[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99303.1

[Show Plain Result]


## Summary of Sequence Search
    1::649
    1::649       0.0 100%  649 aa  SYT_LACS1 RecName: Full=Threonyl-tRNA synthetase;       
    1::650       0.0  71%  654 aa  SYT_LACPL RecName: Full=Threonyl-tRNA synthetase;       
    1::646       0.0  65%  656 aa  SYT_LACSS RecName: Full=Threonyl-tRNA synthetase;       
    1::646       0.0  66%  648 aa  SYT_PEDPA RecName: Full=Threonyl-tRNA synthetase;       
    1::645       0.0  65%  647 aa  SYT_LACBA RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  63%  657 aa  SYT_LACCB RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  62%  657 aa  SYT_LACC3 RecName: Full=Threonyl-tRNA synthetase;       
    2::645       0.0  61%  645 aa  SYT_ENTFA RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  61%  648 aa  SYT_STRTD RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  61%  648 aa  SYT_STRT2 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  61%  648 aa  SYT_STRT1 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  59%  649 aa  SYT_STRMU RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  59%  647 aa  SYT_STRGC RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  61%  648 aa  SYT_STRU0 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  59%  647 aa  SYT_STRA5 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  59%  647 aa  SYT_STRA1 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  59%  647 aa  SYT_STRA3 RecName: Full=Threonyl-tRNA synthetase;       
    1::650       0.0  61%  652 aa  SYT_LEUMM RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRSV RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRZJ RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRZT RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRZP RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRPI RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRP7 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRP4 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRPJ RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  647 aa  SYT_STRPN RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  647 aa  SYT_STRR6 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  647 aa  SYT_STRP2 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  646 aa  SYT_LACLS RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  58%  648 aa  SYT_STRS7 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  650 aa  SYT_STRSY RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  650 aa  SYT_STRS2 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  57%  646 aa  SYT_LACLM RecName: Full=Threonyl-tRNA synthetase;       
    1::649       0.0  60%  653 aa  SYT_LEUCK RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPF RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPG RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPC RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPB RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRP8 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRP1 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRP3 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPZ RecName: Full=Threonyl-tRNA synthetase;       
    2::641       0.0  57%  647 aa  SYT_STRPM RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAW RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAT RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAS RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAR RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAE RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAC RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAA9 RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAA3 RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAA2 RecName: Full=Threonyl-tRNA synthetase;       
    2::644       0.0  56%  646 aa  SYT_LACLA RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  647 aa  SYT_STACT RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  56%  647 aa  SYT_STRP6 RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAA8 RecName: Full=Threonyl-tRNA synthetase;       
    2::642       0.0  57%  647 aa  SYT_STRPD RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAN RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAM RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAAB RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAA1 RecName: Full=Threonyl-tRNA synthetase;       
    1::639       0.0  58%  645 aa  SYT_STAS1 RecName: Full=Threonyl-tRNA synthetase;       
    5::641       0.0  59%  643 aa  SYT_ANOFW RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  58%  644 aa  SYT_LACH4 RecName: Full=Threonyl-tRNA synthetase;       
    5::633       0.0  60%  644 aa  SYT_GEOSW RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  58%  640 aa  SYT_LISMO RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  57%  640 aa  SYT_LISIN RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  57%  640 aa  SYT_LISMH RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  57%  640 aa  SYT_LISMF RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  57%  640 aa  SYT_LISMC RecName: Full=Threonyl-tRNA synthetase;       
    1::640       0.0  57%  640 aa  SYT_LISW6 RecName: Full=Threonyl-tRNA synthetase;       
    5::641       0.0  58%  652 aa  SYT_GEOKA RecName: Full=Threonyl-tRNA synthetase;       
    5::633       0.0  57%  643 aa  SYT1_BACSU RecName: Full=Threonyl-tRNA synthetase 1;       
    1::631       0.0  58%  645 aa  SYT_STAEQ RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  57%  644 aa  SYT_LACAC RecName: Full=Threonyl-tRNA synthetase;       
    1::631       0.0  58%  645 aa  SYT_STAES RecName: Full=Threonyl-tRNA synthetase;       
    5::633       0.0  56%  643 aa  SYT_BACA2 RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  56%  643 aa  SYT_LACGA RecName: Full=Threonyl-tRNA synthetase;       
    2::643       0.0  56%  643 aa  SYT_LACJO RecName: Full=Threonyl-tRNA synthetase;       
    2::640       0.0  53%  642 aa  SYT_ACHLI RecName: Full=Threonyl-tRNA synthetase;       
    1::642       0.0  55%  646 aa  SYT_OCEIH RecName: Full=Threonyl-tRNA synthetase;       
    1::647       0.0  54%  647 aa  SYT_EXISA RecName: Full=Threonyl-tRNA synthetase;       
    5::635       0.0  58%  645 aa  SYT_BACHD RecName: Full=Threonyl-tRNA synthetase;       
    2::637     e-170  46%  641 aa  SYT_AYWBP RecName: Full=Threonyl-tRNA synthetase;       
    2::638     e-168  46%  640 aa  SYT_PHYMT RecName: Full=Threonyl-tRNA synthetase;       
    2::637     e-162  43%  641 aa  SYT_PHYAS RecName: Full=Threonyl-tRNA synthetase;       
    5::635     e-150  44%  638 aa  SYT2_BACSU RecName: Full=Threonyl-tRNA synthetase 2;       
    2::641     e-150  42%  646 aa  SYT_BACFR RecName: Full=Threonyl-tRNA synthetase;       
    2::641     e-150  42%  646 aa  SYT_BACFN RecName: Full=Threonyl-tRNA synthetase;       
    2::632     e-149  45%  635 aa  SYT_DESRM RecName: Full=Threonyl-tRNA synthetase;       
    2::632     e-149  45%  635 aa  SYT_CLOTH RecName: Full=Threonyl-tRNA synthetase;       
    2::641     e-149  41%  646 aa  SYT_BACTN RecName: Full=Threonyl-tRNA synthetase;       
    2::640     e-148  41%  651 aa  SYT_PARD8 RecName: Full=Threonyl-tRNA synthetase;       
   11::653     e-148  41%  659 aa  SYT_CHLT3 RecName: Full=Threonyl-tRNA synthetase;       
    1::637     e-147  45%  638 aa  SYT_PELCD RecName: Full=Threonyl-tRNA synthetase;       
    2::630     e-146  43%  634 aa  SYT_CARHZ RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-145  44%  637 aa  SYT_CLONN RecName: Full=Threonyl-tRNA synthetase;       
    8::639     e-145  42%  644 aa  SYT_THETN RecName: Full=Threonyl-tRNA synthetase;       
    9::657     e-145  40%  657 aa  SYT_PROA2 RecName: Full=Threonyl-tRNA synthetase;       
    3::635     e-145  42%  640 aa  SYT_THENN RecName: Full=Threonyl-tRNA synthetase;       
    2::641     e-145  41%  646 aa  SYT_BACV8 RecName: Full=Threonyl-tRNA synthetase;       
    9::653     e-144  41%  657 aa  SYT_CHLL2 RecName: Full=Threonyl-tRNA synthetase;       
    3::621     e-144  43%  640 aa  SYT_THEP1 RecName: Full=Threonyl-tRNA synthetase;       
    3::606     e-144  43%  640 aa  SYT_THEMA RecName: Full=Threonyl-tRNA synthetase;       
    4::620     e-144  43%  639 aa  SYT_RUBXD RecName: Full=Threonyl-tRNA synthetase;       
   21::632     e-144  44%  639 aa  SYT_CLOTE RecName: Full=Threonyl-tRNA synthetase;       
    2::643     e-143  42%  643 aa  SYT_CLOBB RecName: Full=Threonyl-tRNA synthetase;       
    3::621     e-143  42%  640 aa  SYT_THESQ RecName: Full=Threonyl-tRNA synthetase;       
    2::622     e-143  43%  637 aa  SYT_CLOK5 RecName: Full=Threonyl-tRNA synthetase;       
    2::622     e-143  43%  637 aa  SYT_CLOK1 RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-142  46%  635 aa  SYT_CLOB6 RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-142  40%  645 aa  SYT_CYTH3 RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-142  46%  635 aa  SYT_CLOBM RecName: Full=Threonyl-tRNA synthetase;       
   10::632     e-142  41%  666 aa  SYT_PROVI RecName: Full=Threonyl-tRNA synthetase;       
    2::643     e-142  41%  643 aa  SYT_CLOBA RecName: Full=Threonyl-tRNA synthetase;       
   13::632     e-142  42%  657 aa  SYT_CHLTE RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-142  46%  635 aa  SYT_CLOBL RecName: Full=Threonyl-tRNA synthetase;       
    2::641     e-142  40%  648 aa  SYT_AZOPC RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-142  45%  635 aa  SYT_CLOBK RecName: Full=Threonyl-tRNA synthetase;       
    2::639     e-141  40%  648 aa  SYT_FLAPJ RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-141  45%  635 aa  SYT_CLOBJ RecName: Full=Threonyl-tRNA synthetase;       
    9::659     e-141  40%  659 aa  SYT_CHLPB RecName: Full=Threonyl-tRNA synthetase;       
   10::655     e-141  40%  657 aa  SYT_CHLCH RecName: Full=Threonyl-tRNA synthetase;       
   15::639     e-141  41%  643 aa  SYT_SULSY RecName: Full=Threonyl-tRNA synthetase;       
    8::632     e-141  41%  657 aa  SYT_PELPB RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-140  45%  635 aa  SYT_CLOBH RecName: Full=Threonyl-tRNA synthetase;       
    2::607     e-140  45%  635 aa  SYT_CLOB1 RecName: Full=Threonyl-tRNA synthetase;       
    2::632     e-140  42%  635 aa  SYT_SYNWW RecName: Full=Threonyl-tRNA synthetase;       
    2::640     e-140  39%  648 aa  SYT_FLAJ1 RecName: Full=Threonyl-tRNA synthetase;       
   11::578     e-139  44%  580 aa  SYT_UREU1 RecName: Full=Threonyl-tRNA synthetase;       
    4::621     e-139  43%  644 aa  SYT_ACIF5 RecName: Full=Threonyl-tRNA synthetase;       
    4::621     e-139  43%  644 aa  SYT_ACIF2 RecName: Full=Threonyl-tRNA synthetase;       
   11::572     e-139  45%  580 aa  SYT_UREPA RecName: Full=Threonyl-tRNA synthetase;       
   11::572     e-139  45%  580 aa  SYT_UREP2 RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-138  42%  636 aa  SYT_PELPD RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-138  40%  642 aa  SYT_THICR RecName: Full=Threonyl-tRNA synthetase;       
    3::632     e-138  41%  634 aa  SYT_FINM2 RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-137  41%  643 aa  SYT_THISH RecName: Full=Threonyl-tRNA synthetase;       
   11::636     e-137  41%  638 aa  SYT_AQUAE RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-136  42%  636 aa  SYT_GEOBB RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-136  42%  636 aa  SYT_GEOSM RecName: Full=Threonyl-tRNA synthetase;       
    2::642     e-136  39%  653 aa  SYT_PORG3 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-136  41%  636 aa  SYT_NATTJ RecName: Full=Threonyl-tRNA synthetase;       
    5::666     e-135  41%  681 aa  SYT_ACIC5 RecName: Full=Threonyl-tRNA synthetase;       
    2::622     e-135  42%  639 aa  SYT_CLOD6 RecName: Full=Threonyl-tRNA synthetase;       
    2::642     e-135  39%  653 aa  SYT_PORGI RecName: Full=Threonyl-tRNA synthetase;       
    2::622     e-135  42%  637 aa  SYT_CLOAB RecName: Full=Threonyl-tRNA synthetase;       
    4::633     e-135  42%  644 aa  SYT_NITOC RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-135  40%  640 aa  SYT_HALHL RecName: Full=Threonyl-tRNA synthetase;       
    4::640     e-135  40%  648 aa  SYT_KOSOT RecName: Full=Threonyl-tRNA synthetase;       
   29::610     e-134  42%  638 aa  SYT_THELT RecName: Full=Threonyl-tRNA synthetase;       
    3::642     e-134  41%  659 aa  SYT_THET8 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-134  41%  636 aa  SYT_SACD2 RecName: Full=Threonyl-tRNA synthetase;       
    3::645     e-133  40%  649 aa  SYT_DEIDV RecName: Full=Threonyl-tRNA synthetase;       
    1::636     e-133  40%  636 aa  SYT_GEOSL RecName: Full=Threonyl-tRNA synthetase;       
    3::605     e-133  44%  620 aa  SYT_FUSNN RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-132  39%  644 aa  SYT_PSYWF RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-132  39%  641 aa  SYT_MARAV RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-132  41%  637 aa  SYT_LEGPH RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-132  41%  637 aa  SYT_LEGPC RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-132  41%  637 aa  SYT_LEGPA RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-131  40%  640 aa  SYT_HALSA RecName: Full=Threonyl-tRNA synthetase;       
    1::635     e-131  40%  640 aa  SYT_HALS3 RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-131  41%  651 aa  SYT_COXBU RecName: Full=Threonyl-tRNA synthetase;       
    3::643     e-131  40%  649 aa  SYT_DEIRA RecName: Full=Threonyl-tRNA synthetase;       
    3::642     e-131  40%  659 aa  SYT_THET2 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-131  39%  637 aa  SYT_TERTT RecName: Full=Threonyl-tRNA synthetase;       
    6::631     e-130  41%  644 aa  SYT_DESVM RecName: Full=Threonyl-tRNA synthetase;       
    5::642     e-130  41%  650 aa  SYT_ANADE RecName: Full=Threonyl-tRNA synthetase;       
    3::644     e-130  39%  656 aa  SYT_BDEBA RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-130  40%  637 aa  SYT_HAHCH RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-130  41%  638 aa  SYT_METCA RecName: Full=Threonyl-tRNA synthetase;       
    4::625     e-130  39%  640 aa  SYT_ACICJ RecName: Full=Threonyl-tRNA synthetase;       
    1::627     e-130  41%  654 aa  SYT_DINSH RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-130  40%  635 aa  SYT_RICFE RecName: Full=Threonyl-tRNA synthetase;       
   22::631     e-129  42%  644 aa  SYT_DESDG RecName: Full=Threonyl-tRNA synthetase;       
    2::640     e-129  40%  643 aa  SYT_CLOPS RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-129  40%  635 aa  SYT_RICTY RecName: Full=Threonyl-tRNA synthetase;       
    2::645     e-129  41%  652 aa  SYT_PARL1 RecName: Full=Threonyl-tRNA synthetase;       
    2::603     e-129  41%  637 aa  SYT_DESOH RecName: Full=Threonyl-tRNA synthetase;       
    2::632     e-129  40%  635 aa  SYT_FRAP2 RecName: Full=Threonyl-tRNA synthetase;       
    2::640     e-129  40%  643 aa  SYT_CLOPE RecName: Full=Threonyl-tRNA synthetase;       
    2::640     e-129  40%  643 aa  SYT_CLOP1 RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-129  40%  637 aa  SYT_LEGPL RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-129  39%  635 aa  SYT_RALPJ RecName: Full=Threonyl-tRNA synthetase;       
    3::600     e-128  41%  651 aa  SYT_SYMTH RecName: Full=Threonyl-tRNA synthetase;       
    2::618     e-128  39%  636 aa  SYT_DESAH RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-128  41%  642 aa  SYT_VIBHB RecName: Full=Threonyl-tRNA synthetase;       
    6::631     e-128  41%  644 aa  SYT_DESVV RecName: Full=Threonyl-tRNA synthetase;       
    6::631     e-128  41%  644 aa  SYT_DESVH RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-128  39%  634 aa  SYT_FRATN RecName: Full=Threonyl-tRNA synthetase;       
    2::621     e-128  40%  636 aa  SYT_DESAA RecName: Full=Threonyl-tRNA synthetase;       
    2::633     e-128  39%  640 aa  SYT_PETMO RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-128  39%  642 aa  SYT_CELJU RecName: Full=Threonyl-tRNA synthetase;       
    5::642     e-128  40%  650 aa  SYT_ANASK RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-128  39%  634 aa  SYT_FRATW RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-128  39%  634 aa  SYT_FRATT RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-128  39%  634 aa  SYT_FRAT1 RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-128  39%  634 aa  SYT_FRATM RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-127  39%  635 aa  SYT_RICAH RecName: Full=Threonyl-tRNA synthetase;       
    5::642     e-127  40%  650 aa  SYT_ANAD2 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-127  38%  635 aa  SYT_NITEC RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-127  41%  642 aa  SYT_VIBPA RecName: Full=Threonyl-tRNA synthetase;       
    4::635     e-127  38%  640 aa  SYT_PROM1 RecName: Full=Threonyl-tRNA synthetase;       
    5::638     e-127  39%  642 aa  SYT_MYXXD RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-127  40%  642 aa  SYT_VIBVY RecName: Full=Threonyl-tRNA synthetase;       
    2::611     e-127  41%  635 aa  SYT_RICPR RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-127  39%  635 aa  SYT_METFK RecName: Full=Threonyl-tRNA synthetase;       
    4::622     e-127  39%  641 aa  SYT_GLUDA RecName: Full=Threonyl-tRNA synthetase;       
    4::623     e-127  39%  635 aa  SYT_NITEU RecName: Full=Threonyl-tRNA synthetase;       
    2::630     e-126  39%  633 aa  SYT_WOLWR RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-126  40%  642 aa  SYT_VIBVU RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-126  38%  634 aa  SYT_FRATO RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-126  38%  634 aa  SYT_FRATH RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-126  38%  634 aa  SYT_FRATF RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-126  39%  635 aa  SYT_RICBR RecName: Full=Threonyl-tRNA synthetase;       
    4::614     e-126  40%  645 aa  SYT_GLUOX RecName: Full=Threonyl-tRNA synthetase;       
    2::630     e-126  40%  633 aa  SYT_RICB8 RecName: Full=Threonyl-tRNA synthetase;       
    2::623     e-126  39%  643 aa  SYT_RHORT RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-126  38%  638 aa  SYT_PROM4 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-126  39%  635 aa  SYT_RICCN RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-126  39%  635 aa  SYT_RICAE RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-126  39%  635 aa  SYT_RICPU RecName: Full=Threonyl-tRNA synthetase;       
   29::627     e-126  42%  642 aa  SYT_LAWIP RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-126  38%  650 aa  SYT_BORA1 RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-125  38%  645 aa  SYT_MARMS RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  39%  635 aa  SYT_RICRS RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-125  38%  637 aa  SYT_NEIMB RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-125  38%  635 aa  SYT_RALSO RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-125  38%  641 aa  SYT_ALHEH RecName: Full=Threonyl-tRNA synthetase;       
    2::633     e-125  38%  635 aa  SYT_RALEJ RecName: Full=Threonyl-tRNA synthetase;       
    2::637     e-125  38%  644 aa  SYT_PSYCK RecName: Full=Threonyl-tRNA synthetase;       
    4::613     e-125  39%  633 aa  SYT_CHRVO RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURPS RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURP6 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURP1 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURP0 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURMS RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURMA RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURM9 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURM7 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-125  38%  635 aa  SYT_BURS3 RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-125  38%  635 aa  SYT_BURPP RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-124  40%  642 aa  SYT_VIBCM RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-124  40%  642 aa  SYT_VIBCH RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-124  37%  635 aa  SYT_RICCK RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-124  38%  635 aa  SYT_BURTA RecName: Full=Threonyl-tRNA synthetase;       
    4::610     e-124  40%  642 aa  SYT_VIBC3 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-124  38%  640 aa  SYT_POLSQ RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-124  38%  636 aa  SYT_ANAMM RecName: Full=Threonyl-tRNA synthetase;       
    2::611     e-124  40%  648 aa  SYT_MAGSM RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-124  38%  635 aa  SYT_BURXL RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-124  37%  635 aa  SYT_BURP8 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-124  38%  635 aa  SYT_BURCJ RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-124  38%  636 aa  SYT_ANAMF RecName: Full=Threonyl-tRNA synthetase;       
    2::618     e-124  40%  651 aa  SYT_RHOCS RecName: Full=Threonyl-tRNA synthetase;       
    2::615     e-124  39%  658 aa  SYT_PHEZH RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-124  38%  650 aa  SYT_BORPD RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-124  40%  658 aa  SYT_BRUME RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-124  38%  636 aa  SYT_XANCP RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-124  38%  636 aa  SYT_XANCB RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-124  38%  636 aa  SYT_XANC8 RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-124  40%  658 aa  SYT_STRGG RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-124  41%  648 aa  SYT_ROSDO RecName: Full=Threonyl-tRNA synthetase;       
    2::623     e-124  38%  644 aa  SYT_PSYA2 RecName: Full=Threonyl-tRNA synthetase;       
   14::581     e-124  42%  582 aa  SYT_DEHSC RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-124  38%  635 aa  SYT_CUPTR RecName: Full=Threonyl-tRNA synthetase;       
