGFVFALSTAEKLISSGAYQRGIVIGAE
FABH_STRU0      TEIDFIIVATITGDSIMPSVAAKVQGTIGATHAFAFDMTAACSGFVFALAMADKLIRSASYQKGLVIGAE
FABH_CALS8      DDIDLVIVATVTPEMFFPSTACLVQKELKLKNAFAFDISAACSGFIYAMAIATHFIQNGFCKNALVIGAE
FABH_CLOPE      EEIDLIIVATVTPDNFTPSTACIVQDKLGAKNAWAFDINAACTGFIYALKLGRSLIRSGEANNALIIGAE
FABH_ENTFA      SEIDFILVATVTPDFNMPSVACQVQGAIGATEAFAFDISAACSGFVYALSMAEKLVLSGRYQTGLVIGGE
FABH_STRP6      NAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRPZ      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRPM      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRPF      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRPC      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRPB      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRP8      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRP3      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_CLOBM      NDLDLIIVATLTPDNFMPSTACSVQKEIGAINALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_CLOBH      NDLDLIIVATLTPDNFMPSTACSVQKEIGAMNALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_CLOB1      NDLDLIIVATLTPDNFMPSTACSVQKEIGAMNALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_STRPG      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_STRP1      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_CLOBK      NDLDLIIVATLTPDNFMPSTACSVQKEIGAINALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_STRTD      EELDFVLVATISPDNSMPSVAARVQGTIGAVNAFAFDITAACSGFVFALATAEKLIKSGAYKKGLVIGAE
FABH_STRT1      EELDFVLVATISPDNSMPSVAARVQGTIGAVNAFAFDITAACSGFVFALATAEKLIKSGAYKKGLVIGAE
FABH_CLOBJ      NDLDLIIVATLTPDNFMPSTACSVQKEIGAINALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_STRPD      DAIDFIIVATISPDATMPSTXXXXXXXXXXXXXXXFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAE
FABH_CLOBL      NDLDLIIVATLTPDNFMPSTACSVQKEIGAINALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_STRT2      EELDFVLVATISPDNSMPSVAARVQGTIGAVNAFAFDITAACSGFVFALATAEKLIKSGAYKKGLVIGAE
FABH_CLOB6      NDLDLIIVATLTPDNFMPSTACSVQKEIGAINALCFDISAACSGFIYGLEIACSMLKNSFRNKALIIGAE
FABH_NATTJ      ADLDMIIVATVTPDMAFPSTACLVQDKLGADQACAFDLEAACTGFLYGLRIASQFIATDTHKYILVIGSE
FABH_LACDB      AGVDLIIVATMSPDXXXXXXXXXXXXXXXXXXXXCFDLSAACSGFVYALDVAEKMLRRPG-GMALVIGAE
FABH_LACDA      AGVDLIIVATMSPDXXXXXXXXXXXXXXXXXXXXCFDLSAACSGFVYALDVAEKMLRRPG-GMALVIGAE
FABH_CLOD6      EDIELIILATITPDMSLPSTACIVQDAIGAVNATAFDISAACSGFVYGVTIAKQFVETGCYKNVLVIGAE
FABH_PROM2      KTIDLIVLATSTPHDLF-GSAPSIQSKLGASNAVAFDLTAACSGFLFALITTSQFLKAGNFKRALVVGAD
FABH_CLOK5      EDIDLIVVATITPDNFIPSTACIVQKNIKAVNATCFDISAACSGLIYGLDIGTQFIRSGRFKVVLAIGAE
FABH_CLOK1      EDIDLIVVATITPDNFIPSTACIVQKNIKAVNATCFDISAACSGLIYGLDIGTQFIRSGRFKVVLAIGAE
FABH_PROM9      KTIDLIVLATSTPHDLF-GSAPSIQAKLGAHNAVAFDLTAACSGFLFALITASQFLKGGSFKRAIVIGAD
FABH_ACHLI      EKIDLIIVASITSPVKTPSIANLIQAKLGLNNIVAFDINAACSGFVYAVEIAASMISSGNYKSALVIGSE
FABH_GRATL      LEIDLIILATSSPNDLF-GSASQVQAKIGAARAVAFDLTAACSGFVLAIVTATQFIQNGSYKNILIIGAD
FABH_SULDN      NKIDMIVCATISPDYFCPSTATIISTKLGLENVTAFDISAACTGFVYILSIAKAFIESGMKKNVLIIGAE
FABH_PROM0      KTVDLIVLATSTPHDLF-GSAPSIQAKLGAANAVAFDLTAACSGFLFALITTSQFLKGGSFKRAIVIGAD
FABH_AQUAE      EELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAE
FABH_EHRCJ      NEIDLIIVATTTPDRTFPSCATIVQSKLGCKNAFAFDIQAVCSGFVYALSIADNFIKSGQVRTVLVIGAE
FABH_DESHY      EELDLVIVATITPDFVFPATACLVAERLGAKKAAGFDLQAACTGFLYGVATAAQFIATGIYKNALVIGGE
FABH_DESHD      EELDLVIVATITPDFVFPATACLVAERLGAKKAAGFDLQAACTGFLYGVATAAQFIATGIYKNALVIGGE
FABH_DICNV      DAIDLIIVATSTPEHIFPSTATVVQSRLSCQRAAAFDVQAACTGFMYALNTADCFIKSGQYQNVLVIGAE
