[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99339.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
    1::185     1e-84  78%  185 aa  EFP_ANOFW RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-84  78%  185 aa  EFP_GEOKA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-84  77%  185 aa  EFP_GEOSW RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-83  78%  185 aa  EFP_GEOTN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-81  76%  185 aa  EFP_BACP2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-81  76%  185 aa  EFP_BACSU RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     5e-81  77%  189 aa  EFP2_LACJO RecName: Full=Elongation factor P 2;         Short=EF-P
    1::185     6e-80  75%  185 aa  EFP_BACLD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISW6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISMO RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISMH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISMF RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISMC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-78  72%  185 aa  EFP_LISIN RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     7e-78  74%  189 aa  EFP2_LACAC RecName: Full=Elongation factor P 2;         Short=EF-P
    1::185     2e-77  70%  185 aa  EFP_LACPL RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-77  72%  185 aa  EFP_BACHD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-76  72%  185 aa  EFP_LYSSC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-76  71%  185 aa  EFP_BACSK RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-75  72%  185 aa  EFP_MACCJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-75  70%  185 aa  EFP_BACCN RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-74  68%  185 aa  EFP_STAEQ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-74  69%  185 aa  EFP_OCEIH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-74  69%  185 aa  EFP_STAHJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-74  68%  185 aa  EFP_STAES RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-74  69%  185 aa  EFP_BACCQ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-74  69%  185 aa  EFP_BACC7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-74  69%  185 aa  EFP_BACC1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACHK RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACCZ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACC0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACAN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACAH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACAC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACAA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  70%  185 aa  EFP_BACA2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACCR RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACC4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-73  69%  185 aa  EFP_BACC3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-73  69%  185 aa  EFP_BACWK RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-73  68%  185 aa  EFP_BACC2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-72  68%  185 aa  EFP_STACT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAW RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAR RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAN RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAM RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAC RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAAB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAA9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAA8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAA3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAA2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-71  67%  185 aa  EFP_STAA1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-71  68%  185 aa  EFP_STAS1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-70  64%  185 aa  EFP_MOOTA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-68  61%  185 aa  EFP_HELMI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-68  62%  185 aa  EFP_PELTS RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-66  61%  185 aa  EFP_DESHY RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-66  61%  185 aa  EFP_DESHD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-66  61%  185 aa  EFP_DESAP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-65  62%  185 aa  EFP_CARHZ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-64  62%  185 aa  EFP_BREBN RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-64  58%  186 aa  EFP_HALOH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-63  57%  188 aa  EFP_NATTJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-61  58%  185 aa  EFP_TRIEI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-61  57%  185 aa  EFP_THETN RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-60  55%  185 aa  EFP_NOSP7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-60  57%  185 aa  EFP_CYAP8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-60  57%  185 aa  EFP_THEPX RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-60  57%  185 aa  EFP_THEP3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-60  57%  185 aa  EFP_SYMTH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-60  57%  185 aa  EFP_THEEB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-60  56%  188 aa  EFP_EXISA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-60  55%  185 aa  EFP_ACAM1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-59  55%  185 aa  EFP_SYNP2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-59  55%  187 aa  EFP_PROM1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-59  55%  187 aa  EFP_PROMT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-59  56%  185 aa  EFP_SYNP6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-59  56%  185 aa  EFP_SYNE7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-59  53%  185 aa  EFP_DESRM RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-58  55%  185 aa  EFP_SYNWW RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-58  54%  188 aa  EFP_EXIS2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-58  53%  185 aa  EFP_CYAP7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-58  55%  185 aa  EFP_CLOTH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-58  55%  185 aa  EFP_SYNJB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-58  55%  185 aa  EFP_SYNJA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-58  54%  187 aa  EFP_SYNSC RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-58  53%  186 aa  EFP_SYNS9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-58  55%  187 aa  EFP_SYNPX RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-58  55%  187 aa  EFP_SYNPW RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-58  53%  185 aa  EFP_MICAN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-58  55%  187 aa  EFP_GLOVI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     8e-58  52%  186 aa  EFP_COPPD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     8e-58  55%  185 aa  EFP_CALS8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-57  54%  185 aa  EFP_ANATD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-57  53%  187 aa  EFP_SYNS3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-57  54%  186 aa  EFP_PROMA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-57  53%  186 aa  EFP_CYAA5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-57  53%  187 aa  EFP_SYNY3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-57  54%  185 aa  EFP_ANAVT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-57  53%  186 aa  EFP_PROM5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-57  54%  185 aa  EFP_CYAP4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-56  53%  186 aa  EFP_PROM4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-56  53%  185 aa  EFP_ANASP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-56  53%  186 aa  EFP_PROMP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-56  52%  186 aa  EFP_PROMS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-56  52%  186 aa  EFP_PROM9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-56  51%  187 aa  EFP_RHOE4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-56  52%  186 aa  EFP_PROM2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     8e-56  52%  186 aa  EFP_PROM0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     8e-56  54%  185 aa  EFP_EUBR3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-55  53%  186 aa  EFP_SYNR3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-55  52%  186 aa  EFP_PROM3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-55  50%  187 aa  EFP_ACIC1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-55  50%  187 aa  EFP_RHOSR RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-55  52%  186 aa  EFP_PROMM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-55  49%  185 aa  EFP_DEIGD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-55  52%  185 aa  EFP_SALAI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-55  50%  187 aa  EFP_RHOOB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-54  51%  187 aa  EFP_MYCPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-54  51%  187 aa  EFP_MYCA1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-54  52%  185 aa  EFP_EUBE2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-54  51%  185 aa  EFP_SALTO RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-54  53%  187 aa  EFP_CORA7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-54  53%  186 aa  EFP_CLOCE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-54  52%  187 aa  EFP_MYCSS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-54  52%  187 aa  EFP_MYCSK RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-54  52%  187 aa  EFP_MYCSJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-54  52%  187 aa  EFP_COREF RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-54  48%  187 aa  EFP_FRASC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-54  54%  186 aa  EFP_ENTFA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-54  50%  185 aa  EFP_ACHLI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-53  51%  187 aa  EFP_NOCFA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-53  52%  187 aa  EFP_MYCS2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-53  49%  185 aa  EFP_FINM2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-53  52%  185 aa  EFP_CLOD6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-53  51%  187 aa  EFP_MYCVP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-53  48%  187 aa  EFP_ARTAT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  48%  187 aa  EFP_KOCRD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOBM RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOBL RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOBK RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOBJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOBH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOB6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  185 aa  EFP_CLOB1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-53  52%  186 aa  EFP_CLOAB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-53  51%  187 aa  EFP_MYCA9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-53  52%  187 aa  EFP_CORK4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-53  50%  187 aa  EFP_MYCMM RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-53  49%  185 aa  EFP_CLOBB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-53  49%  185 aa  EFP_CLOBA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-53  49%  187 aa  EFP_CLAMS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-53  49%  187 aa  EFP_CLAM3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     8e-53  50%  187 aa  EFP_MYCUA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-52  51%  187 aa  EFP_MYCGI RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-52  49%  189 aa  EFP_PHYAS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-52  50%  188 aa  EFP_SACEN RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-52  47%  187 aa  EFP_ARTCA RecName: Full=Elongation factor P;         Short=EF-P;
    4::185     3e-52  48%  187 aa  EFP_WOLSU RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-52  46%  185 aa  EFP_DEIRA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-52  49%  185 aa  EFP_CLOK5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-52  47%  187 aa  EFP_ARTS2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     4e-52  48%  192 aa  EFP_AQUAE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-52  48%  187 aa  EFP_FRASN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-52  48%  185 aa  EFP_DEIDV RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-52  48%  187 aa  EFP_LEIXX RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-52  49%  187 aa  EFP_THEYD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-52  49%  187 aa  EFP_CORU7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-51  51%  189 aa  EFP_ONYPE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-51  49%  185 aa  EFP_ALKOO RecName: Full=Elongation factor P;         Short=EF-P;