    4::619     e-124  38%  632 aa  SYT_CHRSD RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-124  38%  635 aa  SYT_BURCC RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-123  38%  640 aa  SYT_PSEPK RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  40%  658 aa  SYT_BRUAB RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  40%  658 aa  SYT_BRUA2 RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  40%  658 aa  SYT_BRUA1 RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-123  37%  635 aa  SYT_RALEH RecName: Full=Threonyl-tRNA synthetase;       
   14::581     e-123  41%  582 aa  SYT_DEHSB RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-123  38%  635 aa  SYT_BURVG RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  39%  658 aa  SYT_BRUSU RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  39%  658 aa  SYT_BRUSI RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  39%  658 aa  SYT_BRUC2 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-123  41%  662 aa  SYT_AGRRK RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-123  38%  634 aa  SYT_XANC5 RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-123  38%  640 aa  SYT_PSEP1 RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-123  38%  634 aa  SYT_XANAC RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-123  39%  658 aa  SYT_BRUMB RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-123  38%  635 aa  SYT_BURCM RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-123  38%  634 aa  SYT_XANOR RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-123  38%  634 aa  SYT_XANOM RecName: Full=Threonyl-tRNA synthetase;       
   33::629     e-123  40%  658 aa  SYT_STRAW RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-123  38%  640 aa  SYT_PSE14 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-123  38%  640 aa  SYT_POLNS RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-123  38%  635 aa  SYT_BURA4 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-122  38%  635 aa  SYT_PSYIN RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-122  39%  642 aa  SYT_NATPD RecName: Full=Threonyl-tRNA synthetase;       
    3::645     e-122  38%  649 aa  SYT_DEIGD RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-122  37%  642 aa  SYT_KLEP3 RecName: Full=Threonyl-tRNA synthetase;       
    2::634     e-122  38%  635 aa  SYT_BURM1 RecName: Full=Threonyl-tRNA synthetase;       
    4::621     e-122  39%  636 aa  SYT_VESOH RecName: Full=Threonyl-tRNA synthetase;       
    2::615     e-122  39%  644 aa  SYT_MARMM RecName: Full=Threonyl-tRNA synthetase;       
    2::616     e-122  39%  638 aa  SYT_MAGSA RecName: Full=Threonyl-tRNA synthetase;       
    2::630     e-122  38%  633 aa  SYT_WOLPM RecName: Full=Threonyl-tRNA synthetase;       
   14::581     e-122  41%  582 aa  SYT_DEHE1 RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-122  40%  661 aa  SYT_RHISN RecName: Full=Threonyl-tRNA synthetase;       
    2::627     e-122  39%  657 aa  SYT_HYPNA RecName: Full=Threonyl-tRNA synthetase;       
    4::642     e-122  41%  666 aa  SYT_AGRVS RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-122  39%  660 aa  SYT_SINMW RecName: Full=Threonyl-tRNA synthetase;       
    1::637     e-122  39%  658 aa  SYT_RHOPA RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-122  37%  641 aa  SYT_PROMT RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECOSE RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECOLC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECOHS RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECO55 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECO24 RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-121  38%  649 aa  SYT_BORPE RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-121  38%  649 aa  SYT_BORPA RecName: Full=Threonyl-tRNA synthetase;       
    2::636     e-121  38%  649 aa  SYT_BORBR RecName: Full=Threonyl-tRNA synthetase;       
    4::642     e-121  40%  667 aa  SYT_AGRT5 RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-121  38%  638 aa  SYT_PROM2 RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-121  37%  639 aa  SYT_ACIAC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_SHIDS RecName: Full=Threonyl-tRNA synthetase;       
    4::608     e-121  38%  638 aa  SYT_PROM9 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  38%  642 aa  SYT_ECO8A RecName: Full=Threonyl-tRNA synthetase;       
    1::632     e-121  40%  647 aa  SYT_DESMR RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-121  37%  633 aa  SYT_STRMK RecName: Full=Threonyl-tRNA synthetase;       
    5::637     e-121  39%  661 aa  SYT_RHIME RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-121  37%  642 aa  SYT_HAES1 RecName: Full=Threonyl-tRNA synthetase;       
    2::624     e-121  37%  633 aa  SYT_STRM5 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  36%  638 aa  SYT_PROMS RecName: Full=Threonyl-tRNA synthetase;       
    3::608     e-121  38%  638 aa  SYT_PROMP RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-121  37%  638 aa  SYT_LEPIC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_SHISS RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_SHIFL RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_SHIF8 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-121  38%  642 aa  SYT_SALTI RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-121  38%  642 aa  SYT_SALSV RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-121  38%  642 aa  SYT_SALA4 RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-121  39%  646 aa  SYT_RHOS1 RecName: Full=Threonyl-tRNA synthetase;       
    7::637     e-121  39%  656 aa  SYT_MESSB RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-121  37%  638 aa  SYT_LEPIN RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ERWCT RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOUT RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOSM RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOLU RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOLI RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOL6 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOL5 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOK1 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECODH RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECOBW RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECO81 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECO7I RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECO45 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-121  37%  642 aa  SYT_ECO27 RecName: Full=Threonyl-tRNA synthetase;       
    9::629     e-121  40%  642 aa  SYT_DESAD RecName: Full=Threonyl-tRNA synthetase;       
    5::652     e-120  38%  659 aa  SYT_ZYMMO RecName: Full=Threonyl-tRNA synthetase;       
    2::599     e-120  40%  635 aa  SYT_METPP RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_ECO5E RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_ECO57 RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-120  39%  658 aa  SYT_BARBK RecName: Full=Threonyl-tRNA synthetase;       
   31::596     e-120  41%  607 aa  SYT_SYNP6 RecName: Full=Threonyl-tRNA synthetase;       
   28::593     e-120  41%  604 aa  SYT_SYNE7 RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-120  39%  646 aa  SYT_RHOSK RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-120  39%  646 aa  SYT_RHOS4 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  36%  638 aa  SYT_PROM0 RecName: Full=Threonyl-tRNA synthetase;       
    4::624     e-120  38%  638 aa  SYT_IDILO RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALTY RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALPK RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALPA RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALHS RecName: Full=Threonyl-tRNA synthetase;       
    1::620     e-120  39%  648 aa  SYT_PARDP RecName: Full=Threonyl-tRNA synthetase;       
    1::630     e-120  37%  642 aa  SYT_HALMA RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  37%  642 aa  SYT_ENT38 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALPB RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALNS RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALEP RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALDC RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-120  37%  643 aa  SYT_ACTSZ RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_SHIBS RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_SHIB3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALG2 RecName: Full=Threonyl-tRNA synthetase;       
    2::654     e-120  38%  658 aa  SYT_RHILO RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-120  37%  635 aa  SYT_POLNA RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-120  37%  643 aa  SYT_PASMU RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-120  36%  643 aa  SYT_MANSM RecName: Full=Threonyl-tRNA synthetase;       
    1::628     e-120  39%  646 aa  SYT_RHOS5 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_ESCF3 RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-120  37%  640 aa  SYT_PSEA7 RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-120  37%  637 aa  SYT_NEIMA RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-120  37%  642 aa  SYT_HAES2 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-120  38%  642 aa  SYT_SALCH RecName: Full=Threonyl-tRNA synthetase;       
    3::608     e-120  37%  638 aa  SYT_PROM5 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-120  37%  642 aa  SYT_PECCP RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-120  37%  643 aa  SYT_HAEIN RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-119  40%  668 aa  SYT_RHIE6 RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  640 aa  SYT_PSEAE RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  640 aa  SYT_PSEAB RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-119  37%  640 aa  SYT_PSEA8 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  37%  643 aa  SYT_HAEIG RecName: Full=Threonyl-tRNA synthetase;       
    2::618     e-119  38%  633 aa  SYT_EHRCR RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  36%  636 aa  SYT_COLP3 RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  37%  643 aa  SYT_HAEI8 RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-119  38%  658 aa  SYT_BARHE RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-119  38%  642 aa  SYT_SALPC RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-119  39%  661 aa  SYT_RHIL3 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-119  37%  643 aa  SYT_PROMA RecName: Full=Threonyl-tRNA synthetase;       
    2::638     e-119  38%  648 aa  SYT_ORITB RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-119  37%  643 aa  SYT_HAEIE RecName: Full=Threonyl-tRNA synthetase;       
   33::653     e-119  38%  658 aa  SYT_STRCO RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-119  40%  668 aa  SYT_RHIEC RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-119  37%  642 aa  SYT_PROMH RecName: Full=Threonyl-tRNA synthetase;       
    2::638     e-119  38%  648 aa  SYT_ORITI RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-119  37%  643 aa  SYT_HAEPS RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-119  37%  632 aa  SYT_WOLTR RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-119  36%  638 aa  SYT_NITMU RecName: Full=Threonyl-tRNA synthetase;       
    1::626     e-119  39%  648 aa  SYT_SILST RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-119  37%  640 aa  SYT_PSEPF RecName: Full=Threonyl-tRNA synthetase;       
   22::577     e-119  41%  589 aa  SYT_MYCPU RecName: Full=Threonyl-tRNA synthetase;       
    4::626     e-119  37%  642 aa  SYT_GRABC RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPY RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPS RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPP RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPN RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPG RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPE RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPB RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERPA RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERP3 RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-118  36%  640 aa  SYT_PSEE4 RecName: Full=Threonyl-tRNA synthetase;       
   35::614     e-118  40%  627 aa  SYT_GLOVI RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-118  40%  668 aa  SYT_RHILW RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-118  37%  640 aa  SYT_PSEPG RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-118  38%  658 aa  SYT_BART1 RecName: Full=Threonyl-tRNA synthetase;       
    2::630     e-118  37%  633 aa  SYT_WOLPP RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-118  37%  642 aa  SYT_YERE8 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-118  36%  642 aa  SYT_SHESH RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-118  37%  639 aa  SYT_LEPBL RecName: Full=Threonyl-tRNA synthetase;       
    3::637     e-118  37%  639 aa  SYT_LEPBJ RecName: Full=Threonyl-tRNA synthetase;       
    1::633     e-118  38%  648 aa  SYT_SILPO RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-118  36%  642 aa  SYT_SHEPA RecName: Full=Threonyl-tRNA synthetase;       
    5::653     e-118  39%  664 aa  SYT_NOVAD RecName: Full=Threonyl-tRNA synthetase;       
    4::618     e-118  37%  638 aa  SYT_DECAR RecName: Full=Threonyl-tRNA synthetase;       
    4::593     e-118  39%  638 aa  SYT_AZOSB RecName: Full=Threonyl-tRNA synthetase;       
    2::639     e-117  38%  643 aa  SYT_DELAS RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-117  36%  642 aa  SYT_SHEPW RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-117  37%  640 aa  SYT_PSEU5 RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-117  38%  640 aa  SYT_PSEFS RecName: Full=Threonyl-tRNA synthetase;       
    2::614     e-117  37%  633 aa  SYT_EHRCJ RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-117  36%  642 aa  SYT_SHEWM RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-117  37%  640 aa  SYT_PSEU2 RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-117  37%  640 aa  SYT_AZOVD RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-117  36%  640 aa  SYT_PROM3 RecName: Full=Threonyl-tRNA synthetase;       
    2::637     e-117  38%  655 aa  SYT_CAUCR RecName: Full=Threonyl-tRNA synthetase;       
    2::637     e-117  38%  655 aa  SYT_CAUCN RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-117  36%  642 aa  SYT_SHESW RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-117  36%  642 aa  SYT_SHEPC RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-117  36%  640 aa  SYT_PSEPW RecName: Full=Threonyl-tRNA synthetase;       
    1::631     e-117  37%  642 aa  SYT_HALWD RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-117  36%  642 aa  SYT_SERP5 RecName: Full=Threonyl-tRNA synthetase;       
    4::624     e-117  38%  638 aa  SYT_ALTMD RecName: Full=Threonyl-tRNA synthetase;       
    4::633     e-117  37%  643 aa  SYT_ACTP2 RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-117  37%  640 aa  SYT_PSEMY RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-117  37%  640 aa  SYT_ACIBY RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-117  37%  640 aa  SYT_ACIBT RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-117  37%  640 aa  SYT_ACIBC RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-117  37%  640 aa  SYT_ACIB3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  37%  642 aa  SYT_SHESR RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  37%  642 aa  SYT_SHEON RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-117  36%  640 aa  SYT_PROMM RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  37%  642 aa  SYT_SHESM RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  37%  642 aa  SYT_SHESA RecName: Full=Threonyl-tRNA synthetase;       
    4::637     e-117  37%  640 aa  SYT_PSESM RecName: Full=Threonyl-tRNA synthetase;       
    4::628     e-117  37%  643 aa  SYT_HAEDU RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-117  37%  642 aa  SYT_ERWT9 RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-117  37%  640 aa  SYT_ACIB5 RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-116  36%  632 aa  SYT_RUTMC RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-116  36%  637 aa  SYT_NEIM0 RecName: Full=Threonyl-tRNA synthetase;       
   60::634     e-116  40%  647 aa  SYT_DESDA RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-116  37%  640 aa  SYT_ACIBS RecName: Full=Threonyl-tRNA synthetase;       
    2::618     e-116  37%  635 aa  SYT_JANMA RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-116  37%  642 aa  SYT_EDWI9 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-116  37%  642 aa  SYT_TOLAT RecName: Full=Threonyl-tRNA synthetase;       
    2::615     e-116  37%  637 aa  SYT_THIDA RecName: Full=Threonyl-tRNA synthetase;       
   10::600     e-116  38%  603 aa  SYT_SYNY3 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-116  36%  642 aa  SYT_SHEB9 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-116  36%  642 aa  SYT_SHEB8 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-116  36%  642 aa  SYT_SHEB5 RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-116  36%  642 aa  SYT_SHEB2 RecName: Full=Threonyl-tRNA synthetase;       
    4::620     e-116  37%  638 aa  SYT_PELUB RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-116  36%  637 aa  SYT_NEIG1 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-116  37%  642 aa  SYT_SHEFN RecName: Full=Threonyl-tRNA synthetase;       
    4::638     e-116  36%  640 aa  SYT_DICNV RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-116  36%  640 aa  SYT_ACIAD RecName: Full=Threonyl-tRNA synthetase;       
    4::633     e-116  37%  643 aa  SYT_ACTPJ RecName: Full=Threonyl-tRNA synthetase;       
    4::633     e-116  37%  643 aa  SYT_ACTP7 RecName: Full=Threonyl-tRNA synthetase;       
   41::642     e-116  39%  684 aa  SYT_MYCA1 RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-116  38%  633 aa  SYT_EHRRW RecName: Full=Threonyl-tRNA synthetase;       
    5::652     e-116  38%  672 aa  SYT_ERYLH RecName: Full=Threonyl-tRNA synthetase;       
    2::613     e-116  38%  633 aa  SYT_EHRRG RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-115  37%  639 aa  SYT_ACISJ RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  36%  642 aa  SYT_SHEDO RecName: Full=Threonyl-tRNA synthetase;       
    1::629     e-115  39%  658 aa  SYT_FRASN RecName: Full=Threonyl-tRNA synthetase;       
    4::631     e-115  36%  642 aa  SYT_PHOLL RecName: Full=Threonyl-tRNA synthetase;       
   39::656     e-115  39%  684 aa  SYT_MYCA9 RecName: Full=Threonyl-tRNA synthetase;       
    2::629     e-115  37%  635 aa  SYT_HERAR RecName: Full=Threonyl-tRNA synthetase;       
   32::666     e-115  41%  669 aa  SYT_ARTS2 RecName: Full=Threonyl-tRNA synthetase;       
    2::635     e-115  37%  639 aa  SYT_DIAST RecName: Full=Threonyl-tRNA synthetase;       
    2::631     e-115  36%  635 aa  SYT_VARPS RecName: Full=Threonyl-tRNA synthetase;       
   26::622     e-115  39%  637 aa  SYT_NEOSM RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-115  36%  642 aa  SYT_SHEAM RecName: Full=Threonyl-tRNA synthetase;       
   41::642     e-115  39%  684 aa  SYT_MYCPA RecName: Full=Threonyl-tRNA synthetase;       
    2::625     e-114  36%  635 aa  SYT_XYLFT RecName: Full=Threonyl-tRNA synthetase;       
    2::625     e-114  36%  635 aa  SYT_XYLF2 RecName: Full=Threonyl-tRNA synthetase;       
    4::595     e-114  39%  638 aa  SYT_AZOSE RecName: Full=Threonyl-tRNA synthetase;       
    2::625     e-114  36%  635 aa  SYT_XYLFM RecName: Full=Threonyl-tRNA synthetase;       
   38::642     e-114  41%  672 aa  SYT_MICLC RecName: Full=Threonyl-tRNA synthetase;       
    2::625     e-114  36%  635 aa  SYT_XYLFA RecName: Full=Threonyl-tRNA synthetase;       
    4::632     e-114  35%  642 aa  SYT_SHEHH RecName: Full=Threonyl-tRNA synthetase;       
    2::599     e-113  38%  635 aa  SYT_POLSJ RecName: Full=Threonyl-tRNA synthetase;       
    7::612     e-113  37%  650 aa  SYT_PARUW RecName: Full=Threonyl-tRNA synthetase;       
   32::666     e-113  40%  669 aa  SYT_ARTCA RecName: Full=Threonyl-tRNA synthetase;       
   31::589     e-113  40%  617 aa  SYT_SYNS3 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-113  36%  642 aa  SYT_SHELP RecName: Full=Threonyl-tRNA synthetase;       
   41::656     e-113  39%  684 aa  SYT_MYCSS RecName: Full=Threonyl-tRNA synthetase;       
   41::656     e-113  39%  684 aa  SYT_MYCSK RecName: Full=Threonyl-tRNA synthetase;       
   41::656     e-113  39%  684 aa  SYT_MYCSJ RecName: Full=Threonyl-tRNA synthetase;       
   26::572     e-112  40%  605 aa  SYT_THEEB RecName: Full=Threonyl-tRNA synthetase;       
    2::603     e-112  38%  637 aa  SYT_LEPCP RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-112  38%  677 aa  SYT_BIFLO RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-112  38%  677 aa  SYT_BIFLD RecName: Full=Threonyl-tRNA synthetase;       
   23::654     e-112  38%  694 aa  SYT_COREF RecName: Full=Threonyl-tRNA synthetase;       
   49::650     e-112  40%  692 aa  SYT_MYCTU RecName: Full=Threonyl-tRNA synthetase;       
   49::650     e-112  40%  692 aa  SYT_MYCTA RecName: Full=Threonyl-tRNA synthetase;       
   49::650     e-112  40%  692 aa  SYT_MYCBT RecName: Full=Threonyl-tRNA synthetase;       
   49::650     e-112  40%  692 aa  SYT_MYCBP RecName: Full=Threonyl-tRNA synthetase;       
   49::650     e-112  40%  692 aa  SYT_MYCBO RecName: Full=Threonyl-tRNA synthetase;       
   59::644     e-111  40%  695 aa  SYT_MYCGI RecName: Full=Threonyl-tRNA synthetase;       
   33::630     e-111  39%  659 aa  SYT_THEFY RecName: Full=Threonyl-tRNA synthetase;       
    4::636     e-111  38%  677 aa  SYT_BIFLI RecName: Full=Threonyl-tRNA synthetase;       
   32::666     e-111  40%  669 aa  SYT_ARTAT RecName: Full=Threonyl-tRNA synthetase;       
    5::650     e-111  38%  667 aa  SYT_SPHAL RecName: Full=Threonyl-tRNA synthetase;       
   31::577     e-111  40%  611 aa  SYT_SYNS9 RecName: Full=Threonyl-tRNA synthetase;       
    1::625     e-111  38%  668 aa  SYT_NOCSJ RecName: Full=Threonyl-tRNA synthetase;       