FABH_PROMP      ETIDLIILATSTPNDLF-GSAPEIQSKLGAINAVAFDLTAACSGFLFAAITATQFLKAGSYKRAVVIGSD
FABH_NITEC      SDIDLVIVATTTPDMIFPSTACILQNKLGISGSPAFDVQAVCSGFIYALATADMFVSSGKSRNALIVGSE
FABH_THEEB      TAVDLIILATSTPDDLF-GTACLVQTRIGAVNAVAFDLTAACSGFLFALVTAAQYLRTGAYRSALVVGGD
FABH1_BACAN     EDIDLILVATVTPDRAFPAVACVIQEAIGAKHAAAMDLSAACAGFMYGMITAQQFIQTGTYKNVLVVGSD
FABH_CHLTE      DEIDLIIVATMSPDMLFPSTACLVQGNIQAKNAWGFDLSAACSGFVYGLYTGAQFIESGNCKKVMVIGAD
FABH_PROM5      ETIDLIILATSTPHDLF-GSAPEIQSKLGANNAVAFDLTAACSGFLFAVITATQFLKAGSYRRAIVIGSD
FABH_PERMH      KDIDAVIVATSTPDMTFPSTACFLADKLGSSKPMAFDISAACSGFIYGLTLANSFIKSGQFENILVVGAE
FABH_CAMFF      NDIDAVICATITPDYFCPSTACKVASNLGLFDVTAFDISAACTGFIYLLEIAKSLVESGAKKNVLIIGAE
FABH_XANCP      DEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAE
FABH_CAMJJ      EDIDAILVATLSPDYFTPSTACKIASNLGLVNISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAE
FABH_CAMJE      EDIDAILVATLSPDYFTPSTACKIASNLGLVNISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAE
FABH_POLSJ      SDIDLIIVATSTPDMVFPSAACIVQNKLGIAGCPAFDVQAVCSGFVYALTVADALIKTGSATKALVIGAE
FABH_SYNY3      EDLDLIILATSTPDDLF-GTAAQIQGGLGATRAFAFDITAACSGFVVGLNVAAQFLRTGVYQRVLIVGGD
FABH_BRAJA      QSIDLIVLATSTPDNTFPATAVAVQHGLGINHGAAFDLQAVCSGFVFALATADNFLRTGAFKRALVIGAE
FABH_CAMJ8      EDIDAILVATLSPDYFTPSTACKIASNLGLVNISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAE
FABH_PROMT      QTIDLIILATSTPEDLF-GSAPKIQSNLGASNAVAFDLTAACSGFLFALVTASQYLASGSMKRALVIGAD
FABH_CAMJR      EDIDAILVATLSPDYFTPSTACKIASNLGLVNISAFDISAACSGFIYLLEQAKALVESGLKKNVLIVGAE
FABH_MICAN      RDIDLILLATSTPDDLF-GSAAQVQSQIGANRAIAFDLTAACSGFLVGLVTATQFIRTGTYRNVLVIGAD
FABH_SPIOL      DDIDLILMCTSTPEDLFGSAPQVQRALGCSRTPLSYDITAACSGFMLGLVSAACHVRGGGFKNVLVIGAD
FABH_METCA      HDLDLIILATSSPDRVFPSTACLLQQRLGVRSCAAFDVQAACSGFIFALSIADQYISAGNANRVLVVGTE
FABH_TRIEI      KDIDLIILATSTPDDLF-GTACKIQWELGAQKAVAFDITVACSGFLFALVTGAQFIRNGVYQNVLLIGAD
FABH_CAMJD      EDIDAILVATLSPDYFTPSTACKIASNLGLVNISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAE
FABH_XANC8      DEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAE
FABH_XYLFA      ADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFVYALSVAEKFVSSGCSKTVLVVGAD
FABH_THETN      EDLDMIIVATVTPDMNFPSTACIVQANLGALNAAAFDISVGCSGFIYGLAIAQQFVETGMYRNVLVIGAE
FABH_XYLFT      ADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFVYALSVAEKFVSSGCSKTVLVVGAD
FABH_ARCB4      EEIDLVICATVTPDFLCPSTACLIAAKLGLSNVMAFDVSAACTGFVYALNVAKAFIESGMKKNVLIVGAE
FABH_XANC5      EEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAE
FABH_PASMU      NEIDLIVVATTSATHAFPSTACQIQKMLGIKDAIAFDVAAACSGFVYALTVADQFIRTGKVKKALVIGAD
FABH1_LACPL     SAIDLILVTTITPDALTPATACLVQANIGADNAFAFDLSAACAGFTFGLATADKFIRSGQYQNVMVISAE
FABH_XANAC      DEIDLIVIGTTTPDLIFPSTACLLQARLGNIGCGAMDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAE
FABH_ARATH      EDIDLVLMCTSTPDDLFGAAPQIQKALGCTKNPLAYDITAACSGFVLGLVSAACHIRGGGFKNVLVIGAD
FABH_CAMC1      SQIDAVICATISPDHLCPSTACKIAANLGLNFGIAFDISAACTGFIYLLELANSLIVSGAKKNVLIIGAE
FABH_RICRS      NDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLISSDKYKTILLIGAE
FABH_RICRO      NDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLISSDKYKTILLIGAE
FABH_RICCN      NDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLISSDKYKTILLIGAE
FABH1_BACCR     EDIDLILVATVTPDRAFPAVACVIQEAIGAKHAAAMDLSAACAGFMYGMITAQQFIQTGTYKNVLVVGSD
