[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99301.1

[Show Plain Result]


## Summary of Sequence Search
    1::448
   10::446     1e-29  26%  472 aa  DNAB_BACSU RecName: Full=Replication initiation and membrane
  487::655     2e-05  28% 1639 aa  MSP1_PLAFW RecName: Full=Merozoite surface protein 1;AltName:
  478::646     2e-05  28% 1630 aa  MSP1_PLAFK RecName: Full=Merozoite surface protein 1;AltName:
   18::168     4e-04  25%  413 aa  Y525_MYCPN RecName: Full=Uncharacterized protein MG349 homolog;
  205::353     7e-04  26%  667 aa  Y366_MYCGE RecName: Full=Uncharacterized protein MG366;
  559::643     7e-04  30%  790 aa  LYS14_YEAST RecName: Full=Lysine biosynthesis regulatory protein
  532::633     0.001  33% 1726 aa  MSP1_PLAFP RecName: Full=Merozoite surface protein 1;AltName:
  501::602     0.001  33% 1701 aa  MSP1_PLAFM RecName: Full=Merozoite surface protein 1;AltName:
  501::602     0.001  33% 1701 aa  MSP1_PLAFF RecName: Full=Merozoite surface protein 1;AltName:
  532::633     0.001  33% 1726 aa  MSP1_PLAFC RecName: Full=Merozoite surface protein 1;AltName:
    1::448

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxPKDGYLVSASTYIDNHDIEIVQVLYQPIIGIVAVALYSYLRFEIDSKLILSERKLNKNIID
DNAB_BACSU      ---------PVDPYVVKSRSMLQDIDRQIITQLYQPLIGPVAFSLYMTLWGELEQNRLWGGESTHRQLMG
MSP1_PLAFW      ----------------------------------------------------------------------
MSP1_PLAFK      ----------------------------------------------------------------------
Y525_MYCPN      --------------------------LDMISHAYGQIAGVEVVGFYLWLITEANAQAFNSEIRTPQNAFN
Y366_MYCGE      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
MSP1_PLAFP      ----------------------------------------------------------------------
MSP1_PLAFM      ----------------------------------------------------------------------
MSP1_PLAFF      ----------------------------------------------------------------------
MSP1_PLAFC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLGISIPELYDARLKLEATGLIKTFEGEDKLGKYHIYELQKPLNEVKFFTDDLLSTALLEMVGNEKFKKL
DNAB_BACSU      MTQSNLKTIHQEQGKLEGIGLLKVYMKEERQERLFIYELLPPLRPNEFFEDGMLNVFLYNRVGKTKYQQL
MSP1_PLAFW      -------------------------------------EYEKLLNEISKFNNNIDLTNFEKMMGKRKVEKL
MSP1_PLAFK      -------------------------------------EYEKLLNEISKFNNNIDLTNFEKMMGKRKVEKL
Y525_MYCPN      TTGVNVPDIYKTIGKLESLGLVRTFFSQEK--SEMTFWIVEPLGWKEFNQKKHFKEKLIESMGKLEYDRN
Y366_MYCGE      ----------------------------------------------------------------------
LYS14_YEAST     -----------------------------------------------------------DLVIKEVFKSL
MSP1_PLAFP      ----------------------------------------------------------------------
MSP1_PLAFM      ----------------------------------------------------------------------
MSP1_PLAFF      ----------------------------------------------------------------------
MSP1_PLAFC      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SLWNKFDNNYHDKKEVTKQFFDVFNLNKDNIVLQAQLNNSKISNDESLINRQKVSLDMTVFSDFIKNSYV
DNAB_BACSU      KQFFTHPAISEDAKDITRPFNHAFESMEETVRLAEGSEYTSVGQSPSYTITEDV-FDFDLFLAGLSETMI
MSP1_PLAFW      THHNTFENSKHNLEKLTKALKYMEDYSLRNIVVEKELKYSKIENEETLVENIKKDEEQLFEKKITKDENK
MSP1_PLAFK      THHNTFENSKHNLEKLTKALKYMEDYSLRNIVVEKELKYSKIENEETLVENIKKDEEQLFEKKITKDENK
Y525_MYCPN      CLFEQIDNQFDNALEITANFEANFTSKQD-----------------------------------------
Y366_MYCGE      --------------------YELQNKNNVSFFLNTEIKTSK--NSFSLSSKEK---------DYFKNKPF
LYS14_YEAST     NTIRSTEKNYFSKEE------GLFTKKLDYLLLSSQTSSEKSKDQISYFNTQKVEIDKQLDYEFIDKSGI
MSP1_PLAFP      ----KFNNNF-DKDVVDKIFSARYTYN----VEKQRYNNKFSSSNNSVYNVQKLKKALSYLEDYSLRKGI
MSP1_PLAFM      ----KFNNNF-DKDVVDKIFSARYTYN----VEKQRYNNKFSSSNNSVYNVQKLKKALSYLEDYSLRKGI
MSP1_PLAFF      ----KFNNNF-DKDVVDKIFSARYTYN----VEKQRYNNKFSSSNNSVYNVQKLKKALSYLEDYSLRKGI
MSP1_PLAFC      ----KFNNNF-DKDVVDKIFSARYTYN----VEKQRYNNKFSSSNNSVYNVQKLKKALSYLEDYSLRKGI