   26::610     e-111  38%  611 aa  SYT_NAUPA RecName: Full=Threonyl-tRNA synthetase;       
    7::630     e-111  37%  635 aa  SYT_CHLAB RecName: Full=Threonyl-tRNA synthetase;       
   19::568     e-110  40%  583 aa  SYT_BORHD RecName: Full=Threonyl-tRNA synthetase;       
   37::660     e-110  39%  695 aa  SYT_LEIXX RecName: Full=Threonyl-tRNA synthetase;       
    2::595     e-110  37%  602 aa  SYT_CAMJ8 RecName: Full=Threonyl-tRNA synthetase;       
   16::630     e-110  36%  635 aa  SYT_CHLPN RecName: Full=Threonyl-tRNA synthetase;       
    2::595     e-110  37%  602 aa  SYT_CAMJR RecName: Full=Threonyl-tRNA synthetase;       
   21::655     e-110  39%  660 aa  SYT_THEVO RecName: Full=Threonyl-tRNA synthetase;       
    2::638     e-110  37%  659 aa  SYT_CAUSK RecName: Full=Threonyl-tRNA synthetase;       
    5::596     e-110  38%  609 aa  SYT_CAMHC RecName: Full=Threonyl-tRNA synthetase;       
    4::627     e-110  36%  658 aa  SYT_BARQU RecName: Full=Threonyl-tRNA synthetase;       
    2::595     e-110  37%  602 aa  SYT_CAMJE RecName: Full=Threonyl-tRNA synthetase;       
    4::609     e-109  36%  642 aa  SYT_SODGM RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-109  36%  642 aa  SYT_AERHH RecName: Full=Threonyl-tRNA synthetase;       
   11::659     e-109  37%  692 aa  SYT_BIFA0 RecName: Full=Threonyl-tRNA synthetase;       
   41::656     e-109  39%  684 aa  SYT_MYCS2 RecName: Full=Threonyl-tRNA synthetase;       
    2::595     e-109  37%  602 aa  SYT_CAMJJ RecName: Full=Threonyl-tRNA synthetase;       
   19::568     e-109  40%  583 aa  SYT_BORDL RecName: Full=Threonyl-tRNA synthetase;       
    4::634     e-109  34%  638 aa  SYT_HAMD5 RecName: Full=Threonyl-tRNA synthetase;       
   51::655     e-108  38%  695 aa  SYT_CORGL RecName: Full=Threonyl-tRNA synthetase;       
    2::595     e-108  37%  602 aa  SYT_CAMJD RecName: Full=Threonyl-tRNA synthetase;       
   19::568     e-108  40%  583 aa  SYT_BORRA RecName: Full=Threonyl-tRNA synthetase;       
    4::639     e-108  35%  642 aa  SYT_AERS4 RecName: Full=Threonyl-tRNA synthetase;       
   31::577     e-108  40%  611 aa  SYT_SYNSC RecName: Full=Threonyl-tRNA synthetase;       
   47::647     e-108  38%  687 aa  SYT_CORDI RecName: Full=Threonyl-tRNA synthetase;       
    5::601     e-108  36%  606 aa  SYT_CAMC5 RecName: Full=Threonyl-tRNA synthetase;       
    5::601     e-108  37%  606 aa  SYT_CAMC1 RecName: Full=Threonyl-tRNA synthetase;       
    6::568     e-108  39%  583 aa  SYT_BORT9 RecName: Full=Threonyl-tRNA synthetase;       
    6::561     e-108  38%  581 aa  SYT_BORAP RecName: Full=Threonyl-tRNA synthetase;       
   48::649     e-107  38%  691 aa  SYT_MYCUA RecName: Full=Threonyl-tRNA synthetase;       
   47::647     e-107  38%  687 aa  SYT_CORA7 RecName: Full=Threonyl-tRNA synthetase;       
   48::649     e-107  38%  691 aa  SYT_MYCMM RecName: Full=Threonyl-tRNA synthetase;       
   42::649     e-107  37%  691 aa  SYT_CORJK RecName: Full=Threonyl-tRNA synthetase;       
    2::603     e-107  36%  639 aa  SYT_VEREI RecName: Full=Threonyl-tRNA synthetase;       
   32::642     e-107  39%  684 aa  SYT_PROAC RecName: Full=Threonyl-tRNA synthetase;       
   46::646     e-107  38%  691 aa  SYT_MYCVP RecName: Full=Threonyl-tRNA synthetase;       
    4::623     e-107  36%  633 aa  SYT_LARHH RecName: Full=Threonyl-tRNA synthetase;       
    7::630     e-107  35%  635 aa  SYT_CHLCV RecName: Full=Threonyl-tRNA synthetase;       
   34::577     e-106  39%  611 aa  SYT_SYNPX RecName: Full=Threonyl-tRNA synthetase;       
   33::611     e-106  38%  612 aa  SYT_HELPH RecName: Full=Threonyl-tRNA synthetase;       
   82::688     e-106  37%  725 aa  SYTC_CAEEL RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   59::660     e-106  38%  702 aa  SYT_MYCLE RecName: Full=Threonyl-tRNA synthetase;       
   59::660     e-106  38%  702 aa  SYT_MYCLB RecName: Full=Threonyl-tRNA synthetase;       
   33::611     e-106  38%  612 aa  SYT_HELP2 RecName: Full=Threonyl-tRNA synthetase;       
   83::689     e-105  36%  723 aa  SYTC_BOVIN RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
    1::598     e-105  36%  603 aa  SYT_CAMLR RecName: Full=Threonyl-tRNA synthetase;       
   33::611     e-105  38%  612 aa  SYT_HELPY RecName: Full=Threonyl-tRNA synthetase;       
   31::577     e-105  39%  610 aa  SYT_SYNPW RecName: Full=Threonyl-tRNA synthetase;       
    7::630     e-105  36%  635 aa  SYT_CHLFF RecName: Full=Threonyl-tRNA synthetase;       
   45::643     e-105  38%  685 aa  SYT_RHOE4 RecName: Full=Threonyl-tRNA synthetase;       
   34::611     e-105  38%  612 aa  SYT_HELPG RecName: Full=Threonyl-tRNA synthetase;       
   83::689     e-105  36%  723 aa  SYTC_HUMAN RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   34::611     e-105  38%  612 aa  SYT_HELAH RecName: Full=Threonyl-tRNA synthetase;       
   33::611     e-104  37%  612 aa  SYT_HELPS RecName: Full=Threonyl-tRNA synthetase;       
   55::661     e-104  36%  695 aa  SYTC_RAT RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;      
    6::575     e-104  37%  581 aa  SYT_BORBZ RecName: Full=Threonyl-tRNA synthetase;       
    6::575     e-104  37%  581 aa  SYT_BORBU RecName: Full=Threonyl-tRNA synthetase;       
   13::591     e-104  36%  604 aa  SYT_SULNB RecName: Full=Threonyl-tRNA synthetase;       
   21::652     e-104  37%  660 aa  SYT_THEAC RecName: Full=Threonyl-tRNA synthetase;       
    7::563     e-104  37%  564 aa  SYT_MYCPN RecName: Full=Threonyl-tRNA synthetase;       
   34::611     e-104  37%  612 aa  SYT_HELPJ RecName: Full=Threonyl-tRNA synthetase;       
   82::688     e-104  36%  722 aa  SYTC_MOUSE RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   12::630     e-103  35%  635 aa  SYT_CHLTB RecName: Full=Threonyl-tRNA synthetase;       
   12::630     e-103  35%  635 aa  SYT_CHLT2 RecName: Full=Threonyl-tRNA synthetase;       
   43::630     e-103  36%  635 aa  SYT_CHLTR RecName: Full=Threonyl-tRNA synthetase;       
   43::630     e-103  36%  635 aa  SYT_CHLTA RecName: Full=Threonyl-tRNA synthetase;       
   14::600     e-102  37%  640 aa  SYT_TROWT RecName: Full=Threonyl-tRNA synthetase;       
   14::600     e-102  37%  640 aa  SYT_TROW8 RecName: Full=Threonyl-tRNA synthetase;       
  180::768     e-101  36%  802 aa  SYTC2_HUMAN RecName: Full=Probable threonyl-tRNA synthetase 2,
   40::643     e-101  37%  685 aa  SYT_RHOSR RecName: Full=Threonyl-tRNA synthetase;       
   13::632     e-101  32%  636 aa  SYT_WIGBR RecName: Full=Threonyl-tRNA synthetase;       
   75::697     e-100  36%  734 aa  SYTC_YEAST RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   19::536     e-100  38%  582 aa  SYT_BORGA RecName: Full=Threonyl-tRNA synthetase;       
    4::614     e-100  34%  642 aa  SYT_BAUCH RecName: Full=Threonyl-tRNA synthetase;       
  174::809     e-100  35%  814 aa  SYTC2_XENTR RecName: Full=Probable threonyl-tRNA synthetase 2,
    4::637     e-100  34%  643 aa  SYT_BUCBP RecName: Full=Threonyl-tRNA synthetase;       
   75::682     e-100  34%  709 aa  SYTM_ARATH RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   43::622     4e-99  36%  635 aa  SYT_CHLMU RecName: Full=Threonyl-tRNA synthetase;       
   49::673     1e-98  36%  703 aa  SYTC_SCHPO RecName: Full=Threonyl-tRNA synthetase, cytoplasmic;    
   33::591     2e-98  36%  604 aa  SYT_HELHP RecName: Full=Threonyl-tRNA synthetase;       
  168::756     3e-98  35%  790 aa  SYTC2_MOUSE RecName: Full=Probable threonyl-tRNA synthetase 2,
   40::643     6e-97  36%  685 aa  SYT_RHOOB RecName: Full=Threonyl-tRNA synthetase;       
    4::609     6e-97  34%  642 aa  SYT_BUCA5 RecName: Full=Threonyl-tRNA synthetase;       
    4::609     8e-97  34%  642 aa  SYT_BUCAI RecName: Full=Threonyl-tRNA synthetase;       
    4::609     2e-96  33%  642 aa  SYT_BUCAT RecName: Full=Threonyl-tRNA synthetase;       
   16::557     7e-96  37%  564 aa  SYT_MYCGE RecName: Full=Threonyl-tRNA synthetase;       
   65::710     3e-94  35%  723 aa  SYTM_RAT RecName: Full=Threonyl-tRNA synthetase, mitochondrial;    
   76::675     4e-94  33%  710 aa  SYTC1_DICDI RecName: Full=Probable threonyl-tRNA synthetase 1,
    4::609     3e-93  32%  642 aa  SYT_BUCAP RecName: Full=Threonyl-tRNA synthetase;       
   65::710     2e-91  34%  723 aa  SYTM_MOUSE RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
    5::581     2e-91  33%  585 aa  SYT_TREDE RecName: Full=Threonyl-tRNA synthetase;       
   16::563     8e-90  34%  592 aa  SYT_TREPS RecName: Full=Threonyl-tRNA synthetase;       
   16::563     8e-90  34%  592 aa  SYT_TREPA RecName: Full=Threonyl-tRNA synthetase;       
  160::703     4e-89  34%  724 aa  SYTC2_BOVIN RecName: Full=Probable threonyl-tRNA synthetase 2,
   60::684     5e-87  33%  718 aa  SYTM_HUMAN RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   83::528     6e-85  39%  540 aa  SYT_SULTO RecName: Full=Threonyl-tRNA synthetase;       
    7::531     6e-85  36%  545 aa  SYT_SULIM RecName: Full=Threonyl-tRNA synthetase;       
    7::531     6e-85  36%  545 aa  SYT_SULIA RecName: Full=Threonyl-tRNA synthetase;       
    7::531     1e-84  36%  545 aa  SYT_SULIK RecName: Full=Threonyl-tRNA synthetase;       
   50::537     1e-84  36%  549 aa  SYT_SULAC RecName: Full=Threonyl-tRNA synthetase;       
    7::531     4e-84  36%  545 aa  SYT_SULSO RecName: Full=Threonyl-tRNA synthetase;       
    7::531     4e-84  36%  545 aa  SYT_SULIY RecName: Full=Threonyl-tRNA synthetase;       
    7::531     4e-84  36%  545 aa  SYT_SULIN RecName: Full=Threonyl-tRNA synthetase;       
    7::531     5e-84  36%  545 aa  SYT_SULIL RecName: Full=Threonyl-tRNA synthetase;       
   38::533     4e-82  36%  541 aa  SYT_METS5 RecName: Full=Threonyl-tRNA synthetase;       
   46::689     2e-73  33%  698 aa  SYTC2_DICDI RecName: Full=Probable threonyl-tRNA synthetase 2,
   41::461     4e-64  36%  462 aa  SYTM_YEAST RecName: Full=Threonyl-tRNA synthetase, mitochondrial;  
   17::343     2e-62  37%  743 aa  SYT_RHOBA RecName: Full=Threonyl-tRNA synthetase;       
   39::472     7e-56  32%  473 aa  SYTM_SCHPO RecName: Full=Probable threonyl-tRNA synthetase,
  161::427     4e-45  37%  458 aa  SYTC_ARATH RecName: Full=Probable threonyl-tRNA synthetase,
  154::600     3e-38  29%  621 aa  SYT_NITMS RecName: Full=Threonyl-tRNA synthetase;       
  164::594     1e-36  30%  635 aa  SYT_METBF RecName: Full=Threonyl-tRNA synthetase;       
  190::581     3e-36  31%  611 aa  SYT_METMJ RecName: Full=Threonyl-tRNA synthetase;       
  189::582     5e-36  30%  626 aa  SYT_PYRKO RecName: Full=Threonyl-tRNA synthetase;       
  176::571     5e-36  29%  614 aa  SYT_METST RecName: Full=Threonyl-tRNA synthetase;       
  190::576     5e-36  31%  608 aa  SYT_METS3 RecName: Full=Threonyl-tRNA synthetase;       
  189::587     1e-35  31%  626 aa  SYT_THEGJ RecName: Full=Threonyl-tRNA synthetase;       
  198::573     9e-35  30%  624 aa  SYT_METKA RecName: Full=Threonyl-tRNA synthetase;       
  164::600     1e-34  28%  635 aa  SYT_METAC RecName: Full=Threonyl-tRNA synthetase;       
  190::592     2e-34  30%  627 aa  SYT_THEON RecName: Full=Threonyl-tRNA synthetase;       
  202::590     2e-34  30%  619 aa  SYT_METTP RecName: Full=Threonyl-tRNA synthetase;       
  230::586     6e-34  31%  625 aa  SYT_THESM RecName: Full=Threonyl-tRNA synthetase;       
    1::224     8e-34  36%  227 aa  SYT_PSESY RecName: Full=Threonyl-tRNA synthetase;       
  182::575     8e-34  33%  622 aa  SYT_METMP RecName: Full=Threonyl-tRNA synthetase;       
  188::586     3e-33  29%  625 aa  SYT_PYRAB RecName: Full=Threonyl-tRNA synthetase;       
  197::614     4e-33  28%  635 aa  SYT_METBU RecName: Full=Threonyl-tRNA synthetase;       
  193::575     2e-32  30%  622 aa  SYT_METM6 RecName: Full=Threonyl-tRNA synthetase;       
  204::578     3e-32  29%  619 aa  SYT_ARCFU RecName: Full=Threonyl-tRNA synthetase;       
  188::586     5e-32  28%  625 aa  SYT_PYRHO RecName: Full=Threonyl-tRNA synthetase;       
  182::572     2e-31  29%  622 aa  SYT_METM7 RecName: Full=Threonyl-tRNA synthetase;       
  207::591     2e-31  28%  614 aa  SYT_METB6 RecName: Full=Threonyl-tRNA synthetase;       
  203::586     4e-31  29%  625 aa  SYT_PYRFU RecName: Full=Threonyl-tRNA synthetase;       
  195::569     6e-31  29%  605 aa  SYT_METTH RecName: Full=Threonyl-tRNA synthetase;       
  193::575     1e-30  30%  622 aa  SYT_METM5 RecName: Full=Threonyl-tRNA synthetase;       
  201::603     1e-30  28%  641 aa  SYT_UNCMA RecName: Full=Threonyl-tRNA synthetase;       
   38::421     1e-30  29%  471 aa  SYT1_AERPE RecName: Full=Probable threonyl-tRNA synthetase 1;      
  203::581     7e-30  29%  609 aa  SYT_METPE RecName: Full=Threonyl-tRNA synthetase;       
  205::584     7e-30  30%  630 aa  SYT_META3 RecName: Full=Threonyl-tRNA synthetase;       
  278::595     9e-30  34%  614 aa  SYT_STAMF RecName: Full=Threonyl-tRNA synthetase;       
  280::600     2e-29  28%  625 aa  SYT_HYPBU RecName: Full=Threonyl-tRNA synthetase;       
  187::598     1e-27  28%  620 aa  SYT_METJA RecName: Full=Threonyl-tRNA synthetase;       
  163::584     2e-27  26%  634 aa  SYT_METMA RecName: Full=Threonyl-tRNA synthetase;       
  197::580     2e-27  27%  615 aa  SYT_CENSY RecName: Full=Threonyl-tRNA synthetase;       
  301::591     9e-27  28%  609 aa  SYT_PYRIL RecName: Full=Threonyl-tRNA synthetase;       
  275::591     2e-26  29%  608 aa  SYT_THEPD RecName: Full=Threonyl-tRNA synthetase;       
  299::568     8e-26  29%  607 aa  SYT_PYRCJ RecName: Full=Threonyl-tRNA synthetase;       
  208::568     2e-25  26%  608 aa  SYT_PYRAR RecName: Full=Threonyl-tRNA synthetase;       
  283::598     2e-25  28%  613 aa  SYT_CALMQ RecName: Full=Threonyl-tRNA synthetase;       
  204::573     1e-24  29%  610 aa  SYT_METHJ RecName: Full=Threonyl-tRNA synthetase;       
  300::568     2e-24  29%  608 aa  SYT_PYRAE RecName: Full=Threonyl-tRNA synthetase;       
  301::556     1e-21  27%  609 aa  SYT_THENV RecName: Full=Threonyl-tRNA synthetase;       
  193::572     3e-21  27%  622 aa  SYT_METVS RecName: Full=Threonyl-tRNA synthetase;       
  451::595     4e-21  35%  633 aa  SYT_NANEQ RecName: Full=Threonyl-tRNA synthetase;       
   37::425     1e-16  25%  451 aa  SYP_ROSDO RecName: Full=Prolyl-tRNA synthetase;       
   38::380     6e-16  28%  481 aa  SYP_CALMQ RecName: Full=Prolyl-tRNA synthetase;       
   37::425     9e-16  26%  464 aa  SYP_SILPO RecName: Full=Prolyl-tRNA synthetase;       
   42::358     5e-15  30%  478 aa  SYP_METBU RecName: Full=Prolyl-tRNA synthetase;       
   37::425     5e-14  26%  450 aa  SYP_PARDP RecName: Full=Prolyl-tRNA synthetase;       
   37::427     3e-13  26%  445 aa  SYP_RHOS4 RecName: Full=Prolyl-tRNA synthetase;       
   79::292     3e-13  30%  333 aa  RM39_DROME RecName: Full=39S ribosomal protein L39, mitochondrial; 
   37::427     3e-13  26%  445 aa  SYP_RHOSK RecName: Full=Prolyl-tRNA synthetase;       
   37::427     3e-13  26%  445 aa  SYP_RHOS1 RecName: Full=Prolyl-tRNA synthetase;       
   38::434     1e-12  26%  440 aa  SYP_RHILW RecName: Full=Prolyl-tRNA synthetase;       
   40::369     2e-12  25%  487 aa  SYP_THENV RecName: Full=Prolyl-tRNA synthetase;       
   37::427     2e-12  26%  445 aa  SYP_RHOS5 RecName: Full=Prolyl-tRNA synthetase;       
   42::398     2e-12  27%  482 aa  SYP_METTH RecName: Full=Prolyl-tRNA synthetase;       
   37::423     3e-12  25%  427 aa  SYP_RICFE RecName: Full=Prolyl-tRNA synthetase;       
   37::432     3e-12  31%  440 aa  SYP_GRABC RecName: Full=Prolyl-tRNA synthetase;       
   36::165     4e-12  32%  613 aa  SYP_TROWT RecName: Full=Prolyl-tRNA synthetase;       
   36::165     4e-12  32%  601 aa  SYP_TROW8 RecName: Full=Prolyl-tRNA synthetase;       
   35::540     6e-12  32%  564 aa  SYP_SULSY RecName: Full=Prolyl-tRNA synthetase;       
   36::435     6e-12  24%  442 aa  SYP_RHILO RecName: Full=Prolyl-tRNA synthetase;       
   41::370     8e-12  26%  488 aa  SYP_PYRAE RecName: Full=Prolyl-tRNA synthetase;       
   34::552     8e-12  31%  567 aa  SYP_IDILO RecName: Full=Prolyl-tRNA synthetase;       
   37::427     1e-11  25%  451 aa  SYP_SILST RecName: Full=Prolyl-tRNA synthetase;       
   41::370     1e-11  26%  488 aa  SYP_PYRAR RecName: Full=Prolyl-tRNA synthetase;       
   37::422     2e-11  25%  438 aa  SYP_RICCK RecName: Full=Prolyl-tRNA synthetase;       
   34::569     2e-11  29%  577 aa  SYP_THESQ RecName: Full=Prolyl-tRNA synthetase;       
   34::569     2e-11  30%  577 aa  SYP_THEP1 RecName: Full=Prolyl-tRNA synthetase;       
   34::178     2e-11  30%  577 aa  SYP_THENN RecName: Full=Prolyl-tRNA synthetase;       
   34::569     2e-11  30%  577 aa  SYP_THEMA RecName: Full=Prolyl-tRNA synthetase;       
   34::419     2e-11  32%  439 aa  SYP_PARL1 RecName: Full=Prolyl-tRNA synthetase;       
   37::544     2e-11  29%  584 aa  SYP_MYCSS RecName: Full=Prolyl-tRNA synthetase;       
   37::544     2e-11  29%  584 aa  SYP_MYCSK RecName: Full=Prolyl-tRNA synthetase;       
   34::556     2e-11  29%  570 aa  SYP_CLOB8 RecName: Full=Prolyl-tRNA synthetase;       
   34::573     3e-11  28%  578 aa  SYP_SYNAS RecName: Full=Prolyl-tRNA synthetase;       
   37::415     4e-11  29%  435 aa  SYP_RHORT RecName: Full=Prolyl-tRNA synthetase;       
   49::392     4e-11  25%  499 aa  SYP_DEIRA RecName: Full=Prolyl-tRNA synthetase;       
   47::390     4e-11  24%  497 aa  SYP_DEIGD RecName: Full=Prolyl-tRNA synthetase;       
   37::422     4e-11  25%  437 aa  SYP_ACICJ RecName: Full=Prolyl-tRNA synthetase;       
   38::172     5e-11  27%  595 aa  SYP_TREDE RecName: Full=Prolyl-tRNA synthetase;       
   34::554     5e-11  27%  574 aa  SYP_RALSO RecName: Full=Prolyl-tRNA synthetase;       
   11::558     7e-11  30%  560 aa  SYP_VESOH RecName: Full=Prolyl-tRNA synthetase;       
   34::172     7e-11  31%  575 aa  SYP_THELT RecName: Full=Prolyl-tRNA synthetase;       
   34::185     7e-11  28%  573 aa  SYP_MOOTA RecName: Full=Prolyl-tRNA synthetase;       
   37::423     9e-11  24%  427 aa  SYP_RICAH RecName: Full=Prolyl-tRNA synthetase;       
   34::544     9e-11  31%  571 aa  SYP_PROMH RecName: Full=Prolyl-tRNA synthetase;       
   34::191     9e-11  27%  586 aa  SYP_LEPBP RecName: Full=Prolyl-tRNA synthetase;       
   34::191     9e-11  27%  586 aa  SYP_LEPBA RecName: Full=Prolyl-tRNA synthetase;       
   37::427     1e-10  23%  432 aa  SYP_RICBR RecName: Full=Prolyl-tRNA synthetase;       
   37::427     1e-10  23%  432 aa  SYP_RICB8 RecName: Full=Prolyl-tRNA synthetase;       
   26::354     1e-10  26%  469 aa  SYP_METST RecName: Full=Prolyl-tRNA synthetase;       
   34::555     1e-10  33%  577 aa  SYP_MARAV RecName: Full=Prolyl-tRNA synthetase;       
   34::548     1e-10  29%  574 aa  SYP_DESDA RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-10  28%  437 aa  SYP_SPHWW RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-10  28%  576 aa  SYP_FINM2 RecName: Full=Prolyl-tRNA synthetase;       
   34::421     2e-10  20%  426 aa  SYP_EHRRG RecName: Full=Prolyl-tRNA synthetase;       
   36::165     2e-10  28%  603 aa  SYP_ARTS2 RecName: Full=Prolyl-tRNA synthetase;       
   40::432     2e-10  22%  436 aa  SYP_NEOSM RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-10  29%  438 aa  SYP_GLUOX RecName: Full=Prolyl-tRNA synthetase;       
   34::544     3e-10  29%  574 aa  SYP_RALPJ RecName: Full=Prolyl-tRNA synthetase;       
   34::544     3e-10  32%  572 aa  SYP_PHOLL RecName: Full=Prolyl-tRNA synthetase;       
   34::163     3e-10  27%  581 aa  SYP_KOSOT RecName: Full=Prolyl-tRNA synthetase;       
   36::186     3e-10  29%  439 aa  SYP_HYPNA RecName: Full=Prolyl-tRNA synthetase;       
   34::536     3e-10  32%  565 aa  SYP_HYDS0 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-10  28%  572 aa  SYP_ERWCT RecName: Full=Prolyl-tRNA synthetase;       
   34::551     3e-10  30%  575 aa  SYP_DESHY RecName: Full=Prolyl-tRNA synthetase;       
   34::551     3e-10  30%  575 aa  SYP_DESHD RecName: Full=Prolyl-tRNA synthetase;       
   34::567     3e-10  28%  570 aa  SYP_CLOTE RecName: Full=Prolyl-tRNA synthetase;       
   41::370     3e-10  26%  488 aa  SYP_PYRIL RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-10  28%  441 aa  SYP_OLICO RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-10  26%  444 aa  SYP_MARMM RecName: Full=Prolyl-tRNA synthetase;       
   40::169     3e-10  29%  590 aa  SYP_LEIXX RecName: Full=Prolyl-tRNA synthetase;       
   34::163     3e-10  28%  445 aa  SYP_DINSH RecName: Full=Prolyl-tRNA synthetase;       
   31::361     3e-10  30%  471 aa  SYP_ARCFU RecName: Full=Prolyl-tRNA synthetase;       
   35::570     3e-10  24%  571 aa  SYP_ACTSZ RecName: Full=Prolyl-tRNA synthetase;       
   34::166     5e-10  30%  602 aa  SYP_THEEB RecName: Full=Prolyl-tRNA synthetase;       
    8::544     5e-10  32%  571 aa  SYP_PSYIN RecName: Full=Prolyl-tRNA synthetase;       
   34::546     5e-10  26%  574 aa  SYP_HAHCH RecName: Full=Prolyl-tRNA synthetase;       
  117::378     5e-10  29%  492 aa  SYP_FLAJ1 RecName: Full=Prolyl-tRNA synthetase;       
   37::428     5e-10  27%  442 aa  SYP_BRUSI RecName: Full=Prolyl-tRNA synthetase;       
   37::428     5e-10  27%  442 aa  SYP_BRUO2 RecName: Full=Prolyl-tRNA synthetase;       
   37::428     5e-10  27%  442 aa  SYP_BRUC2 RecName: Full=Prolyl-tRNA synthetase;       
   34::572     6e-10  27%  574 aa  SYP_TERTT RecName: Full=Prolyl-tRNA synthetase;       
   37::194     6e-10  27%  585 aa  SYP_MYCVP RecName: Full=Prolyl-tRNA synthetase;       
   32::388     6e-10  27%  480 aa  SYP_METS5 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     6e-10  28%  452 aa  SYP_JANSC RecName: Full=Prolyl-tRNA synthetase;       
   35::571     6e-10  26%  572 aa  SYP_HAEIG RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPY RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPS RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPP RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPN RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPG RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPE RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPB RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERPA RecName: Full=Prolyl-tRNA synthetase;       
    8::555     8e-10  29%  572 aa  SYP_YERP3 RecName: Full=Prolyl-tRNA synthetase;       
   34::177     8e-10  28%  616 aa  SYP_LACLA RecName: Full=Prolyl-tRNA synthetase;       