FABH_STAAW      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAT      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAS      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAE      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAC      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAA8      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAA3      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAR      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAN      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAM      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAAB      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAA9      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAA2      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_STAA1      EDIDMIIVATATGDMPFPTVANMLQERLGTGKVASMDQLAACSGFMYSMITAKQYVQSGDYHNILVVGAD
FABH_SULNB      EDIDLVLCATVTPDYFNPSTACIISDKLGIRNVQAFDISAACSGFVYLLTVAKAFIESGMKKNVLIIGAE
FABH_PORPU      EDIDLIILATSTPDDLF-GSASQLQAEIGATSSTAFDITAACSGFIIALVTASQFIQAGSYNKVLVVGAD
FABH_VESOH      KDLDLIILATTTADKIFPATATILQTAIGA-SCPAFDLQSVCAGFIFALTTAEQYIKASAANKVLVVGSE
FABH_PROMM      ESVDLIILATSTPDDLF-GSAPQLQAILGARQAVAFDLTAACSGFLFALITAAQFLRTGAMRRALVIGAD
FABH_RICFE      NDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLIASGKYKTVLLIGAE
FABH_NEIMA      NEIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_FUSNN      EDVDMIILATTTADYIAQGAACIVQNKLGLKKIPCFDLNAACTGFIYGLEVAYSLVKSGLYKNILVIGAE
FABH_POLNA      ADIDLIIVATSTPDMVFPSVACILQHKLGIAGCPAFDLQAVCSGFVYALTVADAMIKSGAASKALVIGAE
FABH_PHOLL      EQIDLIIVATASSTHAFPSSACQIQHMLGTQNSAAFDISAACSGFVYALSIADKFIKTGVAKHALVIGSD
FABH2_CUPWR     NDVDMVLMCTSTPEDLFGSAPQIQKALGCKKNPLAYDITAACSGFVLGLVSAACHIRGGGFNNILVIGAD
FABH_WOLPM      DEIDLIIVATTTPDKTFPSCATIVQSKLKCKNAFAFDVQAACSGFIYAVTVADSLIKSNNIKYALVIGAE
FABH_RICM5      NDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLISSGKYKTILLIGAE
FABH_NITMU      REIELVIVATTTPDMIFPSTACILQDKLGIGDCAAFDVQAVCSGFIYALATADMFIRAGKCQTALVVGAE
FABH_DIAST      QDLDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFVYALTVADAMIRSGGARRALVVGSE
FABH_BRASO      QSIDLIVLGTSTPDNTFPATAVAVQNGLGIHHGAAFDLQAVCSGFVYALATADNFLRSGSFKRALVIGAE
FABH_ACISJ      QDLDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFVYALTVADAMIRSGGARRALVVGSE
FABH_ACAM1      TDLDLILLATSTPDDLF-GSACQIQAAIGAKHAVAFDLTAACSGFVFGMITAAQFIRTGVYRNVLLVGAD
FABH2_STAES     TDVDMIINTTLTPDYKTPSVASYVQAQLGLKNAGAIDINAACAGFTYGLNLANGLITSGQNKKILVIGSE
FABH_NITEU      KDIDLIIVATTTPDMIFPSTACILQNKLGMSNGPAFDVQAVCSGFIYALATADMFVSSGKARNALVVGAE
FABH_MARAV      TDIDLIVFATTTPDKVFPSCACILQARLGIQGCPAFDIQAVCSGFVYALATAEKFIRTGSSKKALVIGAE
FABH_CAMC5      PQIDTIICATMSPDHLCPSTACKIAANLGLDYGIAFDISAACTGFIYLLQLANSLIKSGAKKNVLIVGAE
FABH_BURS3      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYAMATADSFIRSGQHRTALVIGAE
FABH_DELAS      QDIDLIIVATSTPDMVFPSTACILQNKLGANGCAAFDVQAVCSGFVYALTVADAMIQSGAASRALVVGSE
FABH_BURCH      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYAMATADSFIRSGQHRTALIVGAE
FABH_BURCC      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYAMATADSFIRSGQHRTALIVGAE
FABH_BURCA      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYAMATADSFIRSGQHRTALIVGAE
FABH_NEIG2      NDIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_NEIG1      NDIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_CHLPD      EEIEVIIVATMTPDMLFPATACFVQGIIGATNAWAFDINAACSGFLFALSTASRLIESGAHKKVMVIGGD
FABH1_CUPWR     DDVDMVLMCTSTPEDLFGSAPQISKALGCKKNPLSYDITAACSGFVLGLVSAACHIRGGGFNNVLVIGAD
FABH_WOLPP      DEIGLIIVATTTPDKTLPSCATIVQSKLKCKNAFSFDVQAACSGFIYAVTVADSLIKSHNIKYALVIGAE
FABH_BRASB      QSIDLIVLGTSTPDNTFPATAVAVQDGLGIHHGAAFDLQAVCSGFVYALATADNFLRSGSFKRALVIGAE
