[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99322.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
  139::232     5e-04  35%  235 aa  RNC_CLOTE RecName: Full=Ribonuclease 3;       
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxRVYVLKFGIDEKTMNNRFIVEYTYTWTGRIKINKISLRLHGQ
RNC_CLOTE       ----------------------------REFILKYNIVEKAMKDEIILDYKTKLQGDIQINYILIKHEGP


                         .         .         *         .         .         .         .:140
query           QHPREFRNEAQLLQYLKKHSKRYVKGKEISNKKRSK
RNC_CLOTE       PHRRKFYTEVKIIGYSKKESEQNAAKKAIENMEVNK