   34::163     8e-10  32%  572 aa  SYP_KLEP3 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     8e-10  30%  568 aa  SYP_HALHL RecName: Full=Prolyl-tRNA synthetase;       
   34::201     8e-10  24%  581 aa  SYP_BLOFL RecName: Full=Prolyl-tRNA synthetase;       
   34::572     8e-10  30%  604 aa  SYP_ANASP RecName: Full=Prolyl-tRNA synthetase;       
   34::565     8e-10  30%  568 aa  SYP_ALHEH RecName: Full=Prolyl-tRNA synthetase;       
   40::535     1e-09  30%  567 aa  SYP_STRCO RecName: Full=Prolyl-tRNA synthetase;       
   37::422     1e-09  28%  439 aa  SYP_NITHX RecName: Full=Prolyl-tRNA synthetase;       
   66::386     1e-09  25%  476 aa  SYP_MYCMO RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-09  27%  616 aa  SYP_LACLS RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-09  27%  616 aa  SYP_LACLM RecName: Full=Prolyl-tRNA synthetase;       
   37::428     1e-09  27%  442 aa  SYP_BRUME RecName: Full=Prolyl-tRNA synthetase;       
   37::428     1e-09  27%  442 aa  SYP_BRUMB RecName: Full=Prolyl-tRNA synthetase;       
   37::428     1e-09  27%  442 aa  SYP_BRUAB RecName: Full=Prolyl-tRNA synthetase;       
   37::428     1e-09  27%  442 aa  SYP_BRUA2 RecName: Full=Prolyl-tRNA synthetase;       
   37::428     1e-09  27%  442 aa  SYP_BRUA1 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     1e-09  28%  444 aa  SYP_BRASO RecName: Full=Prolyl-tRNA synthetase;       
   34::572     1e-09  30%  604 aa  SYP_ANAVT RecName: Full=Prolyl-tRNA synthetase;       
   35::193     1e-09  28%  572 aa  SYP_THICR RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-09  26%  573 aa  SYP_THETN RecName: Full=Prolyl-tRNA synthetase;       
   34::533     1e-09  35%  559 aa  SYP_RUTMC RecName: Full=Prolyl-tRNA synthetase;       
    8::571     1e-09  28%  571 aa  SYP_PSEA6 RecName: Full=Prolyl-tRNA synthetase;       
   34::571     1e-09  28%  572 aa  SYP_PECCP RecName: Full=Prolyl-tRNA synthetase;       
   37::434     1e-09  27%  442 aa  SYP_OCHA4 RecName: Full=Prolyl-tRNA synthetase;       
   36::169     1e-09  26%  608 aa  SYP_MICLC RecName: Full=Prolyl-tRNA synthetase;       
   34::547     1e-09  28%  576 aa  SYP_MAGSM RecName: Full=Prolyl-tRNA synthetase;       
   34::556     1e-09  32%  575 aa  SYP_LAWIP RecName: Full=Prolyl-tRNA synthetase;       
   34::555     1e-09  31%  572 aa  SYP_KLEP7 RecName: Full=Prolyl-tRNA synthetase;       
   34::579     1e-09  26%  579 aa  SYP_HAMD5 RecName: Full=Prolyl-tRNA synthetase;       
  117::388     1e-09  30%  492 aa  SYP_GRAFK RecName: Full=Prolyl-tRNA synthetase;       
   34::193     1e-09  27%  569 aa  SYP_DESRM RecName: Full=Prolyl-tRNA synthetase;       
   34::551     1e-09  29%  567 aa  SYP_CAMFF RecName: Full=Prolyl-tRNA synthetase;       
   37::163     1e-09  29%  440 aa  SYP_AZOC5 RecName: Full=Prolyl-tRNA synthetase;       
   38::558     1e-09  29%  564 aa  SYP1_STRAW RecName: Full=Prolyl-tRNA synthetase 1;       
   34::571     2e-09  28%  572 aa  SYP_YERE8 RecName: Full=Prolyl-tRNA synthetase;       
   37::432     2e-09  27%  439 aa  SYP_RHOPB RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-09  28%  439 aa  SYP_NITWN RecName: Full=Prolyl-tRNA synthetase;       
   25::372     2e-09  28%  460 aa  SYP_METM7 RecName: Full=Prolyl-tRNA synthetase;       
   35::571     2e-09  24%  572 aa  SYP_HAEIE RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ESCF3 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  32%  572 aa  SYP_ENTS8 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECOUT RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECOSM RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECOL6 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECOL5 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECOK1 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECO81 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECO45 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECO27 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-09  28%  444 aa  SYP_BRASB RecName: Full=Prolyl-tRNA synthetase;       
   34::405     2e-09  25%  426 aa  SYP_ANAPZ RecName: Full=Prolyl-tRNA synthetase;       
   37::439     2e-09  31%  440 aa  SYP_AGRT5 RecName: Full=Prolyl-tRNA synthetase;       
  132::354     2e-09  23%  427 aa  SYS_CHLT3 RecName: Full=Seryl-tRNA synthetase;       
   34::166     2e-09  28%  598 aa  SYP_SYNS3 RecName: Full=Prolyl-tRNA synthetase;       
   37::423     2e-09  23%  426 aa  SYP_RICPU RecName: Full=Prolyl-tRNA synthetase;       
   34::543     2e-09  30%  572 aa  SYP_PSYCK RecName: Full=Prolyl-tRNA synthetase;       
   34::556     2e-09  29%  574 aa  SYP_PSEHT RecName: Full=Prolyl-tRNA synthetase;       
   37::414     2e-09  28%  444 aa  SYP_PELUB RecName: Full=Prolyl-tRNA synthetase;       
   37::165     2e-09  28%  582 aa  SYP_MYCUA RecName: Full=Prolyl-tRNA synthetase;       
   36::165     2e-09  26%  586 aa  SYP_KINRD RecName: Full=Prolyl-tRNA synthetase;       
   34::570     2e-09  27%  574 aa  SYP_FERNB RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-09  30%  572 aa  SYP_ECO7I RecName: Full=Prolyl-tRNA synthetase;       
   34::564     2e-09  26%  570 aa  SYP_CLOPS RecName: Full=Prolyl-tRNA synthetase;       
   34::564     2e-09  27%  570 aa  SYP_CLOPE RecName: Full=Prolyl-tRNA synthetase;       
   34::564     2e-09  27%  570 aa  SYP_CLOP1 RecName: Full=Prolyl-tRNA synthetase;       
   34::540     2e-09  29%  566 aa  SYP_CAMC1 RecName: Full=Prolyl-tRNA synthetase;       
   37::432     2e-09  27%  439 aa  SYP_BRAJA RecName: Full=Prolyl-tRNA synthetase;       
    8::566     2e-09  27%  572 aa  SYP_ALTMD RecName: Full=Prolyl-tRNA synthetase;       
   35::570     2e-09  25%  571 aa  SYP_ACTP7 RecName: Full=Prolyl-tRNA synthetase;       
   35::570     2e-09  25%  571 aa  SYP_ACTP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHISS RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHIFL RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHIF8 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHIDS RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHIBS RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_SHIB3 RecName: Full=Prolyl-tRNA synthetase;       
   37::423     3e-09  23%  426 aa  SYP_RICCN RecName: Full=Prolyl-tRNA synthetase;       
   37::423     3e-09  23%  426 aa  SYP_RICAE RecName: Full=Prolyl-tRNA synthetase;       
   37::432     3e-09  27%  439 aa  SYP_RHOPS RecName: Full=Prolyl-tRNA synthetase;       
   37::432     3e-09  26%  439 aa  SYP_RHOP5 RecName: Full=Prolyl-tRNA synthetase;       
   37::432     3e-09  26%  439 aa  SYP_RHOP2 RecName: Full=Prolyl-tRNA synthetase;       
   41::370     3e-09  24%  487 aa  SYP_PYRCJ RecName: Full=Prolyl-tRNA synthetase;       
   34::543     3e-09  28%  572 aa  SYP_PSYA2 RecName: Full=Prolyl-tRNA synthetase;       
   38::399     3e-09  28%  480 aa  SYP_METMA RecName: Full=Prolyl-tRNA synthetase;       
   34::544     3e-09  31%  572 aa  SYP_EDWI9 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOSE RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOLU RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOLI RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOLC RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOHS RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECODH RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECOBW RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECO8A RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECO5E RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECO57 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECO55 RecName: Full=Prolyl-tRNA synthetase;       
   34::555     3e-09  30%  572 aa  SYP_ECO24 RecName: Full=Prolyl-tRNA synthetase;       
   37::428     3e-09  27%  442 aa  SYP_BRUSU RecName: Full=Prolyl-tRNA synthetase;       
   34::163     3e-09  28%  572 aa  SYP_ANATD RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-09  27%  425 aa  SYP_ANAMM RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-09  26%  571 aa  SYP_VIBFM RecName: Full=Prolyl-tRNA synthetase;       
   34::178     4e-09  26%  561 aa  SYP_THEAB RecName: Full=Prolyl-tRNA synthetase;       
   41::558     4e-09  31%  567 aa  SYP_STRGG RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALTY RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALTI RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALSV RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALPK RecName: Full=Prolyl-tRNA synthetase;       
   34::571     4e-09  28%  572 aa  SYP_SALPC RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALPB RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALPA RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALNS RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALHS RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALG2 RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALEP RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALDC RecName: Full=Prolyl-tRNA synthetase;       
   34::571     4e-09  28%  572 aa  SYP_SALCH RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALAR RecName: Full=Prolyl-tRNA synthetase;       
   34::554     4e-09  31%  572 aa  SYP_SALA4 RecName: Full=Prolyl-tRNA synthetase;       
    6::163     4e-09  29%  575 aa  SYP_SACD2 RecName: Full=Prolyl-tRNA synthetase;       
   37::423     4e-09  23%  426 aa  SYP_RICRS RecName: Full=Prolyl-tRNA synthetase;       
   37::423     4e-09  23%  426 aa  SYP_RICRO RecName: Full=Prolyl-tRNA synthetase;       
   37::432     4e-09  27%  438 aa  SYP_RHOPT RecName: Full=Prolyl-tRNA synthetase;       
   37::432     4e-09  27%  438 aa  SYP_RHOPA RecName: Full=Prolyl-tRNA synthetase;       
   36::574     4e-09  27%  585 aa  SYP_PROAC RecName: Full=Prolyl-tRNA synthetase;       
   36::165     4e-09  26%  606 aa  SYP_KOCRD RecName: Full=Prolyl-tRNA synthetase;       
   17::562     4e-09  26%  571 aa  SYP_HAEDU RecName: Full=Prolyl-tRNA synthetase;       
   34::555     4e-09  29%  572 aa  SYP_ERWT9 RecName: Full=Prolyl-tRNA synthetase;       
   34::549     4e-09  28%  575 aa  SYP_DESMR RecName: Full=Prolyl-tRNA synthetase;       
   36::174     4e-09  28%  589 aa  SYP_CORA7 RecName: Full=Prolyl-tRNA synthetase;       
   34::549     4e-09  29%  570 aa  SYP_CLOAB RecName: Full=Prolyl-tRNA synthetase;       
   34::555     4e-09  31%  572 aa  SYP_CITK8 RecName: Full=Prolyl-tRNA synthetase;       
   34::540     4e-09  28%  572 aa  SYP_CALS8 RecName: Full=Prolyl-tRNA synthetase;       
   34::550     4e-09  28%  576 aa  SYP_BORPE RecName: Full=Prolyl-tRNA synthetase;       
   34::550     4e-09  28%  576 aa  SYP_BORPA RecName: Full=Prolyl-tRNA synthetase;       
   34::550     4e-09  28%  576 aa  SYP_BORBR RecName: Full=Prolyl-tRNA synthetase;       
   34::558     4e-09  28%  576 aa  SYP_BORA1 RecName: Full=Prolyl-tRNA synthetase;       
   36::165     4e-09  25%  583 aa  SYP_ACIC1 RecName: Full=Prolyl-tRNA synthetase;       
   37::434     5e-09  29%  442 aa  SYP_SINMW RecName: Full=Prolyl-tRNA synthetase;       
   34::555     5e-09  28%  572 aa  SYP_SERP5 RecName: Full=Prolyl-tRNA synthetase;       
   37::434     5e-09  30%  442 aa  SYP_RHIME RecName: Full=Prolyl-tRNA synthetase;       
   34::545     5e-09  26%  573 aa  SYP_RALEJ RecName: Full=Prolyl-tRNA synthetase;       
   34::163     5e-09  29%  571 aa  SYP_PSEE4 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     5e-09  25%  571 aa  SYP_PSE14 RecName: Full=Prolyl-tRNA synthetase;       
   34::562     5e-09  27%  569 aa  SYP_NITMU RecName: Full=Prolyl-tRNA synthetase;       
   37::165     5e-09  28%  582 aa  SYP_MYCTU RecName: Full=Prolyl-tRNA synthetase;       
   37::165     5e-09  28%  582 aa  SYP_MYCBP RecName: Full=Prolyl-tRNA synthetase;       
   37::165     5e-09  28%  582 aa  SYP_MYCBO RecName: Full=Prolyl-tRNA synthetase;       
   34::193     5e-09  25%  569 aa  SYP_LEGPC RecName: Full=Prolyl-tRNA synthetase;       
   34::193     5e-09  24%  569 aa  SYP_LEGPA RecName: Full=Prolyl-tRNA synthetase;       
   37::186     5e-09  30%  568 aa  SYP_HALOH RecName: Full=Prolyl-tRNA synthetase;       
   34::555     5e-09  31%  572 aa  SYP_ENT38 RecName: Full=Prolyl-tRNA synthetase;       
   34::192     5e-09  25%  581 aa  SYP_BLOPB RecName: Full=Prolyl-tRNA synthetase;       
   17::182     5e-09  26%  557 aa  SYP_BAUCH RecName: Full=Prolyl-tRNA synthetase;       
   35::570     5e-09  25%  571 aa  SYP_ACTPJ RecName: Full=Prolyl-tRNA synthetase;       
   34::163     7e-09  26%  571 aa  SYP_VIBF1 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     7e-09  30%  574 aa  SYP_THISH RecName: Full=Prolyl-tRNA synthetase;       
   34::167     7e-09  26%  571 aa  SYP_PSEU2 RecName: Full=Prolyl-tRNA synthetase;       
   34::560     7e-09  29%  563 aa  SYP_PERMH RecName: Full=Prolyl-tRNA synthetase;       
   34::557     7e-09  28%  571 aa  SYP_PELCD RecName: Full=Prolyl-tRNA synthetase;       
   34::592     7e-09  29%  604 aa  SYP_NOSP7 RecName: Full=Prolyl-tRNA synthetase;       
   34::540     7e-09  30%  568 aa  SYP_NITEU RecName: Full=Prolyl-tRNA synthetase;       
   34::193     7e-09  24%  569 aa  SYP_LEGPL RecName: Full=Prolyl-tRNA synthetase;       
    3::163     7e-09  28%  570 aa  SYP_DESPS RecName: Full=Prolyl-tRNA synthetase;       
   34::550     7e-09  28%  576 aa  SYP_BORPD RecName: Full=Prolyl-tRNA synthetase;       
   36::165     7e-09  27%  603 aa  SYP_ARTAT RecName: Full=Prolyl-tRNA synthetase;       
   87::272     7e-09  24%  338 aa  RM39_HUMAN RecName: Full=39S ribosomal protein L39, mitochondrial; 
  136::354     9e-09  23%  435 aa  SYS_LACH4 RecName: Full=Seryl-tRNA synthetase;       
   34::436     9e-09  28%  443 aa  SYP_ZYMMO RecName: Full=Prolyl-tRNA synthetase;       
   37::163     9e-09  27%  570 aa  SYP_THEPX RecName: Full=Prolyl-tRNA synthetase;       
   37::163     9e-09  27%  570 aa  SYP_THEP3 RecName: Full=Prolyl-tRNA synthetase;       
   30::353     9e-09  25%  462 aa  SYP_THEAC RecName: Full=Prolyl-tRNA synthetase;       
   31::542     9e-09  27%  568 aa  SYP_SULNB RecName: Full=Prolyl-tRNA synthetase;       
   34::423     9e-09  27%  432 aa  SYP_RICPR RecName: Full=Prolyl-tRNA synthetase;       
   34::545     9e-09  26%  573 aa  SYP_RALME RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-09  25%  571 aa  SYP_PSESM RecName: Full=Prolyl-tRNA synthetase;       
   34::193     9e-09  25%  569 aa  SYP_LEGPH RecName: Full=Prolyl-tRNA synthetase;       
  288::393     9e-09  30%  512 aa  SYP_HALWD RecName: Full=Prolyl-tRNA synthetase;       
   34::569     9e-09  26%  576 aa  SYP_DECAR RecName: Full=Prolyl-tRNA synthetase;       
   37::163     9e-09  25%  441 aa  SYP_BARBK RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-09  27%  571 aa  SYP_ALISL RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-09  28%  571 aa  SYP1_CLOD6 RecName: Full=Prolyl-tRNA synthetase 1;       
   34::562     1e-08  25%  573 aa  SYP_RALEH RecName: Full=Prolyl-tRNA synthetase;       
   34::574     1e-08  25%  582 aa  SYP_PETMO RecName: Full=Prolyl-tRNA synthetase;       
   36::165     1e-08  28%  589 aa  SYP_NOCSJ RecName: Full=Prolyl-tRNA synthetase;       
   34::540     1e-08  30%  568 aa  SYP_NITEC RecName: Full=Prolyl-tRNA synthetase;       
   36::163     1e-08  27%  474 aa  SYP_MYCCT RecName: Full=Prolyl-tRNA synthetase;       
   36::419     1e-08  29%  442 aa  SYP_MESSB RecName: Full=Prolyl-tRNA synthetase;       
   34::547     1e-08  28%  577 aa  SYP_JANMA RecName: Full=Prolyl-tRNA synthetase;       
   34::185     1e-08  27%  567 aa  SYP_FUSNN RecName: Full=Prolyl-tRNA synthetase;       
   34::562     1e-08  25%  573 aa  SYP_CUPTR RecName: Full=Prolyl-tRNA synthetase;       
   36::165     1e-08  28%  585 aa  SYP_CORDI RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-08  27%  570 aa  SYP_CLOBB RecName: Full=Prolyl-tRNA synthetase;       
   40::183     1e-08  26%  590 aa  SYP_CLAMS RecName: Full=Prolyl-tRNA synthetase;       
   40::183     1e-08  26%  590 aa  SYP_CLAM3 RecName: Full=Prolyl-tRNA synthetase;       
   32::161     1e-08  30%  599 aa  SYP_BIFA0 RecName: Full=Prolyl-tRNA synthetase;       
  118::347     1e-08  23%  435 aa  SYS_LACRJ RecName: Full=Seryl-tRNA synthetase;       
  118::347     1e-08  23%  435 aa  SYS_LACRD RecName: Full=Seryl-tRNA synthetase;       
   34::163     1e-08  26%  571 aa  SYP_VIBPA RecName: Full=Prolyl-tRNA synthetase;       
   34::546     1e-08  30%  574 aa  SYP_TOLAT RecName: Full=Prolyl-tRNA synthetase;       
  436::581     1e-08  32%  601 aa  SYP_SYNP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::192     1e-08  26%  616 aa  SYP_STRMU RecName: Full=Prolyl-tRNA synthetase;       
   34::569     1e-08  25%  571 aa  SYP_PSEAE RecName: Full=Prolyl-tRNA synthetase;       
   34::569     1e-08  25%  571 aa  SYP_PSEAB RecName: Full=Prolyl-tRNA synthetase;       
   34::569     1e-08  25%  571 aa  SYP_PSEA8 RecName: Full=Prolyl-tRNA synthetase;       
   63::192     1e-08  24%  577 aa  SYP_CHLFF RecName: Full=Prolyl-tRNA synthetase;       
   35::549     1e-08  27%  569 aa  SYP_CAMJR RecName: Full=Prolyl-tRNA synthetase;       
   35::549     1e-08  27%  569 aa  SYP_CAMJE RecName: Full=Prolyl-tRNA synthetase;       
   35::569     1e-08  27%  569 aa  SYP_CAMJD RecName: Full=Prolyl-tRNA synthetase;       
   34::548     1e-08  27%  568 aa  SYP_CAMJ8 RecName: Full=Prolyl-tRNA synthetase;       
   37::420     2e-08  28%  440 aa  SYP_XANP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::177     2e-08  27%  571 aa  SYP_VIBHB RecName: Full=Prolyl-tRNA synthetase;       
   36::181     2e-08  31%  435 aa  SYP_SULDN RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-08  30%  574 aa  SYP_SODGM RecName: Full=Prolyl-tRNA synthetase;       
   38::434     2e-08  30%  440 aa  SYP_RHIL3 RecName: Full=Prolyl-tRNA synthetase;       
   34::354     2e-08  25%  481 aa  SYP_PYRKO RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  571 aa  SYP_PSEPK RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  571 aa  SYP_PSEP1 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  571 aa  SYP_PSEMY RecName: Full=Prolyl-tRNA synthetase;       
   34::573     2e-08  23%  580 aa  SYP_POLSQ RecName: Full=Prolyl-tRNA synthetase;       
   37::183     2e-08  24%  580 aa  SYP_MYCA9 RecName: Full=Prolyl-tRNA synthetase;       
   27::361     2e-08  27%  469 aa  SYP_METS3 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  424 aa  SYP_EHRCJ RecName: Full=Prolyl-tRNA synthetase;       
   34::562     2e-08  28%  598 aa  SYP_CYAP8 RecName: Full=Prolyl-tRNA synthetase;       
   34::533     2e-08  27%  570 aa  SYP_CLOBA RecName: Full=Prolyl-tRNA synthetase;       
   34::193     2e-08  30%  569 aa  SYP_CARHZ RecName: Full=Prolyl-tRNA synthetase;       
   34::541     2e-08  25%  578 aa  SYP_BRAHW RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-08  26%  439 aa  SYP_BEII9 RecName: Full=Prolyl-tRNA synthetase;       
   37::544     2e-08  28%  574 aa  SYP_ANASK RecName: Full=Prolyl-tRNA synthetase;       
   37::544     2e-08  28%  574 aa  SYP_ANAD2 RecName: Full=Prolyl-tRNA synthetase;       
  123::350     2e-08  23%  435 aa  SYS_LACDB RecName: Full=Seryl-tRNA synthetase;       
  123::350     2e-08  23%  435 aa  SYS_LACDA RecName: Full=Seryl-tRNA synthetase;       
  136::354     2e-08  22%  435 aa  SYS_LACAC RecName: Full=Seryl-tRNA synthetase;       
   34::177     2e-08  27%  571 aa  SYP_VIBSL RecName: Full=Prolyl-tRNA synthetase;       
   34::193     2e-08  28%  570 aa  SYP_SYNWW RecName: Full=Prolyl-tRNA synthetase;       
   34::592     2e-08  31%  618 aa  SYP_STRS7 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     2e-08  31%  618 aa  SYP_STRP8 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     2e-08  31%  618 aa  SYP_STRP3 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     2e-08  31%  618 aa  SYP_STRE4 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  571 aa  SYP_PSEPW RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-08  29%  571 aa  SYP_PSEPG RecName: Full=Prolyl-tRNA synthetase;       
   34::573     2e-08  27%  580 aa  SYP_POLSJ RecName: Full=Prolyl-tRNA synthetase;       
   37::427     2e-08  27%  439 aa  SYP_PHEZH RecName: Full=Prolyl-tRNA synthetase;       
   25::372     2e-08  28%  460 aa  SYP_METMP RecName: Full=Prolyl-tRNA synthetase;       
  231::372     2e-08  32%  460 aa  SYP_METM5 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-08  29%  575 aa  SYP_HELMI RecName: Full=Prolyl-tRNA synthetase;       
   36::192     2e-08  24%  596 aa  SYP_CORJK RecName: Full=Prolyl-tRNA synthetase;       
   34::563     2e-08  27%  574 aa  SYP_AERS4 RecName: Full=Prolyl-tRNA synthetase;       
   34::557     2e-08  28%  574 aa  SYP_AERHH RecName: Full=Prolyl-tRNA synthetase;       
   34::553     2e-08  28%  581 aa  SYP_ACIAC RecName: Full=Prolyl-tRNA synthetase;       
   34::560     2e-08  31%  600 aa  SYP_ACAM1 RecName: Full=Prolyl-tRNA synthetase;       
  118::343     3e-08  25%  423 aa  SYS_LACBA RecName: Full=Seryl-tRNA synthetase;       
   34::163     3e-08  27%  422 aa  SYP_WOLWR RecName: Full=Prolyl-tRNA synthetase;       
    3::360     3e-08  26%  488 aa  SYP_SYMTH RecName: Full=Prolyl-tRNA synthetase;       
   34::592     3e-08  31%  617 aa  SYP_STRA5 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     3e-08  31%  617 aa  SYP_STRA3 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     3e-08  31%  617 aa  SYP_STRA1 RecName: Full=Prolyl-tRNA synthetase;       
   34::569     3e-08  26%  571 aa  SYP_PSEA7 RecName: Full=Prolyl-tRNA synthetase;       
   34::551     3e-08  27%  574 aa  SYP_NITOC RecName: Full=Prolyl-tRNA synthetase;       
  231::372     3e-08  32%  460 aa  SYP_METM6 RecName: Full=Prolyl-tRNA synthetase;       
   34::569     3e-08  25%  573 aa  SYP_METFK RecName: Full=Prolyl-tRNA synthetase;       
   36::377     3e-08  26%  478 aa  SYP_METB6 RecName: Full=Prolyl-tRNA synthetase;       
   35::554     3e-08  26%  571 aa  SYP_HAES2 RecName: Full=Prolyl-tRNA synthetase;       
   35::554     3e-08  26%  571 aa  SYP_HAES1 RecName: Full=Prolyl-tRNA synthetase;       
   34::542     3e-08  26%  573 aa  SYP_ELUMP RecName: Full=Prolyl-tRNA synthetase;       
   34::541     3e-08  29%  568 aa  SYP_CHRVO RecName: Full=Prolyl-tRNA synthetase;       
   35::534     3e-08  28%  569 aa  SYP_CAMJJ RecName: Full=Prolyl-tRNA synthetase;       