FABH_ACIAC      ADIDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFIYALTVADSMIRSGAARRALVVGSE
FABH_PELLD      EELELIIVATMTPDMMFPSTACLVQDIIGAKNAWAFDINAACSGFLYALNTASQFIKAGTHKNVMVIGGD
FABH_BRUO2      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUSI      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUME      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUMB      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUAB      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUA2      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUA1      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_EHRRG      QDVDLIVVATTTPDRTFPSCATIVQSKLECKNAFAFDIQAVCSGFIYAMAIADNFIKSGQVNVSLVIGAE
FABH_CHLCH      TDIELIIVATITPDMPFPATACLVQDLIGAKNAWAFDLNAACSGFLYALNTAIRFVESGAHKKVMVIGAD
FABH_CAMHC      EEIDAIICATITPDFFCPSTACITAEKLGLNKGIAFDISAACSGFIYLLEIGSALIKSGAKKNVLIIGTE
FABH_WOLTR      DEIGLIIVATTTPDKTLPSCATIAQNKLKCKNAFSFDVQAACSGFIYAVTIADSLIKNDRIKYALVIGAE
FABH_SYNR3      SSVDLILLATSSPDDLF-GSAPKVQALIGAGSAVAFDLTAACSGFLFSLVTAAQYLRTGAMTRALVIGAD
FABH_EHRCR      DDIGLIIVATTTPDRTFPSCATIVQDKLECKNAFAFDIQAVCSGFVYAISIADNFIKSGQVNTALVIGAE
FABH_BRUSU      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_BRUC2      SDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLVIGAE
FABH_NEOSM      KEVDAIIVATCTANKRLPAVANMLQARLGIGRHILFDVNAACTGFLYALSIVDAMIVSGKVSTVLLVGAE
FABH_ACTSZ      NEIELIIVGTTSNSHAYPSAACQIQGMLNINDAISFDLAAACTGFVYALSVADQFIRAGTVKKALVIGSD
FABH_ACTP2      NEIDLIVVGTTTNSHAYPSAACQIQGMLDIQDAIAFDVAAACTGFVYALSVADQFIRSGKIKKALVIGSD
FABH_OCEIH      XDIDLILVATVTPNTSFPSVACIIQDQLGAKNAAAMDVSAACAGFMYGLITAKQFIDTGAYKHVLVVGAE
FABH_NEIMF      GEIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_NEIM0      GEIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_EHRRW      QDVDLIVVATTTPDRTFPSCATIVQSKLECKNAFAFDIQAVCSGFIYAMAIADNFIKSGQVNVSLVIGAE
FABH_BURP0      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_NEIMB      GEIDLIIVATATPDMQFPSTATIVQQKLGITNGCAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAE
FABH_RICCK      NDIDLIIICTTTPDHSFPSVATKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLIASSKYKTVLLIGAE
FABH_AZOSE      DDIDLIIVATSTPDCIFPSTAALLQSKLGIRNAAAFDVQAVCSGFVYGLTIAEKFIRSGSHKRALVVGAE
FABH_RICAH      NDVDLIITCTTTSDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFVYGLQVADSLIASGKYKTILLIGAE
FABH_HAES1      NDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAISFDLAAACTGFIYALSVADQFIKTGKVKKALVIGAD
FABH_BURTA      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALAMADSFIRTGQHRTALIVGAE
FABH_BURPS      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_BURP6      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_BURP1      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH2_VIBPA     SEIDLIIVATCSPDSLIPNIASKVQQNLGIRSAAAFDLNAACTGFVYGLETGTRLIQSGNYRHAIIIGAE
FABH_BURMS      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_BURMA      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_BURM9      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH_BURM7      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGAAFDVQAVCSGFAYALATADSFIRTGQHRTALVIGAE
FABH2_VIBVY     QDIDLIIVATCSPDSLIPNIASMVQKNLEIEAAAAFDLNAACTGFVYGLETGTRLIQSGAYRHALIIGAE
FABH_VARPS      EDIDLIIVATSTPDMVFPSSAAILQNKLGVAGCPAFDVQAVCSGFVYALTVADAMIRTGTARCALVVGAE
FABH_VIBF1      NDIDLIILATSTPTYSFPSAACEVQGLLGIQGCPAFDLSAACSGFVYALSVADQHIKTGMAKNVLVIGSD
FABH_HAES2      NDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAISFDLAAACTGFIYALSVADQFIKTGKVKKALVIGAD