                         .         .         .         +         .         .         .:280
query           SSDDVMNHLDIIKSVKLVYGIDEFQLVKLLEKAINVTNNKIDYNEFKKLAQKNFDSGIRRNFKKNKIVET
DNAB_BACSU      PRKAMTQQVDTIKKLSYLYGIDPLQMQNVVMSAID-ERDVITTEALRKAASDWYQ--IERNGQLPDLVEK
MSP1_PLAFW      PDEKILEVSDIVKKVLLMNKIDELKKTQLILKNVELKHNIHVPNSYKQ----------------------
MSP1_PLAFK      PDEKILEVSDIVKKVLLMNKIDELKKTQLILKNVELKHNIHVPNSYKQ----------------------
Y525_MYCPN      ----------------------------------------------------------------------
Y366_MYCGE      NHPEKIAYIHKKKS----NGVNGFLIVKLIDNLIK--NNIVDLNKISDFVTKEIDSKSVRNIQ--PLIKN
LYS14_YEAST     IPSDNQSH--------------------------------------------------------------
MSP1_PLAFP      SEKD-FNHYYTLKT-----GLEAD--IKKLTEEIKSSENKILEKNFKGL---------------------
MSP1_PLAFM      SEKD-FNHYYTLKT-----GLEAD--IKKLTEEIKSSENKILEKNFKGL---------------------
MSP1_PLAFF      SEKD-FNHYYTLKT-----GLEAD--IKKLTEEIKSSENKILEKNFKGL---------------------
MSP1_PLAFC      SEKD-FNHYYTLKT-----GLEAD--IKKLTEEIKSSENKILEKNFKGL---------------------


                         .         *         .         .         .         .         +:350
query           AXXXXXXXXXXXXPLVNAFKAYVPLEFLEILKNELGSFVTANERYAVKTLVEKQMLPNEVINVLIHYLLV
DNAB_BACSU      TGEQPAEEDSLDGKLIALLEAISPKKLLQDIAD--GTEPSKADLKIIEEIMFEQKLEPGVTNVLIYYVML
MSP1_PLAFW      ----------------------------------------------------------------------
MSP1_PLAFK      ----------------------------------------------------------------------
Y525_MYCPN      ----------------------------------------------------------------------
Y366_MYCGE      AAKIQINFWDQ----IQDIKKYQELKINQIVFNYSENFDSFWSNYLLRNLIK------------------
LYS14_YEAST     ----------------------------------------------------------------------
MSP1_PLAFP      ----------------------------------------------------------------------
MSP1_PLAFM      ----------------------------------------------------------------------
MSP1_PLAFF      ----------------------------------------------------------------------
MSP1_PLAFC      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VQDSSTILKGTFERIAADWTKKKIKNAQEAMTYVKSFTREKSLQRKATKKDSKGRKSNVIVKEKLPEWAK
DNAB_BACSU      KTDMK-LSKNYIQKIASHWARKKVKTVREAMKLAIEENRQYLEWAEGKTKSSK-RNQKVIREEKLPDWMT
MSP1_PLAFW      ----------------------------------------------------------------------
MSP1_PLAFK      ----------------------------------------------------------------------
Y525_MYCPN      ----------------------------------------------------------------------
Y366_MYCGE      ----------------------------------------------------------------------
LYS14_YEAST     ----------------------------------------------------------------------
MSP1_PLAFP      ----------------------------------------------------------------------
MSP1_PLAFM      ----------------------------------------------------------------------
MSP1_PLAFF      ----------------------------------------------------------------------
MSP1_PLAFC      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EKGKNKLTDVGKKExxxxxxxxxxxxxx
DNAB_BACSU      EKETASDSESGQQK--------------
MSP1_PLAFW      ----------------------------
MSP1_PLAFK      ----------------------------
Y525_MYCPN      ----------------------------
Y366_MYCGE      ----------------------------
LYS14_YEAST     ----------------------------
MSP1_PLAFP      ----------------------------
MSP1_PLAFM      ----------------------------
MSP1_PLAFF      ----------------------------
MSP1_PLAFC      ----------------------------