   34::528     3e-08  31%  570 aa  SYP_AQUAE RecName: Full=Prolyl-tRNA synthetase;       
   37::166     3e-08  28%  575 aa  SYP_ANADF RecName: Full=Prolyl-tRNA synthetase;       
   34::420     4e-08  20%  425 aa  SYP_WOLTR RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-08  27%  571 aa  SYP_VIBVY RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-08  27%  571 aa  SYP_VIBVU RecName: Full=Prolyl-tRNA synthetase;       
   34::184     4e-08  26%  569 aa  SYP_UNCTG RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRPZ RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRPM RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRPG RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRPF RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRPD RecName: Full=Prolyl-tRNA synthetase;       
   34::617     4e-08  30%  618 aa  SYP_STRPC RecName: Full=Prolyl-tRNA synthetase;       
   34::617     4e-08  30%  618 aa  SYP_STRPB RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRP6 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-08  31%  618 aa  SYP_STRP1 RecName: Full=Prolyl-tRNA synthetase;       
   34::423     4e-08  26%  428 aa  SYP_RICTY RecName: Full=Prolyl-tRNA synthetase;       
   35::554     4e-08  27%  571 aa  SYP_PASMU RecName: Full=Prolyl-tRNA synthetase;       
   36::560     4e-08  28%  585 aa  SYP_NOCFA RecName: Full=Prolyl-tRNA synthetase;       
   38::399     4e-08  27%  480 aa  SYP_METAC RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-08  27%  577 aa  SYP_LACRJ RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-08  27%  577 aa  SYP_LACRD RecName: Full=Prolyl-tRNA synthetase;       
   34::163     4e-08  28%  424 aa  SYP_EHRCR RecName: Full=Prolyl-tRNA synthetase;       
   34::532     4e-08  28%  572 aa  SYP_CLOTH RecName: Full=Prolyl-tRNA synthetase;       
   34::540     4e-08  27%  567 aa  SYP_CAMC5 RecName: Full=Prolyl-tRNA synthetase;       
   37::428     4e-08  27%  441 aa  SYP_BART1 RecName: Full=Prolyl-tRNA synthetase;       
   34::182     4e-08  26%  569 aa  SYP_BACHD RecName: Full=Prolyl-tRNA synthetase;       
   38::434     6e-08  30%  440 aa  SYP_RHIEC RecName: Full=Prolyl-tRNA synthetase;       
   34::541     6e-08  30%  571 aa  SYP_PSEU5 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     6e-08  29%  571 aa  SYP_PSEF5 RecName: Full=Prolyl-tRNA synthetase;       
   34::567     6e-08  28%  581 aa  SYP_POLNA RecName: Full=Prolyl-tRNA synthetase;       
   34::181     6e-08  25%  570 aa  SYP_PELTS RecName: Full=Prolyl-tRNA synthetase;       
   34::550     6e-08  29%  571 aa  SYP_PEDPA RecName: Full=Prolyl-tRNA synthetase;       
   34::559     6e-08  29%  574 aa  SYP_MARMS RecName: Full=Prolyl-tRNA synthetase;       
   35::565     6e-08  25%  571 aa  SYP_MANSM RecName: Full=Prolyl-tRNA synthetase;       
   35::163     6e-08  28%  571 aa  SYP_HAEPS RecName: Full=Prolyl-tRNA synthetase;       
   34::572     6e-08  28%  581 aa  SYP_DIAST RecName: Full=Prolyl-tRNA synthetase;       
   34::572     6e-08  28%  581 aa  SYP_ACISJ RecName: Full=Prolyl-tRNA synthetase;       
   34::193     7e-08  28%  581 aa  SYP_VEREI RecName: Full=Prolyl-tRNA synthetase;       
   34::597     7e-08  29%  601 aa  SYP_TRIEI RecName: Full=Prolyl-tRNA synthetase;       
   34::592     7e-08  32%  620 aa  SYP_STRTD RecName: Full=Prolyl-tRNA synthetase;       
  431::567     7e-08  35%  595 aa  SYP_SALTO RecName: Full=Prolyl-tRNA synthetase;       
   33::200     7e-08  27%  480 aa  SYP_PYRAB RecName: Full=Prolyl-tRNA synthetase;       
   34::163     7e-08  28%  571 aa  SYP_PSEPF RecName: Full=Prolyl-tRNA synthetase;       
   34::177     7e-08  27%  571 aa  SYP_PHOPR RecName: Full=Prolyl-tRNA synthetase;       
   37::545     7e-08  26%  582 aa  SYP_MYCPA RecName: Full=Prolyl-tRNA synthetase;       
   37::545     7e-08  26%  582 aa  SYP_MYCA1 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     7e-08  28%  581 aa  SYP_METPP RecName: Full=Prolyl-tRNA synthetase;       
   34::549     7e-08  28%  571 aa  SYP_LACS1 RecName: Full=Prolyl-tRNA synthetase;       
   34::565     7e-08  26%  565 aa  SYP_LACDB RecName: Full=Prolyl-tRNA synthetase;       
   34::565     7e-08  26%  565 aa  SYP_LACDA RecName: Full=Prolyl-tRNA synthetase;       
   35::183     7e-08  25%  572 aa  SYP_HAEI8 RecName: Full=Prolyl-tRNA synthetase;       
   32::193     7e-08  28%  589 aa  SYP_GLOVI RecName: Full=Prolyl-tRNA synthetase;       
   34::163     7e-08  29%  570 aa  SYP_GEOSL RecName: Full=Prolyl-tRNA synthetase;       
  286::371     7e-08  35%  479 aa  SYP_EUBE2 RecName: Full=Prolyl-tRNA synthetase;       
   35::541     7e-08  26%  569 aa  SYP_COLP3 RecName: Full=Prolyl-tRNA synthetase;       
  245::367     7e-08  29%  481 aa  SYP_CLOST RecName: Full=Prolyl-tRNA synthetase;       
   32::577     7e-08  28%  597 aa  SYP_BIFLO RecName: Full=Prolyl-tRNA synthetase;       
  297::412     7e-08  34%  496 aa  SYP_BACV8 RecName: Full=Prolyl-tRNA synthetase;       
   34::543     7e-08  27%  572 aa  SYP_ALCBS RecName: Full=Prolyl-tRNA synthetase;       
   34::193     9e-08  26%  581 aa  SYP_VARPS RecName: Full=Prolyl-tRNA synthetase;       
   34::592     9e-08  28%  616 aa  SYP_STRSV RecName: Full=Prolyl-tRNA synthetase;       
   44::558     9e-08  29%  584 aa  SYP_SALAI RecName: Full=Prolyl-tRNA synthetase;       
   34::548     9e-08  28%  576 aa  SYP_PSYWF RecName: Full=Prolyl-tRNA synthetase;       
   35::167     9e-08  29%  600 aa  SYP_PROMS RecName: Full=Prolyl-tRNA synthetase;       
   38::373     9e-08  27%  480 aa  SYP_METBF RecName: Full=Prolyl-tRNA synthetase;       
   35::183     9e-08  25%  572 aa  SYP_HAEIN RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-08  27%  570 aa  SYP_GEOSF RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-08  31%  574 aa  SYP_DESDG RecName: Full=Prolyl-tRNA synthetase;       
   34::571     9e-08  24%  572 aa  SYP_BUCAT RecName: Full=Prolyl-tRNA synthetase;       
   34::571     9e-08  24%  572 aa  SYP_BUCA5 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-07  27%  571 aa  SYP_VIBCM RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-07  27%  571 aa  SYP_VIBCH RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-07  27%  571 aa  SYP_VIBC3 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     1e-07  30%  618 aa  SYP_STRU0 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     1e-07  32%  620 aa  SYP_STRT2 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     1e-07  32%  620 aa  SYP_STRT1 RecName: Full=Prolyl-tRNA synthetase;       
   37::193     1e-07  26%  571 aa  SYP_SHESW RecName: Full=Prolyl-tRNA synthetase;       
   37::193     1e-07  26%  571 aa  SYP_SHEPC RecName: Full=Prolyl-tRNA synthetase;       
   34::166     1e-07  27%  599 aa  SYP_PROM3 RecName: Full=Prolyl-tRNA synthetase;       
  297::419     1e-07  34%  493 aa  SYP_PORGI RecName: Full=Prolyl-tRNA synthetase;       
   34::573     1e-07  24%  580 aa  SYP_POLNS RecName: Full=Prolyl-tRNA synthetase;       
   37::431     1e-07  27%  441 aa  SYP_METRJ RecName: Full=Prolyl-tRNA synthetase;       
  287::367     1e-07  39%  501 aa  SYP_HALSA RecName: Full=Prolyl-tRNA synthetase;       
  287::367     1e-07  39%  501 aa  SYP_HALS3 RecName: Full=Prolyl-tRNA synthetase;       
   34::545     1e-07  28%  573 aa  SYP_GEOSM RecName: Full=Prolyl-tRNA synthetase;       
   34::545     1e-07  28%  573 aa  SYP_GEOBB RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-07  29%  426 aa  SYP_EHRRW RecName: Full=Prolyl-tRNA synthetase;       
   37::537     1e-07  28%  569 aa  SYP_DEHSC RecName: Full=Prolyl-tRNA synthetase;       
   36::174     1e-07  24%  592 aa  SYP_CORU7 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     1e-07  30%  581 aa  SYP_BREBN RecName: Full=Prolyl-tRNA synthetase;       
   34::564     1e-07  26%  571 aa  SYP_ACIBY RecName: Full=Prolyl-tRNA synthetase;       
   34::564     1e-07  26%  571 aa  SYP_ACIBT RecName: Full=Prolyl-tRNA synthetase;       
   34::564     1e-07  26%  571 aa  SYP_ACIBC RecName: Full=Prolyl-tRNA synthetase;       
   34::564     1e-07  26%  571 aa  SYP_ACIB5 RecName: Full=Prolyl-tRNA synthetase;       
   34::564     1e-07  26%  571 aa  SYP_ACIB3 RecName: Full=Prolyl-tRNA synthetase;       
   34::537     2e-07  27%  570 aa  SYP_WOLSU RecName: Full=Prolyl-tRNA synthetase;       
   34::539     2e-07  25%  564 aa  SYP_THEM4 RecName: Full=Prolyl-tRNA synthetase;       
   34::166     2e-07  30%  600 aa  SYP_SYNR3 RecName: Full=Prolyl-tRNA synthetase;       
   37::554     2e-07  26%  571 aa  SYP_SHEFN RecName: Full=Prolyl-tRNA synthetase;       
   37::193     2e-07  27%  572 aa  SYP_SHEAM RecName: Full=Prolyl-tRNA synthetase;       
   38::434     2e-07  29%  440 aa  SYP_RHIE6 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  24%  570 aa  SYP_NEIMF RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  24%  570 aa  SYP_NEIMB RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  24%  570 aa  SYP_NEIMA RecName: Full=Prolyl-tRNA synthetase;       
   37::163     2e-07  26%  440 aa  SYP_METSB RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-07  28%  565 aa  SYP_LACH4 RecName: Full=Prolyl-tRNA synthetase;       
   34::548     2e-07  27%  575 aa  SYP_LACC3 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     2e-07  27%  569 aa  SYP_LACBA RecName: Full=Prolyl-tRNA synthetase;       
  289::369     2e-07  34%  491 aa  SYP_HALLT RecName: Full=Prolyl-tRNA synthetase;       
   37::185     2e-07  23%  566 aa  SYP_EXIS2 RecName: Full=Prolyl-tRNA synthetase;       
    2::417     2e-07  23%  520 aa  SYP_ENCCU RecName: Full=Prolyl-tRNA synthetase;       
   37::537     2e-07  28%  569 aa  SYP_DEHSB RecName: Full=Prolyl-tRNA synthetase;       
   34::564     2e-07  27%  573 aa  SYP_CHRSD RecName: Full=Prolyl-tRNA synthetase;       
  439::577     2e-07  32%  605 aa  SYP_BIFAA RecName: Full=Prolyl-tRNA synthetase;       
   30::353     2e-07  24%  462 aa  SYP_THEVO RecName: Full=Prolyl-tRNA synthetase;       
   35::193     2e-07  27%  481 aa  SYP_SULIK RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-07  32%  620 aa  SYP_STRSY RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-07  32%  620 aa  SYP_STRS2 RecName: Full=Prolyl-tRNA synthetase;       
   37::562     2e-07  27%  569 aa  SYP_SHELP RecName: Full=Prolyl-tRNA synthetase;       
  297::404     2e-07  35%  493 aa  SYP_PARD8 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     2e-07  24%  577 aa  SYP_HELPH RecName: Full=Prolyl-tRNA synthetase;       
  238::357     2e-07  29%  468 aa  SYP_FRAAA RecName: Full=Prolyl-tRNA synthetase;       
  241::369     2e-07  30%  479 aa  SYP2_RHOSR RecName: Full=Prolyl-tRNA synthetase 2;       
   84::269     2e-07  23%  336 aa  RM39_MOUSE RecName: Full=39S ribosomal protein L39, mitochondrial; 
   35::193     3e-07  27%  481 aa  SYP_SULIY RecName: Full=Prolyl-tRNA synthetase;       
   35::193     3e-07  27%  481 aa  SYP_SULIN RecName: Full=Prolyl-tRNA synthetase;       
   35::193     3e-07  27%  481 aa  SYP_SULIM RecName: Full=Prolyl-tRNA synthetase;       
   35::193     3e-07  27%  481 aa  SYP_SULIL RecName: Full=Prolyl-tRNA synthetase;       
   35::193     3e-07  27%  481 aa  SYP_SULIA RecName: Full=Prolyl-tRNA synthetase;       
   37::183     3e-07  26%  570 aa  SYP_SHESR RecName: Full=Prolyl-tRNA synthetase;       
   37::183     3e-07  26%  570 aa  SYP_SHESM RecName: Full=Prolyl-tRNA synthetase;       
   37::183     3e-07  26%  570 aa  SYP_SHEON RecName: Full=Prolyl-tRNA synthetase;       
   37::193     3e-07  26%  571 aa  SYP_SHEB9 RecName: Full=Prolyl-tRNA synthetase;       
   37::193     3e-07  26%  571 aa  SYP_SHEB8 RecName: Full=Prolyl-tRNA synthetase;       
   37::193     3e-07  26%  571 aa  SYP_SHEB5 RecName: Full=Prolyl-tRNA synthetase;       
   37::193     3e-07  26%  571 aa  SYP_SHEB2 RecName: Full=Prolyl-tRNA synthetase;       
  297::419     3e-07  32%  493 aa  SYP_PORG3 RecName: Full=Prolyl-tRNA synthetase;       
  465::563     3e-07  31%  569 aa  SYP_NITSB RecName: Full=Prolyl-tRNA synthetase;       
  242::379     3e-07  27%  484 aa  SYP_HALMA RecName: Full=Prolyl-tRNA synthetase;       
   34::166     3e-07  29%  613 aa  SYP_CYAP4 RecName: Full=Prolyl-tRNA synthetase;       
  447::553     3e-07  27%  581 aa  SYP_CHLTR RecName: Full=Prolyl-tRNA synthetase;       
  447::553     3e-07  27%  581 aa  SYP_CHLTB RecName: Full=Prolyl-tRNA synthetase;       
  447::553     3e-07  27%  581 aa  SYP_CHLT2 RecName: Full=Prolyl-tRNA synthetase;       
   34::561     3e-07  26%  565 aa  SYP_CAMLR RecName: Full=Prolyl-tRNA synthetase;       
   34::186     3e-07  23%  569 aa  SYP_CAMHC RecName: Full=Prolyl-tRNA synthetase;       
   37::431     3e-07  28%  441 aa  SYP_BARQU RecName: Full=Prolyl-tRNA synthetase;       
   34::543     3e-07  29%  568 aa  SYP_ARCB4 RecName: Full=Prolyl-tRNA synthetase;       
   34::564     3e-07  26%  571 aa  SYP_ACIBS RecName: Full=Prolyl-tRNA synthetase;       
   37::544     3e-07  27%  575 aa  SYP1_ANADE RecName: Full=Prolyl-tRNA synthetase 1;       
   34::163     4e-07  25%  422 aa  SYP_WOLPM RecName: Full=Prolyl-tRNA synthetase;       
   37::183     4e-07  26%  570 aa  SYP_SHESA RecName: Full=Prolyl-tRNA synthetase;       
   34::574     4e-07  26%  580 aa  SYP_RHOFD RecName: Full=Prolyl-tRNA synthetase;       
   37::420     4e-07  26%  443 aa  SYP_METNO RecName: Full=Prolyl-tRNA synthetase;       
   23::386     4e-07  26%  456 aa  SYP_META3 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     4e-07  26%  569 aa  SYP_LACSS RecName: Full=Prolyl-tRNA synthetase;       
   34::549     4e-07  27%  574 aa  SYP_DESVV RecName: Full=Prolyl-tRNA synthetase;       
   34::193     4e-07  28%  575 aa  SYP_DESVM RecName: Full=Prolyl-tRNA synthetase;       
   34::549     4e-07  27%  574 aa  SYP_DESVH RecName: Full=Prolyl-tRNA synthetase;       
   37::540     4e-07  27%  569 aa  SYP_DEHE1 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     4e-07  24%  445 aa  SYP_CAUSK RecName: Full=Prolyl-tRNA synthetase;       
  297::390     4e-07  34%  497 aa  SYP_BACTN RecName: Full=Prolyl-tRNA synthetase;       
   34::570     4e-07  27%  581 aa  SYP_AZOSB RecName: Full=Prolyl-tRNA synthetase;       
   34::209     4e-07  27%  570 aa  SYP_ALKMQ RecName: Full=Prolyl-tRNA synthetase;       
   34::592     5e-07  28%  616 aa  SYP_STRGC RecName: Full=Prolyl-tRNA synthetase;       
  440::564     5e-07  27%  600 aa  SYP_PROM9 RecName: Full=Prolyl-tRNA synthetase;       
   35::167     5e-07  28%  600 aa  SYP_PROM0 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     5e-07  24%  570 aa  SYP_NEIG1 RecName: Full=Prolyl-tRNA synthetase;       
   35::162     5e-07  26%  473 aa  SYP_MESFL RecName: Full=Prolyl-tRNA synthetase;       
   34::542     5e-07  26%  572 aa  SYP_ENTFA RecName: Full=Prolyl-tRNA synthetase;       
   34::166     5e-07  30%  600 aa  SYP_CYAP7 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     5e-07  27%  558 aa  SYP_COPPD RecName: Full=Prolyl-tRNA synthetase;       
   37::431     5e-07  28%  441 aa  SYP_BARHE RecName: Full=Prolyl-tRNA synthetase;       
   34::551     5e-07  28%  583 aa  SYP_AZOSE RecName: Full=Prolyl-tRNA synthetase;       
   34::564     5e-07  26%  570 aa  SYP_ACIAD RecName: Full=Prolyl-tRNA synthetase;       
   34::186     6e-07  27%  603 aa  SYP_SYNY3 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRZT RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRZP RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRZJ RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRR6 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRPS RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRPN RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRPJ RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRPI RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRP7 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRP4 RecName: Full=Prolyl-tRNA synthetase;       
   34::592     6e-07  27%  617 aa  SYP_STRP2 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     6e-07  24%  566 aa  SYP_STAS1 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     6e-07  26%  570 aa  SYP_OENOB RecName: Full=Prolyl-tRNA synthetase;       
   37::428     6e-07  27%  444 aa  SYP_METS4 RecName: Full=Prolyl-tRNA synthetase;       
   37::429     6e-07  25%  441 aa  SYP_METPB RecName: Full=Prolyl-tRNA synthetase;       
   34::193     6e-07  26%  583 aa  SYP_METCA RecName: Full=Prolyl-tRNA synthetase;       
   34::561     6e-07  25%  576 aa  SYP_LEPIN RecName: Full=Prolyl-tRNA synthetase;       
   34::561     6e-07  25%  576 aa  SYP_LEPIC RecName: Full=Prolyl-tRNA synthetase;       
   34::163     6e-07  26%  576 aa  SYP_GEOLS RecName: Full=Prolyl-tRNA synthetase;       
  471::554     6e-07  32%  572 aa  SYP_DICNV RecName: Full=Prolyl-tRNA synthetase;       
   34::193     6e-07  26%  581 aa  SYP_DELAS RecName: Full=Prolyl-tRNA synthetase;       
   39::368     6e-07  27%  481 aa  SYP_CHLPD RecName: Full=Prolyl-tRNA synthetase;       
   56::179     6e-07  27%  579 aa  SYP_CHLMU RecName: Full=Prolyl-tRNA synthetase;       
   56::192     6e-07  24%  577 aa  SYP_CHLAB RecName: Full=Prolyl-tRNA synthetase;       
   37::430     6e-07  26%  443 aa  SYP_CAUCR RecName: Full=Prolyl-tRNA synthetase;       
   37::430     6e-07  26%  443 aa  SYP_CAUCN RecName: Full=Prolyl-tRNA synthetase;       
  519::614     6e-07  35%  652 aa  SYG_SCHPO RecName: Full=Putative glycyl-tRNA synthetase;       
   37::554     8e-07  28%  570 aa  SYP_SHEHH RecName: Full=Prolyl-tRNA synthetase;       
   34::184     8e-07  27%  600 aa  SYP_PROM4 RecName: Full=Prolyl-tRNA synthetase;       
   30::356     8e-07  30%  466 aa  SYP_PICTO RecName: Full=Prolyl-tRNA synthetase;       
   34::549     8e-07  29%  574 aa  SYP_NAUPA RecName: Full=Prolyl-tRNA synthetase;       
   43::166     8e-07  28%  485 aa  SYP_METKA RecName: Full=Prolyl-tRNA synthetase;       
   34::163     8e-07  27%  565 aa  SYP_LACAC RecName: Full=Prolyl-tRNA synthetase;       
   34::193     8e-07  23%  577 aa  SYP_HELPY RecName: Full=Prolyl-tRNA synthetase;       
   34::193     8e-07  23%  577 aa  SYP_HELPS RecName: Full=Prolyl-tRNA synthetase;       
   34::193     8e-07  23%  577 aa  SYP_HELPG RecName: Full=Prolyl-tRNA synthetase;       
   34::193     8e-07  23%  577 aa  SYP_HELP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::547     8e-07  28%  570 aa  SYP_GEOMG RecName: Full=Prolyl-tRNA synthetase;       
  494::553     8e-07  35%  581 aa  SYP_CHLTA RecName: Full=Prolyl-tRNA synthetase;       
   34::571     8e-07  24%  572 aa  SYP_BUCAI RecName: Full=Prolyl-tRNA synthetase;       
  252::406     8e-07  35%  499 aa  SYP_BDEBA RecName: Full=Prolyl-tRNA synthetase;       
   37::549     8e-07  26%  565 aa  SYP_BACP2 RecName: Full=Prolyl-tRNA synthetase;       
  160::346     1e-06  21%  424 aa  SYS_LACSS RecName: Full=Seryl-tRNA synthetase;       
  167::345     1e-06  23%  412 aa  SYS_ARCB4 RecName: Full=Seryl-tRNA synthetase;       
   37::182     1e-06  24%  566 aa  SYP_STAHJ RecName: Full=Prolyl-tRNA synthetase;       
   37::168     1e-06  28%  570 aa  SYP_SHEPA RecName: Full=Prolyl-tRNA synthetase;       
  440::598     1e-06  24%  600 aa  SYP_PROM2 RecName: Full=Prolyl-tRNA synthetase;       
   67::374     1e-06  24%  483 aa  SYP_NATTJ RecName: Full=Prolyl-tRNA synthetase;       
   37::429     1e-06  25%  441 aa  SYP_METEP RecName: Full=Prolyl-tRNA synthetase;       
   37::429     1e-06  25%  441 aa  SYP_METC4 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-06  25%  573 aa  SYP_LACF3 RecName: Full=Prolyl-tRNA synthetase;       
   34::193     1e-06  23%  576 aa  SYP_HELPJ RecName: Full=Prolyl-tRNA synthetase;       
  238::365     1e-06  30%  468 aa  SYP_FRASC RecName: Full=Prolyl-tRNA synthetase;       
   34::562     1e-06  29%  571 aa  SYP_BUCAP RecName: Full=Prolyl-tRNA synthetase;       
   38::369     1e-06  24%  488 aa  SYP_BORAP RecName: Full=Prolyl-tRNA synthetase;       
   37::173     1e-06  25%  566 aa  SYP_BACCN RecName: Full=Prolyl-tRNA synthetase;       
   34::166     1e-06  30%  593 aa  SYP_SYNPX RecName: Full=Prolyl-tRNA synthetase;       
   37::554     1e-06  27%  571 aa  SYP_SHEDO RecName: Full=Prolyl-tRNA synthetase;       
   34::184     1e-06  26%  599 aa  SYP_PROMM RecName: Full=Prolyl-tRNA synthetase;       
   34::166     1e-06  28%  603 aa  SYP_PROMA RecName: Full=Prolyl-tRNA synthetase;       
  281::368     1e-06  33%  479 aa  SYP_MYCH7 RecName: Full=Prolyl-tRNA synthetase;       
   34::183     1e-06  25%  568 aa  SYP_LISIN RecName: Full=Prolyl-tRNA synthetase;       
   36::174     1e-06  25%  588 aa  SYP_CORGB RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURTA RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURPS RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURP6 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURP1 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURP0 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURMS RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURMA RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURM9 RecName: Full=Prolyl-tRNA synthetase;       
   34::181     1e-06  23%  578 aa  SYP_BURM7 RecName: Full=Prolyl-tRNA synthetase;       
   34::172     1e-06  28%  566 aa  SYP_BACSK RecName: Full=Prolyl-tRNA synthetase;       
   34::565     1e-06  27%  571 aa  SYP_AZOVD RecName: Full=Prolyl-tRNA synthetase;       
  344::421     1e-06  33%  424 aa  SYH_STAES RecName: Full=Histidyl-tRNA synthetase;       
  344::421     1e-06  33%  424 aa  SYH_STAEQ RecName: Full=Histidyl-tRNA synthetase;       
  118::301     2e-06  22%  425 aa  SYS_STRU0 RecName: Full=Seryl-tRNA synthetase;       
  282::371     2e-06  33%  477 aa  SYP_THET2 RecName: Full=Prolyl-tRNA synthetase;       
   35::193     2e-06  26%  481 aa  SYP_SULSO RecName: Full=Prolyl-tRNA synthetase;       
  293::408     2e-06  29%  490 aa  SYP_SALRD RecName: Full=Prolyl-tRNA synthetase;       
   34::545     2e-06  28%  576 aa  SYP_PELPD RecName: Full=Prolyl-tRNA synthetase;       
   34::193     2e-06  23%  577 aa  SYP_HELAH RecName: Full=Prolyl-tRNA synthetase;       
   36::165     2e-06  22%  566 aa  SYP_COXBU RecName: Full=Prolyl-tRNA synthetase;       
   34::163     2e-06  22%  564 aa  SYP_COXBR RecName: Full=Prolyl-tRNA synthetase;       