FABH_BURP8      QAIDLIIVATSTPDFVFPSTACLLQNKLGINNGAAFDVQAVCSGFAYAVATADSFIRSGQHRTALVVGAE
FABH_GRABC      DDVDAILVATSTPDQVFPAVAVRVQALLGAKRGFGFDLSAACSGFVYGLSMGDALIRSGQAKGVLVIGAE
FABH_HELPG      KDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMCENVLIVGAE
FABH_BARBK      KDIDCIILATSTPNRTFPSSAVEIQHALGMSHGFSFDVQAVCSGFIFALTIGDVYLRSGEAKRVLVIGSE
FABH2_VIBVU     QDIDLIIVATCSPDSLIPNIASMVQKNLEIEAAAAFDLNAACTGFVYGLETGTRLIQSGAYRHALIIGAE
FABH_SPHAL      ADIGLIIVATATPDNTFPASATKVQALLGAPDCIAFDVAAVCSGFLYAVSVADAMLRTGAARHALVIGSE
FABH_RHOCS      XXVDLIVLATATPDQTFPATATKVQARLGITRGAAFDVQAVCSGFVYALAIADNFIKAGQARTALVIGAE
FABH_HELAH      QDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAE
FABH_ACIBL      AEVECIVVGTVTPDMMYPSTACLVQHKLGIPNAWGFDVSAGCSGFLFSLTTGAKFIESGQYKKVLVIGSD
FABH_HELPH      KDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMCENVLIVGAE
FABH_BART1      KDIDCIILATSTPNRTFPASAVEIQYALGMNHGFAFDIQAVCSGFIFALTTGDSYLRCGAAKRILVIGSD
FABH_MESSB      XXXXXIVVATSTPNNTFPATAVEIQERLGIRQGFAFDMQAVCSGFVYAVTTADLYIRGGMAKRALVIGAE
FABH_THISH      XDIDLIIVATTTPDRVFPSTACLLQKRLEIHGCAAFDVQAVCTGFVYALGVADRFIRTGGAKCALVVGAE
FABH_SPHWW      SDIGLIILATATPDQTFPASATMVQAALGIGDCVAFDVQAVCSGFLYALSVADSMIRGGSATHALVIGAE
FABH_ANAVT      SDIDLILLATSTPDDLF-GTATKIQAELGATKAVAFDLTAACSGFVFGLVTAAQFIRTGVYQNVLLIGAD
FABH_ANASP      SDIDLILLATSTPDDLF-GTATKIQAELGANKAVAFDLTAACSGFVFGLVTAAQFIRTGVYQNVLLIGAD
FABH_SOLUE      CEIDAIILCTVTPDHLFPSTACLVQNAIGAKGAWGFDLIAACSGFLYGLTTGAHFVMAGTHKKVLVIGSD
FABH_PSEA6      KSLDMIVCATTSGRYSLPSTACEIQKALDVDGIPAFDVAAACAGYCYALSVADQYIKSGMAKRILVVGTD
FABH_HELPJ      QDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAE
FABH_HELP2      KDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMCENVLIVGAE
FABH_BARHE      KDIDCIILATSTPNHTFPASAVEIQHALGMSHGFAFDIQAVCSGFIFALTTGDAYLRCGTAKRILVIGSD
FABH_ALHEH      SSIDLVIVGTCTPDRVFPSTACLLQERLGMRHSLAFDLSAACSGFVYGLGVADQFFRTGAVRRALVIGAE
FABH_HELPS      KDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMCENVLIVGAE
FABH_RICBR      NEIDLIITCTTTPDNSFPSVATKLQGYLGLNNVPSFDLQAVCAGFVYGVQVANSLISSGKYKTILLIGAE
FABH_HYPNA      SEIDLIVLATTTPDQTFPATATAVQAKLGTGPGAAFDVQAVCSGFLFALATADSLMKQGLFHKALVIGAE
FABH1_VIBPA     NDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALSVADQHIKSGMCKNVLVIGAD
FABH_HELPY      KDIDLVVVATLSPDFLAPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAE
FABH_OCHA4      TDIDLVLLATSTPNHTFPASAVEIQRELGITKGFAFDMQAVCSGFIYAITTADLYIRGGMAKRVLVIGAE
FABH_SILST      DDVDAIVLATSTADLTFPSAATMVQSQLGMTKGFAFDVQAVCAGFVYALSNANALIASGQADRVLVIGAE
FABH2_VIBCH     EEIDLIIVATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAE
FABH_XANOM      DEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAE
FABH_VEREI      TDIDLIIVATSTPDMVFPAAACILQNKLGANGCPAFDLQAVCSGFVYALSVADSMVRAGAANCALVVGAE
FABH_SYNPW      QDLDLILLATSTPDDLF-GSAPRVQAELGATNAVAFDLTAACSGFLFALVTAAQYLRTGAMRRALVIGAD
FABH_PORUM      EDIDLIILATSTPDDLF-GSASQLQAEIGATSSTAFDITAACSGFIIALVTASQFIQAGSYNKVLVVGAD
FABH_DEIGD      RDVDVVICATATPDALFPSTAALIAGQVGLSGAGAFDLSTACSGFVYALSMAQGLILGGTARRVLVVGAE
FABH_BURVG      QSIDLIIVATSTPDFVFPSTACLLQNKLGIKSGAAFDVQAVCSGFAYAMAMADSFIRGGQHRTALVVGAE
FABH_RICB8      NEIDLIITCTTTPDNSFPSVATKLQSYLGLNNVPSFDLQAVCAGFVYGVQVANSLISSGKYKTILLIGAE
FABH_ERWCT      SEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYVKSGAVKYALVIGSD
FABH_STAEQ      VDIDMIIVATATGDMPFPSVANILQERLGTGKVATMDQLAACSGFMYSMITAKQYIQSGDYKHILVVGAD
FABH_PROVI      EELDLIIVATMTPDMLFPSTACLVQDIIGAGNAWAFDLNAACSGFLFALNTGSRFIESGAHKKVMVIGAD
FABH_BAUCH      NKVGMIIVATTSSSHAFPSSACQIQRDLGIMDCVAFDLAAACAGFPYALSIVDQYIKNGVIEYALVIGSD
FABH1_STAES     VDIDMIIVATATGDMPFPSVANILQERLGTGKVATMDQLAACSGFMYSMITAKQYIQSGDYKHILVVGAD
FABH_SALTY      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKHALVVGSD
FABH_COXBU      AVIDMIIVGTATAEYYFPSTACLVQKHLNLEDIPAFDINAACAGFVYALSIADQYIRNEGAKHILVIGVD
FABH_HAEIN      QDIELIIVATTSHSHAYPSAACQVQGLLNIDDAISFDLAAACTGFVYALSVADQFIRAGKVKKALVIGSD
FABH_HAEIG      QDIELIIVATTSHSHAYPSAACQVQGLLNIDDAISFDLAAACTGFVYALSVADQFIRAGKVKKALVIGSD
FABH_HAEI8      QDIELIIVATTSHSHAYPSAACQVQGLLNIDDAISFDLAAACTGFVYALSVADQFIRAGKVKKALVIGSD
FABH_BARQU      KDIDCIILATSTPNHTFPASAVEIQHALGMSHGFAFDIQAVCSGFIFALTTGDAYLRSGVAKRILVIGSE
FABH_MAGSA      SAVDLVIVATATPDNTFPATATKVQSRIGMRHGFAFDVQAVCSGFVYALSVADNFIKSGQVQTALVIGAE
FABH_HELHP      KDIDAVIVATLSPDYLTPSTACITSFKLGIENKAAFDISAACSGFVYLLSLAKSFIESGTYKQILIIGAE
FABH_SALPB      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKHALVVGSD
FABH_SALCH      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKHALVVGSD
FABH1_VIBVY     NDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALSIADQHIKTGMCKNVLVIGSD
FABH1_VIBVU     NDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALSIADQHIKTGMCKNVLVIGSD
FABH_SODGM      QKVGMIIVATTSSSHAFPSSACQIQRELGINDCIAFDLAAACAGFSYALSVADNYIKNGAVEYALVVGSD
FABH_SALTI      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGVVKHALVVGSD
FABH_SALAR      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKHALVVGSD
FABH_GEOKA      KDIDLILVATVTPDRPFPSVACMLQERLGAVNAAALDISAACAGFMYGMVTAAQFIDTGAYKYILVVGAD
FABH_COXBN      AVIDMIIVGTATAEYYFPSTACLVQKHLNLEDIPAFDINGACAGFVYALSIADQYIRNGGAKHILVIGVD
FABH1_DEIRA     KDVDLVIYATCTPDAMFPSTAALVAGQVGLTGVGAYDLSTACSGFVYALSMARGMILGGSAKNVLVLGGE
FABH_PSEHT      KDIDLVILATCTPSTMVANTASLVQKNIGAVGAAAMDTNAACSGFLYALQAATAQIQAGMIKKAVVIAAE
FABH_COXBR      AVIDMIIVGTATAEYYFPSTACLVQKHLNLEDIPAFDINAACAGFVYALSIADQYIRNEGAKHILVIGVD
FABH_CITK8      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVIGSD
FABH2_BACHD     DDVDMIIVCTFTPDFKTPSAASLIQAKLGIQNTGAIDLNAACAGFTYGLHMANGLISSGLHRKILVIGAE
FABH_SHISS      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_SHIFL      DQIGLIVVATTSATHAFPSAACQIQSMLDIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_SHIF8      DQIGLIVVATTSATHAFPSAACQIQSMLDIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_SHIBS      DQIGLIVVATTSATHAFPSAACQIQSMLDIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOUT      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOLI      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOLC      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOL6      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOL5      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOK1      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECOHS      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECO57      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_ECO24      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_COXB2      AVIDMIIVGTATAEYYFPSTACLVQKHLNLEDIPAFDINAACAGFVYALSIADQYIRNEGAKHILVIGVD
FABH_SHIDS      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
FABH_SALPA      DQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKHALVVGSD
FABH_COXB1      AVIDMIIVGTATAEYYFPSTACLVQKHLNLEDIPAFDINAACAGFVYALSIADQYIRNGGAKHILVIGVD
FABH_CHRVO      GEIDLIIVATTTPDMVFPSTACILQEKLGLPGVQAFDVQAVCAGFVYALTTANAYIKSGLAKKALVVGAE
FABH_STAHJ      ADIDMIIVATATGDMPFPSVANILQEKLDTRKVPTMDQLAACSGFMYSMITAKQYVQSGDYKNILVVGAD
FABH_BLOFL      NEIGIIIVATTSSSHAFPSSACQIQRDLKISDTIAFDLSAACSGFVYALDVANQYIKNGVVKYALIVGSD