   34::560     2e-06  26%  564 aa  SYP_COXBN RecName: Full=Prolyl-tRNA synthetase;       
   36::174     2e-06  25%  588 aa  SYP_CORGL RecName: Full=Prolyl-tRNA synthetase;       
  447::558     2e-06  24%  568 aa  SYP_CHLPN RecName: Full=Prolyl-tRNA synthetase;       
  538::677     2e-06  30%  865 aa  SYA_FRAP2 RecName: Full=Alanyl-tRNA synthetase;       
    9::301     2e-06  21%  425 aa  SYS_STRPD RecName: Full=Seryl-tRNA synthetase;       
    3::348     2e-06  22%  422 aa  SYS_MYCMS RecName: Full=Seryl-tRNA synthetase;       
   34::582     2e-06  27%  600 aa  SYP_SYNP6 RecName: Full=Prolyl-tRNA synthetase;       
   34::582     2e-06  27%  600 aa  SYP_SYNE7 RecName: Full=Prolyl-tRNA synthetase;       
   34::168     2e-06  24%  567 aa  SYP_STRMK RecName: Full=Prolyl-tRNA synthetase;       
    8::168     2e-06  26%  569 aa  SYP_SHEWM RecName: Full=Prolyl-tRNA synthetase;       
   34::555     2e-06  26%  568 aa  SYP_MACCJ RecName: Full=Prolyl-tRNA synthetase;       
   37::193     2e-06  27%  568 aa  SYP_LYSSC RecName: Full=Prolyl-tRNA synthetase;       
   34::181     2e-06  26%  566 aa  SYP_DESAP RecName: Full=Prolyl-tRNA synthetase;       
   63::192     2e-06  24%  577 aa  SYP_CHLCV RecName: Full=Prolyl-tRNA synthetase;       
   34::168     3e-06  24%  564 aa  SYP_XANC5 RecName: Full=Prolyl-tRNA synthetase;       
   34::168     3e-06  24%  564 aa  SYP_XANAC RecName: Full=Prolyl-tRNA synthetase;       
   34::168     3e-06  24%  567 aa  SYP_STRM5 RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-06  24%  567 aa  SYP_STAES RecName: Full=Prolyl-tRNA synthetase;       
   37::163     3e-06  24%  567 aa  SYP_STAEQ RecName: Full=Prolyl-tRNA synthetase;       
   31::365     3e-06  28%  480 aa  SYP_ROSS1 RecName: Full=Prolyl-tRNA synthetase;       
   37::548     3e-06  26%  567 aa  SYP_GEOKA RecName: Full=Prolyl-tRNA synthetase;       
  286::370     3e-06  37%  477 aa  SYP_CLOPH RecName: Full=Prolyl-tRNA synthetase;       
  297::390     3e-06  32%  497 aa  SYP_BACFR RecName: Full=Prolyl-tRNA synthetase;       
  297::390     3e-06  32%  497 aa  SYP_BACFN RecName: Full=Prolyl-tRNA synthetase;       
  297::412     3e-06  33%  493 aa  SYP_AZOPC RecName: Full=Prolyl-tRNA synthetase;       
   10::106     3e-06  34%  415 aa  SYH_IDILO RecName: Full=Histidyl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRPZ RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRPM RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRPF RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRP8 RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRP6 RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRP3 RecName: Full=Seryl-tRNA synthetase;       
  121::301     4e-06  22%  425 aa  SYS_STRP1 RecName: Full=Seryl-tRNA synthetase;       
   35::193     4e-06  25%  483 aa  SYP_SULAC RecName: Full=Prolyl-tRNA synthetase;       
   33::394     4e-06  30%  480 aa  SYP_PYRHO RecName: Full=Prolyl-tRNA synthetase;       
   34::592     4e-06  27%  603 aa  SYP_MICAN RecName: Full=Prolyl-tRNA synthetase;       
  308::387     4e-06  32%  478 aa  SYP_METTP RecName: Full=Prolyl-tRNA synthetase;       
   34::553     4e-06  27%  581 aa  SYP_LEPCP RecName: Full=Prolyl-tRNA synthetase;       
   34::564     4e-06  24%  565 aa  SYP_LACJO RecName: Full=Prolyl-tRNA synthetase;       
   32::199     4e-06  27%  478 aa  SYP_IGNH4 RecName: Full=Prolyl-tRNA synthetase;       
   37::548     4e-06  27%  567 aa  SYP_GEOTN RecName: Full=Prolyl-tRNA synthetase;       
   36::155     4e-06  31%  428 aa  SYH_SULAC RecName: Full=Histidyl-tRNA synthetase;       
  547::677     4e-06  31%  865 aa  SYA_FRATN RecName: Full=Alanyl-tRNA synthetase;       
  124::352     5e-06  22%  436 aa  SYS_LEUCK RecName: Full=Seryl-tRNA synthetase;       
   16::166     5e-06  29%  581 aa  SYP_SYNFM RecName: Full=Prolyl-tRNA synthetase;       
   31::365     5e-06  28%  480 aa  SYP_ROSCS RecName: Full=Prolyl-tRNA synthetase;       
  466::544     5e-06  32%  571 aa  SYP_LEUCK RecName: Full=Prolyl-tRNA synthetase;       
   34::167     5e-06  25%  576 aa  SYP_LEPBL RecName: Full=Prolyl-tRNA synthetase;       
   34::167     5e-06  25%  576 aa  SYP_LEPBJ RecName: Full=Prolyl-tRNA synthetase;       
  286::370     5e-06  34%  478 aa  SYP_CLOCE RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACCQ RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACC7 RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACC4 RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACC3 RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACC0 RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACAC RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP_BACAA RecName: Full=Prolyl-tRNA synthetase;       
  431::543     5e-06  31%  587 aa  SYP_ACIBL RecName: Full=Prolyl-tRNA synthetase;       
   37::173     5e-06  25%  566 aa  SYP1_BACHK RecName: Full=Prolyl-tRNA synthetase 1;       
   37::173     5e-06  25%  566 aa  SYP1_BACCZ RecName: Full=Prolyl-tRNA synthetase 1;       
   37::173     5e-06  25%  566 aa  SYP1_BACCR RecName: Full=Prolyl-tRNA synthetase 1;       
   37::173     5e-06  25%  566 aa  SYP1_BACC1 RecName: Full=Prolyl-tRNA synthetase 1;       
   37::173     5e-06  25%  566 aa  SYP1_BACAN RecName: Full=Prolyl-tRNA synthetase 1;       
   37::173     5e-06  25%  566 aa  SYP1_BACAH RecName: Full=Prolyl-tRNA synthetase 1;       
   19::116     5e-06  30%  421 aa  SYH_METKA RecName: Full=Histidyl-tRNA synthetase;       
  344::425     5e-06  30%  433 aa  SYH_CYAA5 RecName: Full=Histidyl-tRNA synthetase;       
  360::406     5e-06  40%  425 aa  SYH2_BACSK RecName: Full=Histidyl-tRNA synthetase 2;       
  582::704     5e-06  32%  893 aa  SYA_LEUMM RecName: Full=Alanyl-tRNA synthetase;       
  173::348     7e-06  23%  422 aa  SYS_MYCCT RecName: Full=Seryl-tRNA synthetase;       
   17::193     7e-06  26%  572 aa  SYP_LEUMM RecName: Full=Prolyl-tRNA synthetase;       
   34::193     7e-06  22%  569 aa  SYP_LACPL RecName: Full=Prolyl-tRNA synthetase;       
   37::548     7e-06  27%  567 aa  SYP_GEOSW RecName: Full=Prolyl-tRNA synthetase;       
   34::163     7e-06  27%  580 aa  SYP_DESAD RecName: Full=Prolyl-tRNA synthetase;       
   34::546     7e-06  24%  578 aa  SYP_BURVG RecName: Full=Prolyl-tRNA synthetase;       
   34::546     7e-06  25%  578 aa  SYP_BURM1 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     7e-06  25%  578 aa  SYP_BURCJ RecName: Full=Prolyl-tRNA synthetase;       
   37::173     7e-06  25%  566 aa  SYP_BACWK RecName: Full=Prolyl-tRNA synthetase;       
   37::173     7e-06  25%  566 aa  SYP_BACC2 RecName: Full=Prolyl-tRNA synthetase;       
  140::301     9e-06  22%  425 aa  SYS_STRPC RecName: Full=Seryl-tRNA synthetase;       
  140::301     9e-06  22%  425 aa  SYS_STRPB RecName: Full=Seryl-tRNA synthetase;       
  131::301     9e-06  22%  425 aa  SYS_STRGC RecName: Full=Seryl-tRNA synthetase;       
   34::167     9e-06  23%  564 aa  SYP_XYLFT RecName: Full=Prolyl-tRNA synthetase;       
   34::167     9e-06  23%  564 aa  SYP_XYLFM RecName: Full=Prolyl-tRNA synthetase;       
   34::167     9e-06  23%  564 aa  SYP_XYLFA RecName: Full=Prolyl-tRNA synthetase;       
   34::167     9e-06  23%  564 aa  SYP_XYLF2 RecName: Full=Prolyl-tRNA synthetase;       
   32::161     9e-06  25%  617 aa  SYP_TREPS RecName: Full=Prolyl-tRNA synthetase;       
   32::161     9e-06  25%  617 aa  SYP_TREPA RecName: Full=Prolyl-tRNA synthetase;       
  423::566     9e-06  26%  594 aa  SYP_SYNPW RecName: Full=Prolyl-tRNA synthetase;       
   35::158     9e-06  30%  483 aa  SYP_SULTO RecName: Full=Prolyl-tRNA synthetase;       
   25::382     9e-06  22%  470 aa  SYP_MYCPE RecName: Full=Prolyl-tRNA synthetase;       
  418::568     9e-06  31%  588 aa  SYP_COREF RecName: Full=Prolyl-tRNA synthetase;       
   34::181     9e-06  25%  578 aa  SYP_BURP8 RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-06  22%  578 aa  SYP_BURCM RecName: Full=Prolyl-tRNA synthetase;       
   34::546     9e-06  25%  578 aa  SYP_BURCH RecName: Full=Prolyl-tRNA synthetase;       
   34::546     9e-06  25%  578 aa  SYP_BURCC RecName: Full=Prolyl-tRNA synthetase;       
   34::546     9e-06  25%  578 aa  SYP_BURCA RecName: Full=Prolyl-tRNA synthetase;       
   34::163     9e-06  22%  578 aa  SYP_BURA4 RecName: Full=Prolyl-tRNA synthetase;       
   22::112     9e-06  31%  426 aa  SYH_SULIA RecName: Full=Histidyl-tRNA synthetase;       
  170::347     1e-05  23%  414 aa  SYS_CAMC1 RecName: Full=Seryl-tRNA synthetase;       
  130::307     1e-05  24%  432 aa  SYS_BURP8 RecName: Full=Seryl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANOR RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANOP RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANOM RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANCP RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANCB RecName: Full=Prolyl-tRNA synthetase;       
   34::163     1e-05  23%  564 aa  SYP_XANC8 RecName: Full=Prolyl-tRNA synthetase;       
  418::541     1e-05  28%  566 aa  SYP_HERA2 RecName: Full=Prolyl-tRNA synthetase;       
   34::546     1e-05  25%  578 aa  SYP_BURS3 RecName: Full=Prolyl-tRNA synthetase;       
  405::548     1e-05  30%  572 aa  SYP_BACLD RecName: Full=Prolyl-tRNA synthetase;       
  374::464     1e-05  24%  470 aa  SYH_XANOR RecName: Full=Histidyl-tRNA synthetase;       
  374::464     1e-05  24%  470 aa  SYH_XANOP RecName: Full=Histidyl-tRNA synthetase;       
  374::464     1e-05  24%  480 aa  SYH_XANOM RecName: Full=Histidyl-tRNA synthetase;       
   14::118     1e-05  30%  433 aa  SYH_THELT RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-05  31%  426 aa  SYH_SULIY RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-05  31%  426 aa  SYH_SULIN RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-05  31%  426 aa  SYH_SULIM RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-05  31%  426 aa  SYH_SULIL RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-05  31%  426 aa  SYH_SULIK RecName: Full=Histidyl-tRNA synthetase;       
   15::116     1e-05  27%  423 aa  SYH_SHELP RecName: Full=Histidyl-tRNA synthetase;       
   15::116     1e-05  27%  424 aa  SYH_SHEAM RecName: Full=Histidyl-tRNA synthetase;       
   35::185     1e-05  31%  431 aa  SYH_DEIGD RecName: Full=Histidyl-tRNA synthetase;       
  121::301     2e-05  24%  425 aa  SYS_STREM RecName: Full=Seryl-tRNA synthetase;       
  160::344     2e-05  23%  423 aa  SYS2_ENTFA RecName: Full=Seryl-tRNA synthetase 2;       
   34::166     2e-05  26%  593 aa  SYP_SYNSC RecName: Full=Prolyl-tRNA synthetase;       
   33::156     2e-05  27%  479 aa  SYP_PYRFU RecName: Full=Prolyl-tRNA synthetase;       
  490::563     2e-05  25%  600 aa  SYP_PROMP RecName: Full=Prolyl-tRNA synthetase;       
   30::179     2e-05  25%  537 aa  SYP_NANEQ RecName: Full=Prolyl-tRNA synthetase;       
   34::177     2e-05  23%  568 aa  SYP_LISMO RecName: Full=Prolyl-tRNA synthetase;       
   34::177     2e-05  23%  568 aa  SYP_LISMH RecName: Full=Prolyl-tRNA synthetase;       
   34::177     2e-05  23%  568 aa  SYP_LISMF RecName: Full=Prolyl-tRNA synthetase;       
   34::177     2e-05  23%  568 aa  SYP_LISMC RecName: Full=Prolyl-tRNA synthetase;       
  405::548     2e-05  29%  564 aa  SYP_BACA2 RecName: Full=Prolyl-tRNA synthetase;       
  301::415     2e-05  31%  506 aa  SYP_RHOBA RecName: Full=Prolyl-tRNA synthetase;       
  251::395     2e-05  28%  474 aa  SYP_ONYPE RecName: Full=Prolyl-tRNA synthetase;       
  271::407     2e-05  28%  425 aa  SYPM_SCHPO RecName: Full=Probable prolyl-tRNA synthetase,
  344::428     2e-05  28%  428 aa  SYH_STACT RecName: Full=Histidyl-tRNA synthetase;       
   15::116     2e-05  26%  425 aa  SYH_SHEON RecName: Full=Histidyl-tRNA synthetase;       
    9::166     2e-05  33%  437 aa  SYH_OPITP RecName: Full=Histidyl-tRNA synthetase;       
   34::185     2e-05  31%  427 aa  SYH_DEIRA RecName: Full=Histidyl-tRNA synthetase;       
  222::370     3e-05  26%  688 aa  YHI0_YEAST RecName: Full=Putative prolyl-tRNA synthetase YHR020W;  
  131::351     3e-05  22%  425 aa  SYS2_CLOAB RecName: Full=Seryl-tRNA synthetase 2;       
   36::398     3e-05  27%  474 aa  SYP_UNCMA RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAW RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAT RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAS RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAR RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAN RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAM RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAE RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAC RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAAB RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAA9 RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAA8 RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAA3 RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAA2 RecName: Full=Prolyl-tRNA synthetase;       
   69::163     3e-05  26%  567 aa  SYP_STAA1 RecName: Full=Prolyl-tRNA synthetase;       
  465::560     3e-05  30%  565 aa  SYP_FRAP2 RecName: Full=Prolyl-tRNA synthetase;       
   34::544     3e-05  26%  578 aa  SYP_BURXL RecName: Full=Prolyl-tRNA synthetase;       
   34::544     3e-05  26%  578 aa  SYP_BURPP RecName: Full=Prolyl-tRNA synthetase;       
   22::112     3e-05  30%  138 aa  SYH_SULSH RecName: Full=Putative histidyl-tRNA synthetase;       
   15::116     3e-05  26%  424 aa  SYH_SHEWM RecName: Full=Histidyl-tRNA synthetase;       
   15::116     3e-05  27%  424 aa  SYH_SHEPW RecName: Full=Histidyl-tRNA synthetase;       
   15::122     3e-05  28%  423 aa  SYH_MYCGA RecName: Full=Histidyl-tRNA synthetase;       
   36::155     3e-05  29%  430 aa  SYH_METS5 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURPS RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURP6 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURP1 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURP0 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURMS RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURMA RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURM9 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     3e-05  28%  446 aa  SYH_BURM7 RecName: Full=Histidyl-tRNA synthetase;       
  509::689     3e-05  24%  879 aa  SYA_CLOTE RecName: Full=Alanyl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRZT RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRZP RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRZJ RecName: Full=Seryl-tRNA synthetase;       
  118::302     3e-05  24%  425 aa  SYS_STRTD RecName: Full=Seryl-tRNA synthetase;       
  132::301     3e-05  22%  425 aa  SYS_STRSV RecName: Full=Seryl-tRNA synthetase;       
  121::301     3e-05  23%  425 aa  SYS_STRS7 RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRR6 RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRPN RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRPJ RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRPI RecName: Full=Seryl-tRNA synthetase;       
  121::267     3e-05  23%  425 aa  SYS_STRPG RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRP7 RecName: Full=Seryl-tRNA synthetase;       
  118::347     3e-05  21%  424 aa  SYS_STRP2 RecName: Full=Seryl-tRNA synthetase;       
  160::345     3e-05  21%  423 aa  SYS_LACLS RecName: Full=Seryl-tRNA synthetase;       
  160::345     3e-05  21%  423 aa  SYS_LACLM RecName: Full=Seryl-tRNA synthetase;       
  160::345     3e-05  21%  423 aa  SYS_LACLA RecName: Full=Seryl-tRNA synthetase;       
  169::347     3e-05  22%  414 aa  SYS_CAMFF RecName: Full=Seryl-tRNA synthetase;       
   36::534     3e-05  25%  581 aa  SYP_RHOOB RecName: Full=Prolyl-tRNA synthetase;       
   38::165     3e-05  27%  474 aa  SYP_PHYAS RecName: Full=Prolyl-tRNA synthetase;       
  285::395     3e-05  29%  474 aa  SYP_AYWBP RecName: Full=Prolyl-tRNA synthetase;       
  283::362     3e-05  31%  471 aa  SYP2_STRAW RecName: Full=Prolyl-tRNA synthetase 2;       
   15::116     3e-05  26%  425 aa  SYH_SHESW RecName: Full=Histidyl-tRNA synthetase;       
   15::116     3e-05  26%  425 aa  SYH_SHESR RecName: Full=Histidyl-tRNA synthetase;       
   15::116     3e-05  26%  425 aa  SYH_SHESM RecName: Full=Histidyl-tRNA synthetase;       
   15::116     3e-05  26%  425 aa  SYH_SHESA RecName: Full=Histidyl-tRNA synthetase;       
   15::116     3e-05  26%  425 aa  SYH_SHEPC RecName: Full=Histidyl-tRNA synthetase;       
  346::425     3e-05  30%  425 aa  SYH_HELMI RecName: Full=Histidyl-tRNA synthetase;       
  332::427     3e-05  25%  430 aa  SYH_CHLPN RecName: Full=Histidyl-tRNA synthetase;       
  314::389     4e-05  33%  421 aa  SYT2_AERPE RecName: Full=Probable threonyl-tRNA synthetase 2;      
  138::345     4e-05  25%  421 aa  SYS_METAC RecName: Full=Seryl-tRNA synthetase;       
  148::352     4e-05  21%  435 aa  SYS_LEUMM RecName: Full=Seryl-tRNA synthetase;       
  130::258     4e-05  28%  433 aa  SYS_BURCM RecName: Full=Seryl-tRNA synthetase;       
   36::165     4e-05  22%  582 aa  SYP_THEFY RecName: Full=Prolyl-tRNA synthetase;       
  405::548     4e-05  29%  564 aa  SYP_BACSU RecName: Full=Prolyl-tRNA synthetase;       
   15::116     4e-05  26%  424 aa  SYH_SHESH RecName: Full=Histidyl-tRNA synthetase;       
   10::116     4e-05  29%  426 aa  SYH_PSEA6 RecName: Full=Histidyl-tRNA synthetase;       
  322::398     4e-05  35%  413 aa  SYH_EHRCR RecName: Full=Histidyl-tRNA synthetase;       
   21::123     4e-05  26%  446 aa  SYH_BURXL RecName: Full=Histidyl-tRNA synthetase;       
  121::301     6e-05  23%  425 aa  SYS_STRE4 RecName: Full=Seryl-tRNA synthetase;       
  171::347     6e-05  22%  414 aa  SYS_CAMC5 RecName: Full=Seryl-tRNA synthetase;       
  130::258     6e-05  28%  433 aa  SYS_BURA4 RecName: Full=Seryl-tRNA synthetase;       
   34::539     6e-05  29%  570 aa  SYP_ACIF5 RecName: Full=Prolyl-tRNA synthetase;       
   34::539     6e-05  29%  570 aa  SYP_ACIF2 RecName: Full=Prolyl-tRNA synthetase;       
  344::421     6e-05  32%  423 aa  SYH_STAHJ RecName: Full=Histidyl-tRNA synthetase;       
  303::406     6e-05  33%  413 aa  SYH_EHRCJ RecName: Full=Histidyl-tRNA synthetase;       
   21::123     6e-05  26%  446 aa  SYH_BURPP RecName: Full=Histidyl-tRNA synthetase;       
  559::699     6e-05  29%  873 aa  SYA_FINM2 RecName: Full=Alanyl-tRNA synthetase;       
  160::347     7e-05  20%  424 aa  SYS_STRP4 RecName: Full=Seryl-tRNA synthetase;       
  169::300     7e-05  26%  424 aa  SYS_ROSCS RecName: Full=Seryl-tRNA synthetase;       
  130::307     7e-05  24%  431 aa  SYS_BURXL RecName: Full=Seryl-tRNA synthetase;       
   36::165     7e-05  25%  581 aa  SYP_RHOE4 RecName: Full=Prolyl-tRNA synthetase;       
   36::189     7e-05  27%  477 aa  SYP_METMJ RecName: Full=Prolyl-tRNA synthetase;       
   36::165     7e-05  22%  581 aa  SYP1_RHOSR RecName: Full=Prolyl-tRNA synthetase 1;       
  378::468     7e-05  23%  482 aa  SYH_XANC5 RecName: Full=Histidyl-tRNA synthetase;       
  374::464     7e-05  23%  478 aa  SYH_XANAC RecName: Full=Histidyl-tRNA synthetase;       
  319::394     7e-05  38%  420 aa  SYH_THESQ RecName: Full=Histidyl-tRNA synthetase;       
  319::394     7e-05  38%  420 aa  SYH_THEMA RecName: Full=Histidyl-tRNA synthetase;       
   21::123     7e-05  27%  446 aa  SYH_BURTA RecName: Full=Histidyl-tRNA synthetase;       
  565::687     7e-05  30%  875 aa  SYA_SODGM RecName: Full=Alanyl-tRNA synthetase;       
  492::704     7e-05  31%  894 aa  SYA_LEUCK RecName: Full=Alanyl-tRNA synthetase;       
  154::334     1e-04  23%  441 aa  SYS_THEVO RecName: Full=Seryl-tRNA synthetase;       
  135::296     1e-04  29%  425 aa  SYS_SYNPX RecName: Full=Seryl-tRNA synthetase;       
  141::219     1e-04  28%  422 aa  SYS_MYCAP RecName: Full=Seryl-tRNA synthetase;       
  159::344     1e-04  25%  428 aa  SYS_CHLMU RecName: Full=Seryl-tRNA synthetase;       
  130::258     1e-04  28%  431 aa  SYS_BURPP RecName: Full=Seryl-tRNA synthetase;       
  466::543     1e-04  29%  576 aa  SYP_THIDA RecName: Full=Prolyl-tRNA synthetase;       
  294::384     1e-04  33%  491 aa  SYP_CYTH3 RecName: Full=Prolyl-tRNA synthetase;       
  374::464     1e-04  23%  477 aa  SYH_XANCP RecName: Full=Histidyl-tRNA synthetase;       
  374::464     1e-04  23%  477 aa  SYH_XANC8 RecName: Full=Histidyl-tRNA synthetase;       
   22::112     1e-04  29%  426 aa  SYH_SULSO RecName: Full=Histidyl-tRNA synthetase;       
  369::459     1e-04  23%  465 aa  SYH_STRM5 RecName: Full=Histidyl-tRNA synthetase;       
    4::119     1e-04  27%  422 aa  SYH_LYSSC RecName: Full=Histidyl-tRNA synthetase;       
   35::203     1e-04  30%  448 aa  SYH_DEIDV RecName: Full=Histidyl-tRNA synthetase;       
  606::690     1e-04  33%  739 aa  SYG_PONAB RecName: Full=Glycyl-tRNA synthetase;       
  606::690     1e-04  33%  739 aa  SYG_HUMAN RecName: Full=Glycyl-tRNA synthetase;       
  129::300     1e-04  24%  423 aa  SYS_CHLSY RecName: Full=Seryl-tRNA synthetase;       
  129::300     1e-04  24%  423 aa  SYS_CHLAA RecName: Full=Seryl-tRNA synthetase;       
  166::343     1e-04  21%  411 aa  SYS_CAMLR RecName: Full=Seryl-tRNA synthetase;       
  130::258     1e-04  28%  433 aa  SYS_BURM1 RecName: Full=Seryl-tRNA synthetase;       
  130::258     1e-04  28%  433 aa  SYS_BURCE RecName: Full=Seryl-tRNA synthetase;       
   34::532     1e-04  26%  571 aa  SYP_THEYD RecName: Full=Prolyl-tRNA synthetase;       
   34::166     1e-04  25%  596 aa  SYP_PROM1 RecName: Full=Prolyl-tRNA synthetase;       
  281::368     1e-04  31%  479 aa  SYP_MYCHJ RecName: Full=Prolyl-tRNA synthetase;       
  281::368     1e-04  31%  479 aa  SYP_MYCH2 RecName: Full=Prolyl-tRNA synthetase;       
   38::143     1e-04  30%  488 aa  SYP_BORBZ RecName: Full=Prolyl-tRNA synthetase;       
   38::143     1e-04  30%  488 aa  SYP_BORBU RecName: Full=Prolyl-tRNA synthetase;       
   15::116     1e-04  25%  424 aa  SYH_SHEPA RecName: Full=Histidyl-tRNA synthetase;       
  321::397     1e-04  30%  426 aa  SYH_PROM0 RecName: Full=Histidyl-tRNA synthetase;       
   34::163     1e-04  29%  406 aa  SYH_NITSB RecName: Full=Histidyl-tRNA synthetase;       