FABH2_DEIRA     DGVNLVICATSSPDAMFPSTAALIAGGTGLRGAAAFDVSVACSGFLYALSVGYGMIRAGLAKKALIVGSE
FABH2_BACTN     DDIDLVIVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACCGFLYLMETAANFIRSGRYKKIIIVGAD
FABH_POLNS      ADLDLIILATSTPDHLGPSTACVVQDKLGAHTSAAFDVQAVCAGFTYALAVADAFIRSGSYKKVLVIGAE
FABH_ENTS8      GQIGLIIVATTSATHAFPSAACQVQGMLGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVNNALVIGSD
FABH_BACV8      DDIDAVIVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACCGFLYLMETAASLIASGRHKKIIIVGAD
FABH_ACICJ      XXXXXXIVATSTPDQGFPATAVSIQAAIGMTRGFAFDLSAACSGFVYGVSVADAMIRAGQCRSALVIGTE
FABH_ERYLH      ETIDLIVLATATPDNTFPATATKVQEALGCNGCIAFDVQAVCSGFLYALATADSLLKTGMAKRALVIGAE
FABH_SILPO      EQIDAIVLATSTADLTFPSAATMVQARLGMTNGYAFDVQAVCAGFVYALSNANALIVSGQAKRVLVIGAE
FABH1_VIBCH     HDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALSIADQHVKSGMCKHVLVIGAD
FABH_ANAMM      TEVDLIIVATATPDKTMPSCATMVQGSLGCKNAAAFDINAACSGFLYALSIVDSMIKAGQANIALIIGSE
FABH_RICTY      XXXXXXXXXXXXXXNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLTNSLIVSGKYKTILLIGAE
FABH_BORA1      ADLDLIIVATSTPDFVFPSTACLVQANLGAKGGAAFDVQAVCSGFAYALTTADSFVRAGRVRCALVIGAE
FABH_BLOPB      DKVGIIIVATTSSSHAFPSSACQIQRDLHIRDTIAFDLSAACSGFVYALGVADQYVKNGSVDYALVVGSD
FABH_HAEDU      NEIELIVVATTTHSHAYPSAACQIQGMLAIEDAIAFDVAAACTGFIYALSVADQFIRAGKVKTAFVVGAD
FABH_AZOSB      NDIDLIIVATSTPDYIFPSTATLLQSKLGGNNGAAFDVQAVCSGFVYALSIAEKFIRSGSHKRALVVGAE
FABH_KLEP7      EQIGLIIVATTSGTHAFPSSACQIQSMLGVKGCPAFDVAAACAGFTYALSVADQYVKNGAVDYALVVGAD
FABH_JANSC      DDIDAVIVATSTPDLTFPSVATMVQAGLGMTGGFAFDVQAVCAGFVYALANANALIVSGQANRVLVIGAE
FABH_CHLPN      DQIDCIIFSTAAPDYIFPSSGALAQAHLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAAD
FABH_BORBR      DEIDMIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSGFVYAMTTADSFIRAGRARCALVIGAE
FABH_AGRVS      XDIDMIICATSTPDNTFPSAAVNIQNRLGMTHGFAFDVQAVCTGFVYAMTTADAYIRGGLAKRVLVIGAE
FABH_ROSS1      XQIDTVILATCTPDRPFPATACTXXXXXXXXXXXXFDLVAACSGFVYGLNVATSMIRSGAARNVLFVACD
FABH_PSYIN      XDLDLIIVGTTSNHNAFPSAACEIQNLLGIYDIPAFDISAACAGFTYALSAADNFIKAGSAKKVLVIGAD
FABH_NOVAD      SRIDLIVLATATPDQTFPATATIVQHNLGCNGGIAFDVAAVCSGFLYALATADSMIRSGMARCALVIGAE
FABH_BORPA      DEIDMIIVATSTPDYVFPSTACLVQANLGAKGGATFDVQAVCSGFVYAMTTADSFIRAGRARCALVIGAE
FABH_STAS1      SEIDMIIVATSTGDFPFPTVANILQERLGIGKVASMDQLAACSGFMYSMINAKQFVQSGDYKNILVVGVD
FABH_RHOS4      DDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALANADALIRSGQAQRVLVIGAE
FABH_RHOS1      DDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALANADALIRSGQAQRVLVIGAE
FABH_ENT38      EEIGLIVVATTSSTHAFPSAACQIQGMMGIKGCPAFDVAAACAGFTYALSIADQYVKSGAVKYALVIGAD
FABH_SYNWW      KELDLIIVGTSSPDMLFPSTACIVQDHLGARNAAAFDVEAGCTGFIYALGIAEKFLLSPEYKKILVIGAD
FABH_ROSCS      XQIDTVILATCTPDRPFPATACTXXXXXXXXXXXXFDIVAACSGFVYGLQVATSMVRSGAARNVLFVACD
FABH_BORPE      DEIDMIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSGFVYAMTTADNFIRAGRARCALVIGAE
FABH_DEIDV      TDVDAIICATVSPDALMPSTAALIGMQVGLVGAAAFDLSTACSGFVYGLSVASGLIHAGTARRVLVVGAE
FABH_YERPS      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_YERPP      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_YERPN      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_YERPE      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_YERPA      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_YERP3      DDIGLIIVATTSSSHAFPSSACQVQRMLGIKDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH1_BACTN     DDIDLVIVATTTSDYRFPSTASILCERLGLKNAFAFDMQAVCSGFLYAMETGANFIRSGKYKKIIIVGAD
FABH_BACP2      EDIDMILVATVTPDQAFPTVACMIQEQLGAHKACAMDISAACAGFMYGLVTGKQFIESGTFKHVLVVGVE
FABH_SERP5      EDIGLIVVATTTSTHAFPSSACQVQQMLGIKXXXXXXXXXXXXGFTYALSVADQYVKNGAVKHALVIGAD
FABH_SINMW      DDIDLIIVATSTPDNTFPATAVNIQNRLGMRHGAAFDMQAVCSGFVYAVTTGDAYIRGGLATRVLVIGAE
FABH_RHOFD      XDIDLIIVATSTPDMVFPSTACILQDKLGANGCPAFDVQAVCSGFIYALSIADAMIKTGAAKKALVIGAE
FABH_RALPJ      SELDLILVATSTPDFVFPSTACLVQQKLGITNGAAFDVQAVCSGFVYALATADKFIRSGAYRNVLVIGSE
FABH_JANMA      DDVDLIILATSTPDFFGPSTACVVQRKLGITNCAAVDVQAVCSGFVYAVSIADNFIKAGTHKNVLVIGAE
FABH_DESPS      EDLDMIVVGTISAHMVMPSCACMIQQEIGAKKAFAFDVNAACSGFLYAMEVGSKYVATNPAMKVLCIGTE
FABH_CHLCV      DQIECIIFSTSAPDYIFPSSAALAQAYLGIKEVPAFDCMAACTGYLYGLSVAKALVESGAYNNVLLIAAD
FABH_YERE8      KDIGLIIVATTSSSHAFPSSACQVQQMLGIEDXXXXXXXXXXXGFTYALSVADQYVKSGAVKHAIVIGSD
FABH_SYNP6      TSVDLILLATSTPDDLF-GSACQVQAALGATQAVAFDLTAACSGFLFALVTGAQFIRSGAYRTVLVIGAD
FABH_SYNE7      TSVDLILLATSTPDDLF-GSACQVQAALGATQAVAFDLTAACSGFLFALVTGAQFIRSGAYRTVLVIGAD
FABH_RALEH      QSIDLIIVATSTPDFVFPSTACIVQEKLGITNCPAFDLQAVCSGFVYALATADKFIRSGSHRNVLVIGTE
FABH_LISW6      NDIDLFIVATVTQEATFPSVANIIQDRLGAKNAAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGAD
FABH_LISMO      DDIDLFIVATVTQEATFPSVANIIQDRLGAKNAAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGAD
FABH_LISMF      DDIDLFIVATVTQEATFPSVANIIQDRLGAKNAAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGAD
FABH_AGRT5      ADIDLIILATSTPDNTFPATAVNIQNRLGMTHGFAFDMQAVCSGFVYAVATADLYIRGGMAKRVLVIGAE
FABH_GLOVI      LDVDLLILATSTPDDLFGG-AAHLQHEIGAVRAVAFDLTAACSGFVFALATASQFVRTGTYRTVLVVGAD
FABH_RHOBA      DEIDLILVATITPDHPTPSTACHLQRRLGAV-APAMDIGAACAGFMYALVTGAQFVSNGNARNVLVIGAD
FABH_RHIME      DDVDLIIVATSTPDNTFPATAVNIQNRLGMRHGAAFDMQAVCSGFVYAVATADAYIRGGLSKRALVIGAE
FABH_CUPTR      QDIDLIIVATSTPDFVFPSTACIVQEKLGITNCPAFDLQAVCSGFVYALATADKFIRSGSHRNVLVIGTE
FABH_CAUCR      XDVDLIIVATTTGDLTFPATATIVQRKLGAPVGVAFDVQAVCSGFVYAMSVADGFVARGHSKCALVIGAE
FABH2_BACAN     EDVDCIIVATTTADYVFPSVACQIQQYFNIPHTMAFDLNATCAGFTYGLHVGNSLITSGSHKKVLVVATE
FABH_BORPD      XEVDLIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSGFVYALSTADAFVRAGRARCALVIGAE
FABH_RICPR      XXXXXXXXXXXXXXNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLAHSLIVSGKYKTILLIGAE
FABH_PROMA      ESIEMVLIATSTPDDLF-GMAPKVQSKLGATRAVAFDLTAACSGFLFGLVSAAQFLQNGSFKRAVVIGAD
FABH_HERAR      NDIDLIILATSTPDFFGPSTACVVQRKLGVTNGAAVDVQAVCSGFVYALATADKFIKSGSHKNVLVIGAE
FABH2_BACCR     EDVDCIIVATTTADYVFPSVACQIQQYFNIPHTLAFDLNATCAGFTYGLHVGNSLITSESHEKVLVVATE
FABH_RALEJ      QSIDLILVATSTPDFVFPSTACIIQNKLGINNCAAFDLQAVCSGFVYALATADKFIRSGSHRNVLVIGTE
FABH_LISIN      DDIDLFIVATVTQEATFPSVANIIQDRLGAKNAAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGAD
FABH_RHIL3      ADIDLVICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAVTTADAYIRGGLAKRVLVIGAE
FABH1_STRCO     SRIGAVVVSTVSHFSQTPAIATEIADRLGTDKAAAFDISAGCAGFGYGLTLAKGMVVEGSAEYVLVIGVE
FABH_AZOPC      LEIDAVLFATATPDYPFPNSASLIAHKVGITNAFGFDMEAACSGFIYALEVAQGFIVSGKHKKVMIIAGD
FABH_PORGI      KSIDGLILATNSSDYHFPSTASIVAHEIGCGDIFSFDMQAACPTFIYALEVGANFIRSGRYSKILVIATE
FABH_PORG3      KSIDGLILATNSSDYHFPSTASIVAHEIGCGDIFSFDMQAACPTFIYALEVGANFIRSGRYSKILVIATE
FABH_ROSDO      QDVDAIIVATSTADLTFPSAATMVQAELGMTRGFAFDVQAVCAGFVFALSNANALILSGQARRVLVIGAE
FABH_POLSQ      SDLDLIILATSTPDHLGPSTACVVQDKLGAHTAAAFDVQAVCAGFTYALATADAFIRTGSYKKVLVIGAE
FABH3_STRCO     DEIDAVIVATTTPDRPCPATAPTVAARLGTGPVPAFDVSAVCSGFLYGLATGSGLIASGAAERVLVIGAE
FABH2_BACSU     DDVDMILVATTTSDYAFPSTACRVQEYFGWESTGALDINATCAGLTYGLHLANGLITSGLHQKILVIAGE
FABH_DINSH      QDVDAVIVATSTPDLTFPAVATMVQARLGMTRGFAYDVQAVCAGFVFAMANANAMILSGQADRILVIGAE
FABH_CHLMU      XQIDCIVFATAAPDYIFPSSAALAQAYLGIKEVPAFDCLVACTGFLYGLSIAKAYVEAGMYQCVLVI