   19::114     1e-04  30%  413 aa  SYH_GEOSL RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURVG RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURS3 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURM1 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURCM RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURCJ RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURCH RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURCC RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURCA RecName: Full=Histidyl-tRNA synthetase;       
   21::123     1e-04  26%  446 aa  SYH_BURA4 RecName: Full=Histidyl-tRNA synthetase;       
  140::349     2e-04  22%  426 aa  SYS_PEDPA RecName: Full=Seryl-tRNA synthetase;       
  118::220     2e-04  29%  416 aa  SYS_NAUPA RecName: Full=Seryl-tRNA synthetase;       
  130::258     2e-04  27%  433 aa  SYS_BURCJ RecName: Full=Seryl-tRNA synthetase;       
  130::258     2e-04  27%  433 aa  SYS_BURCH RecName: Full=Seryl-tRNA synthetase;       
  130::258     2e-04  27%  433 aa  SYS_BURCC RecName: Full=Seryl-tRNA synthetase;       
  490::588     2e-04  26%  593 aa  SYP_SYNS9 RecName: Full=Prolyl-tRNA synthetase;       
  490::563     2e-04  25%  600 aa  SYP_PROM5 RecName: Full=Prolyl-tRNA synthetase;       
   45::170     2e-04  27%  478 aa  SYP_CLOBM RecName: Full=Prolyl-tRNA synthetase;       
   45::371     2e-04  29%  478 aa  SYP_CLOBL RecName: Full=Prolyl-tRNA synthetase;       
   45::371     2e-04  29%  478 aa  SYP_CLOBK RecName: Full=Prolyl-tRNA synthetase;       
   45::170     2e-04  27%  478 aa  SYP_CLOBJ RecName: Full=Prolyl-tRNA synthetase;       
   45::371     2e-04  29%  478 aa  SYP_CLOB6 RecName: Full=Prolyl-tRNA synthetase;       
   15::116     2e-04  26%  426 aa  SYH_SHEB8 RecName: Full=Histidyl-tRNA synthetase;       
   15::116     2e-04  26%  426 aa  SYH_SHEB5 RecName: Full=Histidyl-tRNA synthetase;       
   15::116     2e-04  26%  426 aa  SYH_SHEB2 RecName: Full=Histidyl-tRNA synthetase;       
   34::118     2e-04  28%  423 aa  SYH_MOOTA RecName: Full=Histidyl-tRNA synthetase;       
  359::454     2e-04  26%  475 aa  SYH_FLAJ1 RecName: Full=Histidyl-tRNA synthetase;       
   22::116     2e-04  29%  427 aa  SYH_ALTMD RecName: Full=Histidyl-tRNA synthetase;       
  545::701     2e-04  26%  890 aa  SYA_PSYCK RecName: Full=Alanyl-tRNA synthetase;       
  595::694     2e-04  24%  880 aa  SYA_CAUCR RecName: Full=Alanyl-tRNA synthetase;       
  597::679     2e-04  30%  871 aa  SYA_AQUPY RecName: Full=Alanyl-tRNA synthetase;       
  141::220     2e-04  26%  424 aa  SYS_ELUMP RecName: Full=Seryl-tRNA synthetase;       
  130::217     2e-04  29%  433 aa  SYS_BURS3 RecName: Full=Seryl-tRNA synthetase;       
   36::163     2e-04  25%  474 aa  SYP_MYCMS RecName: Full=Prolyl-tRNA synthetase;       
   34::162     2e-04  30%  476 aa  SYP_CENSY RecName: Full=Prolyl-tRNA synthetase;       
   38::143     2e-04  30%  488 aa  SYP_BORGA RecName: Full=Prolyl-tRNA synthetase;       
    9::117     2e-04  28%  419 aa  SYH_THEM4 RecName: Full=Histidyl-tRNA synthetase;       
  353::420     2e-04  35%  428 aa  SYH_SYNS3 RecName: Full=Histidyl-tRNA synthetase;       
   22::150     2e-04  25%  426 aa  SYH_SULTO RecName: Full=Histidyl-tRNA synthetase;       
   15::116     2e-04  25%  424 aa  SYH_MARMS RecName: Full=Histidyl-tRNA synthetase;       
  302::411     2e-04  32%  414 aa  SYH_EHRRW RecName: Full=Histidyl-tRNA synthetase;       
  350::431     2e-04  30%  439 aa  SYH_CLOTE RecName: Full=Histidyl-tRNA synthetase;       
  304::413     2e-04  21%  427 aa  SYH_CHLT3 RecName: Full=Histidyl-tRNA synthetase;       
   21::123     2e-04  25%  446 aa  SYH_BURP8 RecName: Full=Histidyl-tRNA synthetase;       
  458::525     2e-04  31%  571 aa  SYG_METKA RecName: Full=Glycyl-tRNA synthetase;       
  597::679     2e-04  29%  867 aa  SYA_AQUAE RecName: Full=Alanyl-tRNA synthetase;       
  129::300     3e-04  23%  426 aa  SYS_CHLAD RecName: Full=Seryl-tRNA synthetase;       
  314::399     3e-04  39%  527 aa  SYP_SPHAL RecName: Full=Prolyl-tRNA synthetase;       
   34::166     3e-04  25%  596 aa  SYP_PROMT RecName: Full=Prolyl-tRNA synthetase;       
   45::170     3e-04  27%  478 aa  SYP_CLOBH RecName: Full=Prolyl-tRNA synthetase;       
   45::170     3e-04  27%  478 aa  SYP_CLOB1 RecName: Full=Prolyl-tRNA synthetase;       
   15::116     3e-04  26%  426 aa  SYH_SHEB9 RecName: Full=Histidyl-tRNA synthetase;       
  350::409     3e-04  38%  424 aa  SYH_RUBXD RecName: Full=Histidyl-tRNA synthetase;       
  329::425     3e-04  28%  425 aa  SYH_LISIN RecName: Full=Histidyl-tRNA synthetase;       
   17::127     3e-04  24%  427 aa  SYH_CORU7 RecName: Full=Histidyl-tRNA synthetase;       
  320::429     3e-04  25%  430 aa  SYH_CHLAB RecName: Full=Histidyl-tRNA synthetase;       
  506::685     3e-04  24%  859 aa  SYA_VIBF1 RecName: Full=Alanyl-tRNA synthetase;       
  526::729     3e-04  25%  879 aa  SYA_CLOB8 RecName: Full=Alanyl-tRNA synthetase;       
   11::118     3e-04  33%  324 aa  HISZ_CARHZ RecName: Full=ATP phosphoribosyltransferase regulatory
  138::344     4e-04  25%  423 aa  SYS_METBF RecName: Full=Seryl-tRNA synthetase;       
  171::268     4e-04  29%  415 aa  SYS_HELPS RecName: Full=Seryl-tRNA synthetase;       
  463::564     4e-04  26%  565 aa  SYP_LACGA RecName: Full=Prolyl-tRNA synthetase;       
   47::169     4e-04  29%  575 aa  SYPC_CANAL RecName: Full=Prolyl-tRNA synthetase, cytoplasmic;      
   15::116     4e-04  24%  424 aa  SYH_SHEHH RecName: Full=Histidyl-tRNA synthetase;       
   10::118     4e-04  26%  427 aa  SYH_PROMH RecName: Full=Histidyl-tRNA synthetase;       
  348::412     4e-04  26%  430 aa  SYH_PORPU RecName: Full=Histidyl-tRNA synthetase, chloroplastic;   
   11::110     4e-04  30%  409 aa  SYH_METPE RecName: Full=Histidyl-tRNA synthetase;       
   12::114     4e-04  31%  423 aa  SYH_DESOH RecName: Full=Histidyl-tRNA synthetase;       
  343::391     4e-04  37%  430 aa  SYH_ANAMM RecName: Full=Histidyl-tRNA synthetase;       
  343::391     4e-04  37%  430 aa  SYH_ANAMF RecName: Full=Histidyl-tRNA synthetase;       
  524::684     4e-04  25%  872 aa  SYA_MARMS RecName: Full=Alanyl-tRNA synthetase;       
  507::684     4e-04  25%  881 aa  SYA_CALS8 RecName: Full=Alanyl-tRNA synthetase;       
  510::690     4e-04  27%  880 aa  SYA_BACCR RecName: Full=Alanyl-tRNA synthetase;       
  171::348     5e-04  22%  418 aa  SYS_UREU1 RecName: Full=Seryl-tRNA synthetase;       
  171::348     5e-04  22%  418 aa  SYS_UREPA RecName: Full=Seryl-tRNA synthetase;       
  171::348     5e-04  22%  418 aa  SYS_UREP2 RecName: Full=Seryl-tRNA synthetase;       
  184::351     5e-04  23%  428 aa  SYS_SYNE7 RecName: Full=Seryl-tRNA synthetase;       
  138::218     5e-04  26%  422 aa  SYS_METMA RecName: Full=Seryl-tRNA synthetase;       
  171::268     5e-04  29%  415 aa  SYS_HELPY RecName: Full=Seryl-tRNA synthetase;       
  171::268     5e-04  29%  415 aa  SYS_HELPJ RecName: Full=Seryl-tRNA synthetase;       
  171::268     5e-04  29%  415 aa  SYS_HELPG RecName: Full=Seryl-tRNA synthetase;       
  171::268     5e-04  28%  415 aa  SYS_HELAH RecName: Full=Seryl-tRNA synthetase;       
  144::351     5e-04  27%  460 aa  SYS_HALWD RecName: Full=Seryl-tRNA synthetase;       
  130::258     5e-04  26%  433 aa  SYS_BURVG RecName: Full=Seryl-tRNA synthetase;       
  280::368     5e-04  33%  481 aa  SYP_CHLCH RecName: Full=Prolyl-tRNA synthetase;       
  325::394     5e-04  31%  420 aa  SYH_THEP1 RecName: Full=Histidyl-tRNA synthetase;       
   35::166     5e-04  28%  421 aa  SYH_NITEC RecName: Full=Histidyl-tRNA synthetase;       
   35::116     5e-04  30%  414 aa  SYH_MYCGE RecName: Full=Histidyl-tRNA synthetase;       
  302::398     5e-04  32%  414 aa  SYH_EHRRG RecName: Full=Histidyl-tRNA synthetase;       
   20::115     5e-04  28%  424 aa  SYH_DESHY RecName: Full=Histidyl-tRNA synthetase;       
   20::115     5e-04  28%  424 aa  SYH_DESHD RecName: Full=Histidyl-tRNA synthetase;       
   19::175     5e-04  25%  429 aa  SYH_COREF RecName: Full=Histidyl-tRNA synthetase;       
  333::429     5e-04  22%  430 aa  SYH_CHLFF RecName: Full=Histidyl-tRNA synthetase;       
   23::164     5e-04  24%  423 aa  SYH_CARHZ RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIBY RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIBT RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIBS RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIBC RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIB5 RecName: Full=Histidyl-tRNA synthetase;       
   14::117     5e-04  27%  430 aa  SYH_ACIB3 RecName: Full=Histidyl-tRNA synthetase;       
  130::232     6e-04  30%  434 aa  SYS_RALEH RecName: Full=Seryl-tRNA synthetase;       
  469::550     6e-04  25%  574 aa  SYP_BUCBP RecName: Full=Prolyl-tRNA synthetase;       
   10::116     6e-04  24%  422 aa  SYH_VESOH RecName: Full=Histidyl-tRNA synthetase;       
   10::117     6e-04  26%  419 aa  SYH_THIDA RecName: Full=Histidyl-tRNA synthetase;       
   28::115     6e-04  30%  420 aa  SYH_THEYD RecName: Full=Histidyl-tRNA synthetase;       
  343::402     6e-04  25%  426 aa  SYH_THEAC RecName: Full=Histidyl-tRNA synthetase;       
  353::404     6e-04  33%  441 aa  SYH_SYNPW RecName: Full=Histidyl-tRNA synthetase;       
   15::116     6e-04  24%  424 aa  SYH_SHEDO RecName: Full=Histidyl-tRNA synthetase;       
  329::434     6e-04  27%  436 aa  SYH_PYRKO RecName: Full=Histidyl-tRNA synthetase;       
  344::425     6e-04  27%  426 aa  SYH_MICAN RecName: Full=Histidyl-tRNA synthetase;       
   14::175     6e-04  23%  429 aa  SYH_CORGL RecName: Full=Histidyl-tRNA synthetase;       
   13::119     6e-04  27%  438 aa  SYH_BLOPB RecName: Full=Histidyl-tRNA synthetase;       
 1273::1398    6e-04  26% 1714 aa  SYEP_DROME RecName: Full=Bifunctional aminoacyl-tRNA
  133::220     8e-04  28%  431 aa  SYS_LEPCP RecName: Full=Seryl-tRNA synthetase;       
  171::268     8e-04  29%  415 aa  SYS_HELP2 RecName: Full=Seryl-tRNA synthetase;       
  143::350     8e-04  24%  456 aa  SYS_HALLT RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURPS RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURP6 RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURP1 RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURP0 RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURMS RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURMA RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURM9 RecName: Full=Seryl-tRNA synthetase;       
  130::258     8e-04  26%  433 aa  SYS_BURM7 RecName: Full=Seryl-tRNA synthetase;       
   38::170     8e-04  26%  609 aa  SYP_SYNJB RecName: Full=Prolyl-tRNA synthetase;       
   42::188     8e-04  26%  480 aa  SYP_SOLUE RecName: Full=Prolyl-tRNA synthetase;       
   15::116     8e-04  24%  424 aa  SYH_SHEFN RecName: Full=Histidyl-tRNA synthetase;       
    9::116     8e-04  25%  432 aa  SYH_RALSO RecName: Full=Histidyl-tRNA synthetase;       
   55::186     8e-04  26%  456 aa  SYH_RALEJ RecName: Full=Histidyl-tRNA synthetase;       
  327::429     8e-04  28%  431 aa  SYH_PYRHO RecName: Full=Histidyl-tRNA synthetase;       
   10::116     8e-04  25%  425 aa  SYH_PHOLL RecName: Full=Histidyl-tRNA synthetase;       
   35::116     8e-04  29%  414 aa  SYH_MYCPN RecName: Full=Histidyl-tRNA synthetase;       
   22::196     8e-04  27%  419 aa  SYH_METFK RecName: Full=Histidyl-tRNA synthetase;       
  344::426     8e-04  33%  429 aa  SYH_CYAP4 RecName: Full=Histidyl-tRNA synthetase;       
   55::186     8e-04  26%  456 aa  SYH_CUPTR RecName: Full=Histidyl-tRNA synthetase;       
   27::137     8e-04  23%  443 aa  SYH_CORJK RecName: Full=Histidyl-tRNA synthetase;       
  496::576     8e-04  29%  618 aa  SYG2_YEAST RecName: Full=Glycyl-tRNA synthetase 2;       
  399::549     8e-04  25%  734 aa  RELA_BACSU RecName: Full=GTP pyrophosphokinase;       
   43::177     5e-11  37%  458 aa  SYTC_ARATH RecName: Full=Probable threonyl-tRNA synthetase,(query 4->142)
    1::649

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
SYT_LACS1       MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
SYT_LACPL       MASINVKFPDGAEKQFDAGVTTEAIAKSISPSLAKRSVAGKFNDQIVDYRQPLTTDGSIEIIAADSEDGL
SYT_LACSS       MAEIQLTFPDGAQKTFEQATSLLDVAKSISTSLAKKAIAGKFNGEVVDLQQPLLEDGAIEIITKDDQANL
SYT_PEDPA       MTEINIEFPDGSVKPFEQGVSILDIAKSISTSLAKKAVAGKINGALVRLDQAINENVKIEIVTKDSEDGN
SYT_LACBA       MADISIKFPDGAVKAFPAGTTPADVAKSISISLAKKAVAAKLDGQLVDYLTPLASDGSIEIVTKDSDDGL
SYT_LACCB       --ALDITFPDGNVKQFPDGTTVKAITEGISNSLAKKAVAGKLDGDLIAYDEPIAHSGQLQIMTKDDAEGL
SYT_LACC3       --ALDITFPDGNVKQFPDGTTVKAITEGISNSLAKKAVAGKLDGDLIAYDEPIAHSGQLQIMTKDDAEGL
SYT_ENTFA       --SIHITFPDGAVKPFDSGITTFDVAKSISNSLAKKALAGKFNGVLIDLDRPIVEDGSLEIVTPDHEDAL
SYT_STRTD       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDAL
SYT_STRT2       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDAL
SYT_STRT1       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRVITEDGSIEIVTPDHEDAL
SYT_STRMU       ---IKITFPDGAVREFEIGTTTSEIAESIXXXXXXXXXXGKFNGQLIDTTRAITQDGSIEIVTPDHEDAL
SYT_STRGC       ---IKITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRU0       ---INITFPDGAVREFESGITTFDIAQSISNSLAKKALAGKFNGQLIDTNRPIDTDGSIEIVTPDHEDAF
SYT_STRA5       ---IKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDAL
SYT_STRA1       ---IKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDAL
SYT_STRA3       ---IKITFPDGAIREFESGITTFEIAQSISNSLAKKALAGKFNGQLIDTTRAIEEDGSIEIVTPDHEDAL
SYT_LEUMM       MAEISLTFPDGAIKKFDEGIKPIGVAESISKSLAKKSVSGKINGSYIGMNDVITESGDFQLITTSDSEAL
SYT_STRSV       ---IKITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGAIEIVTPDHEDAL
SYT_STRZJ       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRZT       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRZP       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRPI       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRP7       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRP4       ---INITFPDGAIREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRPJ       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRPN       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRR6       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_STRP2       ---INITFPDGAVREFESGVTTFEIAQSISNSLAKKALAGKFNGKLIDTTRAITEDGSIEIVTPDHEDAL
SYT_LACLS       ---IKITFPDGNIKEFESGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSDFEIVTPDHEDAL
SYT_STRS7       ---ITITFPDGAVREFESGVTTFEIADSIXXXXXXXXXXGKFNGQLIDTTRAIEEDGSIEIITADHEDAF
SYT_STRSY       ---IKITFPDGAVREYQAGVTTFEIAESIXXXXXXXXXXGKFNGKLIDTTRAIDEDGTLEIVMPDHDDAL
SYT_STRS2       ---IKITFPDGAVREYQAGVTTFEIAESIXXXXXXXXXXGKFNGKLIDTTRAIDEDGTLEIVMPDHDDAL
SYT_LACLM       ---IKITFPDGNIKEFESGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSNFEIVTPDHEDAL
SYT_LEUCK       MSEISLTFPDGAVKVFPEGTTPLPVAESIXXXXXXXXXXXXXHGAYVGMHDMIPASGDFQLITTSDDEXX
SYT_STRPF       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRPG       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRPC       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRPB       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRP8       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRP1       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRP3       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRPZ       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STRPM       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STAAW       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAAT       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAAS       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAAR       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAAE       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAAC       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAA9       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAA3       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STAA2       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_LACLA       ---IKITFPDGNVKEFEAGVTTFEIAKSISPSLAKKTLAGKVNGKLIDATRAINEDSNFEIVTPDHEDAL
SYT_STACT       MDKINITFPDGNSTEFDKGITTEEIAQSISPGLRKKAVAGKFNDKMVDLTRPLEEDGSIEIVTPGSDEAL
SYT_STRP6       ---IKITFPDGAVREFESGVTTFDIAEXXXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STAA8       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEAL
SYT_STRPD       ---IKITFPDGAVREFESGVTTFDIAESIXXXXXXXXXXGKFNDQLIDTTRAIEEDGSIEIVTPDHKDAY
SYT_STAAN       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEAL
SYT_STAAM       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEAL
SYT_STAAB       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPVSEEAL
SYT_STAA1       MEQINIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIGIVTPGSEEAL
SYT_STAS1       MDQIKIKFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKLNGQLIDLTRPIESDGDIEIVTPGSDEAL
SYT_ANOFW       ---VKITFPDGAVKEFPKGVTTEDIAASISPGLKKKAIAGKLNERMIDLRTPIEEDGAISIITQDMPEAL
SYT_LACH4       --SFSITLPDGSKKDFEESLTIADLAQNIATSLGKAAVAGKVNGELKPLDYKLDSDSEVAIITNKDEEGL
SYT_GEOSW       ---IRITFPDGAVKEFPKGTTTEQIAASISPGLKKKAIAGKLNDRFIDLRTPIQEDGSISIITQDMPEAL
SYT_LISMO       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_LISIN       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_LISMH       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_LISMF       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_LISMC       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_LISW6       ---MKITFPDGAVKEFEPGVSTADIAASISPXXXXXXXXXXXXXXXXDLVTPIHEDGAIEIVTPDHEDAL
SYT_GEOKA       ---IRITFPDGAEKEFPKGTTTEDIAASISPGLKKKAIAGKLNGRFVDLRTPLHEDGELVIITQDMPEAL
SYT1_BACSU      ---VKITFPDGAVKEFAKGTTTEDIAASISPGLKKKSLAGKLNGKEIDLRTPINEDGTVEIITEGSEEGL
SYT_STAEQ       MNQINIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIEIITPGSEEAL
SYT_LACAC       --SFSVTLPDGSKKEFDKAVSVKEVASSIATSLGKAAVGAKVNGQVKPLDYEIDSDVEIAIITDKDEEGL
SYT_STAES       MNQINIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIEIITPGSEEAL
SYT_BACA2       ---INITFPDGAVKEFPKGTTTEDIAASISPGLKKKSLAGKLNGQEIDLRTPIQEDGAVEIITEGTEEGL
SYT_LACGA       --SFSVTLPDGSKKDFDKAVSVKELASSIATSLGKAAVGAKINGEMKPLDYVVDEDVEAAIITDKDEEGL
SYT_LACJO       --SFSVTLPDGSKKDFDKAVSVKELASSIATSLGKAAVGAKINGVMKPLDYIVDEDVEAAIITDKDEEGL
SYT_ACHLI       ---IKVTFPDGNIKSYKKGITVLEVAEDISISLAKKIVAAKFNEDLVEISRKLEHDGKLQLLTPKEELSF
SYT_OCEIH       MADLSIIFPDGSEKQFPVGTTGEEIAASISPGLKKQALAIKLDGELVDLRRELSSGGSIEIITYKNNEGL
SYT_EXISA       MYMIQLTFPDGAVKEFEAGVTAEDVAGSISPGLRKKAIAAKLDGELIDYRRPIEHDGKIELVMPDSEDGL
SYT_BACHD       ---INITFPDGAVKEFPKGTTTAEIAGSISPGLKKKALAGMLDGTLLDLNTPIEQDGTITIVTPESDEAL
SYT_AYWBP       ---IKISFFDNQIQEFISGTTPLAIWKEHLSEHFKKPVAALFNNQPIELDFPLKKNGNLEILTESDPKSL
SYT_PHYMT       ---IKIKLKNGLEEYFSCGTDVLTIIKKYLKKSEKTAVAAFFNQKLIELNTPLKEDGTLEIINFKHIESL
SYT_PHYAS       ---IKINLLNHQSHSFPSKTTPLEIWKNWLKKTLKKPVAALFNQKFIELDYPLTQDGDLEILAESNPKSL
SYT2_BACSU      ---VHIQLPDGQIQEYPKGITIKEAAGSISSSLQKKAAAGQVNGKLVDLSFKLEEDAELSIVTLDSQEGL
SYT_BACFR       ---IKITFPDGSVREYNEGVNGLQIAESISSRLAQDVLACGVNGEIYDLGRPINEDASVVLYKWEDEQGK
SYT_BACFN       ---IKITFPDGSVREYNEGVNGLQIAESISSRLAQDVLACGVNGEIYDLGRPINEDASVVLYKWEDEQGK
SYT_DESRM       ---IKITLKDGSVREYAVGTTVLEVAKSISQGLAREALAGKVNGKIVDLEYPLKEDAALELLTFNDEEGK
SYT_CLOTH       ---IKITLKDGSVREYNEGITIKEVAESISAGLARVALAGEVNGEVKDLSYPLENDCTLNLLTFDDEGGR
SYT_BACTN       ---IKITFPDGSVREYNEGVNGLQIAESISSRLAQDVLACGVNGETYDLGRPINEDADFVLYKWDDEEGK
SYT_PARD8       ---IKITFPDNSVREYAKGTTAMQIAESISSRLAQEVLAASVNGEVWDLSRPINDDATVKLLKWEDEEGK
SYT_CHLT3       ---IKLTLPNGDVRAYPKGVTGSEVAASIGKRLAEDALAIKFGGKLKDLAFPIQQDGAIEIVTFDSDEGK
SYT_PELCD       MVMIQIELPDGSIKEFSETTTPGDIAAGIGSGLARQAVAARFNDRMVDLCTPITESGRLEIITLNSPQGL
SYT_CARHZ       ---ISLKFPNNEVREFPENITALEVAKTLSPRLAKEALCASINGKLIDLSQKISESGEFRLYTFEDDEGK
SYT_CLONN       ---IKITLKDGKVLEVEKGLTVSEIAARISTSLRKKALGAKINGEKAELMDVINEDSTLEILTFEDQEGK
SYT_THETN       VKAMVITLRDGTKREFEKGITVYEIAKSISDKLAREAVGGKFNGKIVELNTKIEEDGELEILTFEDEEGK
SYT_PROA2       -TQVTVTLPDGESRSFPFGTTGYDIARSIGKKLAQDALAVVINGRAQDLDSPVSEDASIEIVTFDHPLGK
SYT_THENN       ---IKVVLPDGSEREYEKGTKPMEIAREVGI---KKVIGAVVDEELWDLKRPLERDCRIRFVTLEDPEAP
SYT_BACV8       ---IKITFPDGSVREYNEGVTGLQIAESISSRLAQDVLACGVNGETIDLSRPINEDANFVLYKWEDEQGK
SYT_CHLL2       -ASIAITLPDGTVKNVPSGSTGFDIALSIGKRLADDALAVTINGKPTDLHAPVLCDANIEIVTFDSQLGR
SYT_THEP1       ---IKVKLPDGKEKEYDRGITPAEIAKELGV---KKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAP
SYT_THEMA       ---IKVKLPDGKEKEYDRGITPAEIAKELGI---KKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAP
SYT_RUBXD       -----VRLPDGKELEVGSGERLEDVARRIGPRLARDAVVARLNGRLVDLDLPVDGGGELEFVTADSPEGL
SYT_CLOTE       ----------------------SDIVMKISPALYKKAVGAKINGEIAELMTEIKEDSELEILTFDDEEGR
SYT_CLOBB       ---IKVTLKDGSVKEFEAGLSVYEIAKSISEGLARNACCGVVNGKVCDLREEVKEDVSLSICTFDSQEGK
SYT_THESQ       ---IKVKLPDGKEKEYDRGITPAEIAKELGV---KKAIGAVVNGELWDLKRPIENDCELRLVTLEDPEAP
SYT_CLOK5       ---IKISLKNGKEIEVEKGLKVIDIAAKLSISLSKKALGAVVDGKVVELNYKINKDCKVEILTFEDEEGK
SYT_CLOK1       ---IKISLKNGKEIEVEKGLKVIDIAAKLSISLSKKALGAVVDGKVVELNYKINKDCKVEILTFEDEEGK
SYT_CLOB6       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_CYTH3       ---IKITLPDGSIREYEKGITSMGIALSISEGLARNVLAAKVNGEIWDASRAITSDSTVQLLTWNDTEGK
SYT_CLOBM       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_PROVI       --TLTVTLPDGTTKPLPAGSTGMDIALEIGRRLAREAVAIKIDGKAVDLSAPLTADCTAEIITFDSPEGK
SYT_CLOBA       ---IKVSLKDGSVKEFEAGLSVYEIAKSISEGLARNACCGVVNGKVCDLRNKINEDVSLSICTFDSQEGK
SYT_CHLTE       -----ITLPDGSERTYSSGVTGLEIAESIGKKLAEAALAFTIDGKPRDLDTPVTENARVSIITFDSPEGK
SYT_CLOBL       ---IKITLKDGKVMEIEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_AZOPC       ---IKITFPNTSARNYAIGTTPMQIAESISCRLAEEILSANVNGEMWDLSRPINENASVKLYKWEDFEGK
SYT_CLOBK       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETMDLMTELHKDSSLEILTFEDEMGK
SYT_FLAPJ       ---IKITLPDGSIKEFENGVTPMDVAKSISEGLARNVISAAFNNITVEISTELTTDGSLVLYTWNDKDGK
SYT_CLOBJ       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_CHLPB       -ATVTVTFPDGRNMSIPSGSSGYDIAQSIGHSLAREALAIRINGELADLGTAVTDDATVEIITFDGATGK
SYT_CHLCH       --AIALTLPDRSVRNVAMGSTGYDVALSIGRKLAQDALAIKLNGVVCDLNTLINSDAAIEIITFTSPEGP
SYT_SULSY       ---------------FNEGITLKDILKNLNGKF-KDVVGGKLNGEIIDIHTPINQSGNLKFLKKEDKESL
SYT_PELPB       LAVIALTLPDGSVKTFPIGTTGNDVALSIGRKLAQDALALRVNGVAIDLSTPLTADAAIEIITFSSPAGQ
SYT_CLOBH       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_CLOB1       ---IKITLKDGKVMEFEEGIKISDIAMKISPALYKKALAAKIDGETVDLMTELHKDSSLEILTFEDEMGK
SYT_SYNWW       ---ISIRLKDGSQREYPEGISLLQVAEDISPKLAKNAMAAVFNGKISDLNSQVKEDGCLELLDFEDERAR
SYT_FLAJ1       ---IKITLPDGSIREFAQGVTPMEVAKNISEGFARNVISASFNGXXXXXXXXXXXDGNLILYTWNDAEGK
SYT_UREU1       ----------------------------------------------------------------------
SYT_ACIF5       -----IQLPDGSHRQFAEPVTGLTLARAIGSGLARAAVAMRVDGILKDLSAVLDQDAEVAIVTRDSADGL
SYT_ACIF2       -----IQLPDGSHRQFAEPVTGLTLARAIGSGLARAAVAMRVDGILKDLSAVLDQDAEVAIVTRDSADGL
SYT_UREPA       ----------------------------------------------------------------------
SYT_UREP2       ----------------------------------------------------------------------
SYT_PELPD       MSSISIALPDGSKREIASGSTIADXXXXXXXXXXXXXXXXXXDGELVDLSTELKDDSRVEIITEKSPEAL
SYT_THICR       -----ITLPDGSKRAFEDAVTVMQVASDIGAGLAKATIAGRVNGQLKEASDLITEDAELQLITLKDEDGL
SYT_FINM2       ----EVKLKDGSAKEFDGEISLLDVCKSISEGLARDCVGAVVDGKIMGLMETIDSDCEVQFVKFDDDEGK
SYT_THISH       -----ITLPDGSERRFDAPVTVRDVXXXXXXXXXXXXXXXRVNGRLVDTSHLIEDDASLAIITDRDPEGL
SYT_AQUAE       -------------KEYEVEKGTP-LGKIFELAGIKDALGGVINGKIIDLQTPVRESGEIKPVYRGSKESL
SYT_GEOBB       MNEINVTLPDGSQRPLPAGASIFDXXXXXXXXXXXXXXXXXXDGNLVDLNTPLADGARVEIITEKSPEAL
SYT_GEOSM       MNEINVTLPDGSQRPLPAGASIFDXXXXXXXXXXXXXXXXXXDGNLVDLNTPLADGARVEIVTEKSPEAL
SYT_PORG3       ---IKITFPDGNFREYEAGITGWDIAGSISPRLQQDVLAAGVNGQVWDLHRPINEDAEVKLFKWDDAEGK
SYT_NATTJ       ---LKITLKDGSVKEIEKGSNVLDLAKSISNRLAKEAVGAKVDGKTVGLNKELNENCEVEILSFEDDEGC
SYT_ACIC5       ---IQVTLPDGTVKTFPAGTTPFQVAESISPRLAQAAVVARIXXRLVDLSTPLEEDVQLALLTEKDPEAL
SYT_CLOD6       ---IKVALKDGSIKEFENAISVMDVAKSISEGLARNVVAASVNGEVVGLDHIIDTDCDLNLFKFEDKEGK
SYT_PORGI       ---IKITFPDGNFREYEAGITGWDIAGSISPRLQQDVLAAGVNGQVWDLHRQINEDAEVKLFKWDDAEGK
SYT_CLOAB       ---IKVTLKDGKVMEFENTTTPGDVAKAISPGLYKKAISAKINGKRAELMTNIDKDCNLEILTFDDEDGK
SYT_NITOC       -----ITLPDGSQRSFDHPVTVYDVAADIGPXXXXXXXXXXIEGRLVDSSYPLEKDTKLTIITERDMDGL
SYT_HALHL       -----ITLPDGSVKAFDHPVTTREIAESIGRKLAKDAIVGRVDGELIDLDRPIEHDAYVEIVTSNDPDGL
SYT_KOSOT       ----KIELPDGSIKEYDHPVTAADVAADLSPALAKRAIGVEVNGELWDLTRELPEECKINLILEKDPRAP
SYT_THELT       -----------------------------------EVIAAVFNGKLIDLRSTIDSDGEVEFVDLFHELAP
SYT_THET8       -----VYLPDGKPLELPEGATAKDVARALGEGWERRAVGAIVDGELYDLLKPLPQGAKVRLLTEKDPEFQ
SYT_SACD2       -----ITLPDGSKREYDAPISVMGVAADIGPGLAKATLAGVVDGKEVDASFEITQDVSLSIITAKSEEGL
SYT_DEIDV       -----VVLPDGKQLELPMGATALDAASAIGPRLAQDALAATANGELVDLMTPLPDGASITLITKKNPGDA
SYT_GEOSL       MGDIRVTLPDGSERILAEGATVRDXXXXXXXXXXXXXXXXXXDGVQVDVTAPLTDGARVEIITDKSADGL
SYT_FUSNN       -----------------------EIAKGISNSLAKKSVGAKVDGKNVDMSYILDHDAEVEFIDIDSPEGE
SYT_PSYWF       ---VAITLPDGNVKEFDGATTVMEVAQSIGPGLAKATIAGRVDGKLVDASDPITQDASVEIVTAKDKDGV
SYT_MARAV       -----ITLPDGSHRSFAEPVTVHDVXXXXXXXXXXXXXXXXXXXXXVDTSHLIENDTELAIVTERDEDGV
SYT_LEGPH       -----VKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSL
SYT_LEGPC       -----VKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSL
SYT_LEGPA       -----VKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSL
SYT_HALSA       MSSVTVTLPDGSTLEVASGATVEDVAHEIGPGLGRDTVAGKIDHELVAKEEPISEDCEIEIVTDQSDEYL
SYT_HALS3       MSSVTVTLPDGSTLEVASGATVEDVAHEIGPGLGRDTVAGKIDHELVAKEEPISEDCEIEIVTDQSDEYL
SYT_COXBU       -----IQLPDGSVKQFSKPVSVQAVAESIGTSLAKPALAGKIDDHLVDVSFIIDKDVSLRIITEKDPEGL
SYT_DEIRA       -----VTLPDGKQLDLQPGATALDAAKAIGPRLAQDALGATANGELTDLMTPLSDGASITLITKKNPGDA
SYT_THET2       -----VYLPDGKPLELPEGATAKDVARALGEGWERRAVGAIVDGELYDLLKPLPQGAKVRLLTEKDPEFQ
SYT_TERTT       -----ITLPNGSKREFSNPITVLDVAADIGPGLAKATLAGIVDGKEVDAGFTIEQDAALSIVTEKSPEGL
SYT_DESVM       ---------EGQVFDVQSGVSCRDALKALSGKKFKNVVACRCNGTPLDLTATVPADTTIEPVFADSPEGI
SYT_ANADE       ---VKVTLPDGSQKEAPRGTPVIDFVKGIGAGLAKAAYFAKLDGAPVDLSRALDRDARLEIVTTRSPEAL
SYT_BDEBA       MSQITIILPDNSTKVFDHEPTALEVAMSIGPRLAKETLGAKLNGSISDLRTVLKDQTKVALVTTKSPESV
SYT_HAHCH       -----ITLPDGSKREFSNPVTVLDVAADIGPGLAKAAVAGKVDGTLVDCSHVIDKDAELAIVTERDAEGV
SYT_METCA       -----VTLPDGSRREFDHPVTLLQVAEAIGPGLAKAALAGRVDGRLVDLSHRIEADAEVALVTARDADGV
SYT_ACICJ       -----ITLPDGSVRDYPGPVTGTEIAASIGPGLAKAALAMEVDGKMMDLSRTLDADARLRFITRRDADSL
SYT_DINSH       MAQISLTFPDGNARDFDAGVTPAEVAASISTSLGKKAISATVNGAHHDLQWPIDADASIAIHTKDDAQAL
SYT_RICFE       ---INISFPDGSVKQFESNITAFEVANAISMSLAKAAMVAEINGELKDLSTIIENDCKLRILTAKDSECL
SYT_DESDG       ------------------------LKQALSGKKFKKVLAARCGGTMLDLTATVPTAETLEPVYADSPEGL
SYT_CLOPS       ---IKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQ
SYT_RICTY       ---INISFPDGSVKQFAQNITAFEIANAISMSLAKAAMVVEINGEFKDLSTVIEHDCKLRILTAKDYECL
SYT_PARL1       ---IKLKLPDGSVREHEVPLDGLAFAESIAKSLAKKAVAIKIDGQMKDLSTVIDRDAEVEIVTRETPDGV
SYT_DESOH       ---ITITLPDSSTKTFDGPVTGEQIAKSISEGLWRECVAVEVDGAAMDLSEPIATDAAVRLITTRDPEGL
SYT_FRAP2       ---INIKFPDGSIREFESGVNSLQIAKSISPSLAKITVGAYIDNKLSDAKDVINHDCELRLITTKDTEGL
SYT_CLOPE       ---IKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQ
SYT_CLOP1       ---IKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQ
SYT_LEGPL       -----VKLPDGNVKHFEAPLTIYDVAHHISPGLAKAAIAGRVDGVLVDTSYLIKEDCSLIIVTEKHEDSL
SYT_RALPJ       ---IAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXRVDGQMVDTSYTIDHDAKLAIITDKDADGV
SYT_SYMTH       -SVVHVTLPDGSVREYPQGITIAEAVAQIGPRLAKAALAAKVDGRLVDLSARLEKDCTLQVLTFKDEEGR
SYT_DESAH       ---INITLPDDSIKSFKEYPKGMDVARGISEGFARNCVAMEIDGQLLDLDVEIRNDCAVRLITTRDAEAV
SYT_VIBHB       -----ITLPDGSQRQFDNPVSTMEVAQSIGPGLAKATIAGRVNGNRVDACDLIEEDASLEIITKDEVDGL
SYT_DESVV       ---------EGQMLEVASGASCGDALKALSGKKFKNVLACRLDGGLVDITATVPDGTTIEPVYADSPEGL
SYT_DESVH       ---------EGQMLEVASGASCGDALKALSGKKFKNVLACRLDGGLVDITATVPDGTTIEPVYADSPEGL
SYT_FRATN       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATVAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_DESAA       ---INITLPDGKIVESDGPVSGEDVAKGISEGFARNCVAVEVDGKLTDLSTPIETDASVVFITTKDEQGL
SYT_PETMO       ---VKITYPDNSVQEFKDGITPAEIAKGISEGLYRNAIAAEINGELKDLNTPIMQDSTIKLITLDDEIAP
SYT_CELJU       -----ITLPDGSQRSFDKPVSVYEVAASIGPGLAKATLGGRVNGQRVDAHDLISEDANLVIFTPKDDDGL
SYT_ANASK       ---VKVTLPDGSQKEAPRGTPVIDFVKGIGPGLAKAAYFARLDGEPVDLSRAIERDARLEIVTTRSPEAL
SYT_FRATW       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_FRATT       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_FRAT1       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_FRATM       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_RICAH       ---INISFPDGSVRQFENDITAYEVANAISMSLAKAAMVAEINGELKDLSTVIENDCKLRILTAKDSECL
SYT_ANAD2       ---VKVTLPDGSQKEAPRGTPVIDFVKGIGPGLAKAAYFARLDGEPVDLSRAIERDARLEIVTTRNPEAL
SYT_NITEC       -----VRLPDGTDKVFDYPVTVLDVAESIGPGLARVALAGKLNGRLVDLSEPIEIDSDLVLITNKDPEGL
SYT_VIBPA       -----ITLPDGSQRQFDNPVSTMEVAQSIGPGLAKATIAGRVNGNRVDACDLIEEDASLEIITKDEVDGL
SYT_PROM1       -----ITLPDGSEKNYESSVTIEKIATDIGPGLAKAALAGRVNGNLLDTCIPITNDAEIQIITSKDNEGL
SYT_MYXXD       ---ITVTLPDGSQKQTARGTTIADVRESIGPGLAKAALFARVNGQDMDLARKLDEDVKLQIFTPKSPESL
SYT_VIBVY       -----ITLPDGSQRQFDNSVSTMDVALSIGPGLAKATIAGRVNGQRVDACDLIEEDASLEIITKDEVDGL
SYT_RICPR       ---INISFPDGSVKQFAQNITAFEIVNAISMSLAKAAIVVEINGELKDLSTVIENDCKLRILTAQDYECL
SYT_METFK       -----IRLPDGSERKFDGPVTVAEVAMNIXXXXXXXXXXXKVNGKAVDTSYLITDDADLSIITDRDAEGL
SYT_GLUDA       -----ITLPDGSVRRFDGPVTGTMVAESIGPGLARAALAMEVDGALVDLSREIADDASVRFITRKDDAAL
SYT_NITEU       -----VRLPDGTDRVFDNSVTVREVAESISPGLARAALAGKLNGKLVDLSEQIETDSDLVLITDKDSEGL
SYT_WOLWR       ---IRITFSEQKVKEYSGKVTGFDILQP---DVLKEAIAFKVNGELHDLSREIEADAEIEVIQLSDEAGL
SYT_VIBVU       -----ITLPDGSQRQFDNPVSTMDVALSIGPGLAKATIAGRVNGQRVDACDLIEEDASLEIITKDEVDGL
SYT_FRATO       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_FRATH       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_FRATF       ---INIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLITVKDPEGL
SYT_RICBR       ---INISFPDGSVKQFEKNITAFEIAVVISTSLAKAAMIAEINGDLKDLSTQIDNDCRLRILTAKDPECL
SYT_GLUOX       -----ITLPDGSVRTFDGTVTGTTIAASIGPGLAKAAMAMEVDGKPVDIGTEISSDASVKFITRKDEDAL
SYT_RICB8       ---INISFPDGSVKQFEKNITAFEIAVVISTSLAKAAMIAEINGDLKDLSTQIDNDCRLRILTAKDPECL
SYT_RHORT       ---VAISLPDGSVRSYEGPVTGRQIAEDIGPGLAKAALAVTIDGTMKDLSVPITTDASVSLITARDAAAL
SYT_PROM4       -----ITLPDGTKKEFSGSITIADIASDIGPGLASAAIAGKVNQDLVDISIPIDYDAEIKIITAKDKEGV
SYT_RICCN       ---INISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAQDPECL
SYT_RICAE       ---INISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAKDPECL
SYT_RICPU       ---INISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKLRILTAKDPECL
SYT_LAWIP       ---------------------------------SKNIVGYNINGSIIDLFTPLPTITKEVIITIDSEDGL
SYT_BORA1       ---VQITLPDGSQRQYPGPVTVAEVAQSIGTGLAKAALAGRVTVNLVDTSFRIDQDAKLAIVTAKDADGL
SYT_MARMS       -----ITLPDGSQRSFSNPVTVMQVAEDIGPGLAKATVAGRIDGQLVDACELISDDAKLSIITGKDPEGV
SYT_RICRS       ---INISFPDGSIKQFAKNITAYEVANAISMSLAKAAMVAEINGELQDLSIVIDNDCKFRILTAKDPECL
SYT_NEIMB       ---LNITLPDGSVRQYESPVTVAQIAASIGAGLAKATVAGRVNGKLVDACDPIVEDSAVQIITPKDQEGI
SYT_RALSO       ---IAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXRIDGQLVDTSFRIEQNVDLAIVTDKDTDGL
SYT_ALHEH       -----ITLPDGSRREFDHPVTVRDVAESIGKXXXXXXXXXXXXXXXVDLSHRIDDDVQLEIVTDRDPDGV
SYT_RALEJ       ---IAITLPDGSRREFPGPVTVAEVAQSIGTXXXXXXXXXXVDGNLVDTSYSIDRDVALAIITDKDADGV
SYT_PSYCK       ---VAITLPDGSVKNFEGNTTVMEVAQSIGTGLAKATVAGRVDGQLVDAHDPIAHDAKVEIVTPKDDDGV
SYT_CHRVO       -----IRLPDGSVRSFDKPVTVHEVXXXXXXXXXXXXXXXXVDGQLVDTSYLIDRNADLAIVTDKDADGL
SYT_BURPS       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURP6       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURP1       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURP0       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURMS       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURMA       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURM9       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURM7       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_BURS3       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSAVIDRDASLAIVTDKDADGL
SYT_BURPP       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTEKDADGL
SYT_VIBCM       -----ITLPDGSQRHFDNPVSTLEVAQSIGPGLAKATIAGRVNGARVDACDLIEHDASLEIITKDEVDGL
SYT_VIBCH       -----ITLPDGSQRHFDNPVSTLEVAQSIGPGLAKATIAGRVNGARVDACDLIEHDASLEIITKDEVDGL
SYT_RICCK       ---INISLSDGSVRQFEKGMTIYEVANAISMSLAKQAIVAEINGELKDLSTVIENNCKLRILTAKDPECL
SYT_BURTA       ---VSIRLPDGSIRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSALIDRDASLAIVTDKDADGL
SYT_VIBC3       -----ITLPDGSQRHFDNPVSTLEVAQSIGPGLAKATIAGRVNGARVDACDLIEHDASLEIITKDEVDGL
SYT_POLSQ       -----VTLPDGSKREYEAPVRVADVAQSIGSGLAKAALGGIVDGQMVDTSFVIDKDSHLAIITDKSPEAL
SYT_ANAMM       MINITTSFPNKTAAAFHKHVTGSEVASAMFPEIAESIVALFVDGNLQDLATPISKDGSVDPVTIESNTGM
SYT_MAGSM       ---VEIILPDGSSRSYDQELTCGQXXXXXXXXXXXXXXXXVVNGQKVDLDAPVPHGAQVAIITEDSPEGL
SYT_BURXL       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTEKDADGL
SYT_BURP8       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXIDGELVDTSALIDHDVALAIVTDKDADGL
SYT_BURCJ       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGL
SYT_ANAMF       MINITTSFPNKTAAAFHKHVTGSEVASAMFPEIAGSIVALFVDGNLQDLATPISKDGSVDPVTIESNTGM
SYT_RHOCS       ---VSITLPDGGVRTFPRGTTGGQIASAIAKSLGKAALAVKIDGKQRDLALPVEQDCRLEILTRESPEAL
SYT_PHEZH       ---IELVFPDGSKREFPDGVTGREIAAGISKSLEKKAIXXXXXXXXXXXXRPLEKGGAFKILTREAPEAL
SYT_BORPD       ---VQITLPDGSQRQFPGPVTVAEVAQSIGTGLAKAALGGRVEPRLVDTSYRLEHDAQLAIVTAKDADGL
SYT_BRUME       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRAL
SYT_XANCP       MPMITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGV
SYT_XANCB       MPMITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGV
SYT_XANC8       MPMITITLPDGSRREFDAPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDLIEHDASLRIITAKDAEGV
SYT_STRGG       MSDVRVIIQRDSERE-EHVVTTGTTAGELFPG-QRTVVAARIGGELKDLSYELRDGESVEPVEISSEDGL
SYT_ROSDO       MAQISLTFPDGSTREFDAGVTAGDVAASISTSLRKKAISATVGGAHYDLAWPIHADATIAIHTQDEEQAN
SYT_PSYA2       ---VAITLPDGSVKNFEGNTTVMEVAQSIGTGLAKATVAGRVDGHLVDAHDPIVADAKVEIVTPRDDDGV
SYT_DEHSC       ---------------------------------------------------------------------L
SYT_CUPTR       ---IAITLPDGSRREFPGPVTVAEVAQSIXXXXXXXXXXXXVDGQLVDTSYKIERDAELAIVTDKDADGV
SYT_CHRSD       -----VTLPDGSQKTFDSPITVMQLAESIGTGLAKACVAGKIDGVPVDTADVIEHDAEVSILTPRDQEGL
SYT_BURCC       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGL
SYT_PSEPK       -----ITLPDGSQRSFDHAVSVAEVAASIGAGLAKATVAGKVDGKLVDACDLISNDATLQIITPKDEEGL
SYT_BRUAB       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRAL
SYT_BRUA2       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRAL
SYT_BRUA1       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKLEIITREDPRAL
SYT_RALEH       ---IAITLPDGSRREFPGPVTVAEVAQGIXXXXXXXXXXXXVDGQLVDTSYRIDRDAELAIVTDKDADGV
SYT_DEHSB       ---------------------------------------------------------------------L
SYT_BURVG       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDASLAIVTDKDADGL
SYT_BRUSU       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRAL
SYT_BRUSI       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRAL
SYT_BRUC2       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRAL
SYT_AGRRK       --SVSLTFPDGSVRSYDAGATGRDVAESISKSLAKKAVAIAIDGTVRDLSEPVA-DGKIEIITRNDDRAL
SYT_XANC5       ---INITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDVIDHDASLRIITAKDAEGV
SYT_PSEP1       -----ITLPDGSQRSFDHAVSIAEVAASIGAGLAKATVAGKVDGKLVDACDLISNDATLQIITPKDEEGL
SYT_XANAC       ---INITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGQVDGQLVDASDVIDHDASLRIITAKDAEGV
SYT_BRUMB       -NTVSLQFPDGSVREYDASMTGAALAESISKSLAKKAVAYAVDGTVRDLSDPLGASGKVEIITREDPRAL
SYT_BURCM       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDAALAIITDKDADGL
SYT_XANOR       ---INITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGRVDGQLVDASDVIDHDASLRIITAKDAEGV
SYT_XANOM       ---INITLPDGSRREFESPVSVMQVAQSIGAGLAKATIAGRVDGQLVDASDVIDHDASLRIITAKDAEGV
SYT_STRAW       ----------------------------------RTVVAARVGGELKDLAYEVKDGEEVEPVQISSEDGL
SYT_PSE14       -----ITLPDGSQRSFDHVVSVADVALSIGAGLAKATVAGKVDGKLVDACDLIENDASLQIITPKDQEGL
SYT_POLNS       -----VTLPDGSKREFEAPVRVADVAQSIGSGLAKAALGGIVDGKMVDTSFVIDKDSQLAIITDKSPEAL
SYT_BURA4       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSTVIDRDAALAIITDKDADGL
SYT_PSYIN       -----ITLPDGNQRQFDNTTSIMEIAADIGPGLAKACIAGRVDGQLVDACDPIEKDANIAIITAKDDQGL
SYT_NATPD       MSEIVVTLPDGSELEMESGSTVEDVAYEIGPGLGDDTVAGVVDGELVDKAEQLTDDCELVIVTDQSDEYL
SYT_DEIGD       -----VTLPDGKQLDLQAGATALDVARALGPRLAQDALAALVNGELMDLMTPLPEGAQVRLITKKNGDAA
SYT_KLEP3       -----ITLPDGSQRHFDHAVSPMDVALDIGPGLAKATIAGRVNGELVDACDPIETDSTLSIITAKDEEGL
SYT_BURM1       ---VSIRLPDGSVRQYEHPVTVAEVAASIGPXXXXXXXXXXXDGELVDTSAVIDHDASLAIVTDKDPDGL
SYT_VESOH       -----ITLPDGTKKIFEQVVSVEQVAKSMG--LVKAALAGEVDGELVSTSFLIKTDANLTIITANDDQGL
SYT_MARMM       ---INVTLPDGSKRELPDGASPLDXXXXXXXXXXXXXXXXTVDGQDWDLKRPLDGDAQVAIITRKDDKAL
SYT_MAGSA       ---VAITLPDGKVRQFDHPVTGLDVAKDIGPGLAKAALAITIDGEMKDLATLIDRDVNLSIITKSGQDAL
SYT_WOLPM       ---VRVTFSEQKVKEYSGKVTGFDILQPDAL---KEVVALKVNGELYDLSREIEADAEIEVIQLSDEVGL
SYT_DEHE1       ---------------------------------------------------------------------L
SYT_RHISN       --SVSLTFPDGSVREFAAGTTGRDVAESISKSLAKKAVAIALDGELRDLSDPIA-DGKIEIVTREDKRAL
SYT_HYPNA       ---INVTLPDGSKREYAEGASPLDVAESIXXXXXXXXXXXXVDGQMWDLVRPLEGDASVAIITDRDPEGL
SYT_AGRVS       --TVSLTFPDGSVRSFAAGATGRDVAESISKSLAKKAVAIALDGVVRDLADPVV-DGKIEIVTRADPRAL
SYT_SINMW       --SVSLTFPDGSVREFAPGTTGRDVAESISKSLAKKSVAIAIDGELRDLSDPVTE-GRIEIVTREDKRAL
SYT_RHOPA       MDQITITFPDGKTREYPRGTTGLDIAKGISPSLAKRTVVMALNGTLTDLADPIDDNASIDFVARDDARAL
SYT_PROMT       -----ITLPDGTEKKYDSAVTIDQIASEIGPGLAKAALAGRVNGELIDTCIPITQNSHIQIITSKDDEGL
SYT_ECOSE       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_ECOLC       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_ECOHS       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_ECO55       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_ECO24       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_BORPE       ---VQITLPDGSQRQYPGPVTVAEVAQSIXXXXXXXXXXXRVDGRLVDTSFRIDNDAQLAIVTAKDADGL
SYT_BORPA       ---VQITLPDGSQRQYPGPVTVAEVAQSIXXXXXXXXXXXRVDGRLVDTSFRIDNDAQLAIVTAKDADGL
SYT_BORBR       ---VQITLPDGSQRQYPGPVTVAEVAQSIXXXXXXXXXXXRVDGRLVDTSFRIDNDAQLAIVTAKDADGL
SYT_AGRT5       --AISLTFPDGSVRSYPAGTTGREVAESISKSLAKKAVAIALDGTVRDLSETIT-DGKIEIVTREDGRAL
SYT_PROM2       -----ITLPDGSKKVFEKSVTILEIAQSIGAGLAKATIAGKVNDVLLDATIPINSDSKVVIITSKDKEGI
SYT_ACIAC       ---IRITLPDNSQREYAGPVSVADVAQSIGPGLAKMTVAGKVDGRLVDASDVIDHDARLQIITPWDQEGV
SYT_SHIDS       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDTQLSIITAKDEEGL
SYT_PROM9       -----ITLPDGSKKVFEKSVTILEIAQSIGAGLAKATIAGKVNDVLIDATLPIKNDSKVVIITSKDKEGI
SYT_ECO8A       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEDGL
SYT_DESMR       ---MQVTIEDQSLEAAAGEACGQVLSRAVSGKRLKNAVACLVDGQPRDLAFPLPEDAELALVAADSPMGL
SYT_STRMK       ---INITLPDGSRREFENPVSVMEVAQSIGAGLAKATIAGAVDGVLVDASDVIDHDASLRIITAKDEEGV
SYT_RHIME       --SVSLTFPDGSVREFAAGTTGRDVAESISKSLAKKAVAIAISGELRDLSDAVTE-GRIEIVTREDKRAL
SYT_HAES1       -----ITLPDGSQRQFDNPVSVLEVAQSIGSGLAKATIAGRVNGERRDASDMISEDANLEIITAKDEDGL
SYT_STRM5       ---INITLPDGSRREFENPVSVMDVAQSIGAGLAKATIAGSVDGVLVDASDVIDHDASLRIITAKDEEGV
SYT_PROMS       -----ITLPDGSKKVFEKSVTILEIAQSIGAGLAKATIAGKVNDVLLDATIPINKDSKVVIITSKDKEGI
SYT_PROMP       ----EITLPDGSKKVFEKPVTIQEIAQSIGSGLAKATIAGKVNDVLFDATLPIDNDSKVVIITSRDKDGI
SYT_LEPIC       ----QLTLPDKSIKEVASGFTYRDFIEKELPFLKNKALAVRLNGEILDLSRTVEKNSNIEVLTYSEKLGW
SYT_SHISS       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_SHIFL       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_SHIF8       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_SALTI       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_SALSV       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_SALA4       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_RHOS1       MAQISLTFPDGKAREFPAGITPAEVAASISTSLGKKAISASVDGRHYDLQWPIETDAKIAIHTMDEAQAL
SYT_MESSB       -----LTFPDGSVRNVDAAMTGADIAESISKSLAKKAVAYAMDGSLRDLSDPVERSGKIEIITREDPRAL
SYT_LEPIN       ----QLTLPDKSIKEVASGFTYRDFIEKELPFLKNKALAVRLNGEILDLSRTVEKNSNIEVLTYSEKLGW
SYT_ERWCT       -----ITLPDGSQRHYDHAVSPLDVALDIGPGLAKACIAGRVDGELIDASDKIDTDAQLAIITAKDDAGL
SYT_ECOUT       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOSM       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOLU       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOLI       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOL6       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOL5       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOK1       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECODH       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECOBW       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECO81       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECO7I       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECO45       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECO27       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_DESAD       --------------EVQQGALCGEVLKALSKKQFKNVVVAKCGDTLLDLTTTVPADCTLEPVMADSKEGL
SYT_ZYMMO       ---IRITLIDNSEREVLQGXXXXXXXXXXXXXLAKKALAARFNGQMIDLSQPLLEDGRLEIITAENEEAL
SYT_METPP       ---IVITLPDGSQREFPGPVTVAEVAASIGTGLAKAALGGRVDGKLVDTGHRIEGDARLAIVTDKDADGL
SYT_ECO5E       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_ECO57       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_BARBK       --SISLSFPDGSQRDFPAEITGLELAESISKSLAKKAIAYSLNGVIRDLLDPLEQSGQVEIITRDDPRAL
SYT_SYNP6       ----------------------------------------------------------------------
SYT_SYNE7       ----------------------------------------------------------------------
SYT_RHOSK       MAQISLTFPDGKAREFPAGITPAEVAASISTSLGKKAISASVDGRHYDLQWPIETDAKIAIHTMDEAQAL
SYT_RHOS4       MAQISLTFPDGKAREFPAGITPAEVAASISTSLGKKAISASVDGRHYDLQWPIETDAKIAIHTMDEAQAL
SYT_PROM0       -----ITLPDGSKKVFEKSVTILEIAQSIGAGLAKATIAGRVNDVLLDATIPINKDSKVVIITSKDKEGI
SYT_IDILO       -----ITLPDGSQREFDKPVSIMEVAADIGAGLAKATVAGRIDGELVDACELIEHDARIEIVTPKDDDGV
SYT_SALTY       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_SALPK       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_SALPA       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_SALHS       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLSIITAKDEEGL
SYT_PARDP       MSQISLTFPDGNARDYPAGVTAAEVAASIAPSLAKNAISASLDGQHIDLQWPIAASGRIAINTKDSEPAL
SYT_HALMA       MSTVTVTLPDGTPLEVERGSTVEDVAYEIGPGLGDDTVAGVVDGELVDKHAPLTADVELEIVTESSDEYL
SYT_ENT38       -----ITLPDGSQRQFDRAVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDAQLSIITAKDAEGI
SYT_SALPB       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLAIITAKDEEGL
SYT_SALNS       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLAIITAKDEEGL
SYT_SALEP       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLAIITAKDEEGL
SYT_SALDC       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLAIITAKDEEGL
SYT_ACTSZ       -----ITLPDGSQRQFDNPVSVLEVAQSIGSGLAKATIAGRVNGERRDACDMINDDSTLEIITAKDEDGL
SYT_SHIBS       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_SHIB3       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGL
SYT_SALG2       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDASDLIENDATLAIITAKDEEGL
SYT_RHILO       LNSVSLTFPDGSVRDYDAAMTGAGLAESISKSLAKKAVAYAINGTVRDLSDPLGKSGKVEIITRDDARAL
SYT_POLNA       ---IQITLPDSSKRDYSGPVTVAEVAASIXXXXXXXXXXXXXXXXXVDTSFLISQDSALSIVTAKDAEGL
SYT_PASMU       -----ITLPDGSQRQFEQPISVMDVAASIGAGLAKACIAGRVNGERKDACDLITEDSKLEIITAKEEDGL
SYT_MANSM       -----ITLPDGSQRQFDNPVSVLEVAQSIGAGLAKATIAGRVNGERRDACDMITEDSTLEIITAKDEDGL
SYT_RHOS5       MAQISLTFPDGNAREFPAGITPAEVAASISTSLGKKAISASVDGRHYDLQWPIEADAKIAIHTMDEAQAL
SYT_ESCF3       -----ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLAIITAKDEEGL
SYT_PSEA7       -----ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIERDATLQIITPKDEEGL
SYT_NEIMA       ---LNITLPDGSVRQYESPVTVAQIXXXXXXXXXXXXXXXRVNGKLVDACDPIVEDSAVQIITPKDQEGI
SYT_HAES2       -----ITLPDGSQRQFDNPVSVLEVAQSIGSGLAKATIAGRVNGERRDASDMISEDANLEIITAKDEDGL
SYT_SALCH       -----ITLPDGSQRHYDHPVSPMDVALDIGPGLAKATIAGRVNGELVDACDLIENDATLAIITAKDEEGL
SYT_PROM5       ----KITLPDGTKKVFEKAVTTLDIAKSIGAGLAKATIAGKVNNVLFDATLPIKNDSKVVIITSRDKEGI
SYT_PECCP       -----ITLPDGSQRHYDHAVSPLDVALDIGPGLAKACIAGRVNGELVDASDKIDTDAQLAIITAKDEAGL
SYT_HAEIN       -----ITLPDGSQRQFDRPVSVLEVAQDIGAGLAKATIAGRVNGERRDACYVIEQDATLEIITAKDEDGL
SYT_RHIE6       --AISLTFPDGSVRSFPAGATGKDVAESISKSLAKSAVAIAIDGAVRDLSDAVT-DGKIEIITRKDGRAL
SYT_PSEAE       -----ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGL
SYT_PSEAB       -----ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGL
SYT_PSEA8       -----ITLPDGSQRSFDHPVSVAEVAQSIXXXXXXXXXXXXVDGRLVDACDTIDRDATLQIITPKDEEGL
SYT_HAEIG       -----ITLPDGSQRQFDNPVSVLEVAQDIGAGLAKATIAGRVNGERHDACDIIEQDATLEIITAKDEDGL
SYT_EHRCR       ---INIHFSNNLCKQFHRGIKGHDIVNDLFPKLKNETIAAKVNGELYDLSREIIENCTFEVITINSEEGL
SYT_COLP3       -----ITLPDGSQRSFEQAVSVMDVALDIGPGLAKATIAGRIDGNLVDACELITQDASLQLITSKDSEGL
SYT_HAEI8       -----ITLPDGSQRQFDRPVSVLEVAQDIGAGLAK