    1::169     2e-51  55%  185 aa  EFP_RUBXD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-51  47%  186 aa  EFP_DESAD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-51  48%  187 aa  EFP_CORDI RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-51  49%  185 aa  EFP_CLOTE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-51  47%  187 aa  EFP_NOCSJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-51  48%  185 aa  EFP_CLOPH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-51  51%  189 aa  EFP_AYWBP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-51  48%  185 aa  EFP_CLONN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-51  49%  188 aa  EFP_STRGG RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     7e-51  49%  187 aa  EFP_HELAH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-51  46%  187 aa  EFP_DESOH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-50  49%  188 aa  EFP_STRAW RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-50  49%  186 aa  EFP_BEUC1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     1e-50  50%  187 aa  EFP_HELPH RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     1e-50  50%  187 aa  EFP_HELP2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-50  47%  185 aa  EFP_DESMR RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-50  49%  187 aa  EFP_HELPY RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-50  49%  187 aa  EFP_HELPS RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-50  49%  187 aa  EFP_HELPG RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-50  49%  189 aa  EFP_CAMJR RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-50  49%  189 aa  EFP_CAMJJ RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-50  49%  189 aa  EFP_CAMJE RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-50  49%  189 aa  EFP_CAMJD RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-50  49%  189 aa  EFP_CAMJ8 RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-50  49%  187 aa  EFP_HELHP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-50  49%  187 aa  EFP_CORJK RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     3e-50  48%  189 aa  EFP_ALHEH RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     4e-50  49%  187 aa  EFP_HELPJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-50  47%  185 aa  EFP_DESDG RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-50  51%  185 aa  EFP_LACF3 RecName: Full=Elongation factor P;         Short=EF-P;
    4::185     5e-50  45%  187 aa  EFP_BIFA0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-50  48%  187 aa  EFP_CORGL RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-50  48%  187 aa  EFP_CORGB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-50  48%  188 aa  EFP_STRCO RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRPZ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRPG RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRPD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRPC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRPB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRP8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRP6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRP3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-49  50%  185 aa  EFP_STRP1 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     1e-49  49%  189 aa  EFP_HALHL RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-49  49%  185 aa  EFP_ALKMQ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-49  50%  185 aa  EFP_STRPM RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     2e-49  47%  189 aa  EFP_CAMLR RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-49  47%  187 aa  EFP_MYCTU RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-49  47%  187 aa  EFP_MYCTA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-49  47%  187 aa  EFP_MYCBT RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-49  47%  187 aa  EFP_MYCBP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-49  47%  187 aa  EFP_MYCBO RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     4e-49  45%  194 aa  EFP_HYDS0 RecName: Full=Elongation factor P;         Short=EF-P;
    4::185     4e-49  46%  188 aa  EFP_BIFLO RecName: Full=Elongation factor P;         Short=EF-P;
    4::185     4e-49  46%  188 aa  EFP_BIFLI RecName: Full=Elongation factor P;         Short=EF-P;
    4::185     4e-49  46%  188 aa  EFP_BIFLD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-49  49%  185 aa  EFP_STRPF RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-49  48%  185 aa  EFP_THEAB RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     7e-49  48%  189 aa  EFP_CAMFF RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     7e-49  48%  191 aa  EFP1_LACAC RecName: Full=Elongation factor P 1;         Short=EF-P
    1::186     9e-49  51%  186 aa  EFP_STRMU RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-48  51%  186 aa  EFP_STRA5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-48  51%  186 aa  EFP_STRA3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-48  51%  186 aa  EFP_STRA1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRZT RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRZP RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRZJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRR6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRPS RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRPN RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRPJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRPI RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRP7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRP4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-48  51%  186 aa  EFP_STRP2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-48  45%  185 aa  EFP_FERNB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-48  47%  185 aa  EFP_THEM4 RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     3e-48  49%  188 aa  EFP_SULNB RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-48  46%  185 aa  EFP_CLOPS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-48  46%  185 aa  EFP_CLOPE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-48  46%  185 aa  EFP_CLOP1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-48  46%  185 aa  EFP_DESDA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-48  46%  185 aa  EFP_TROWT RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-48  46%  185 aa  EFP_TROW8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-48  48%  185 aa  EFP_LACRJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-48  48%  185 aa  EFP_LACRD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-47  48%  185 aa  EFP_HERA2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-47  48%  192 aa  EFP_SALRD RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     5e-47  46%  185 aa  EFP_DESVM RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-47  47%  184 aa  EFP_THET8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     9e-47  47%  184 aa  EFP_THET2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-47  45%  187 aa  EFP_MYCAP RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-46  42%  187 aa  EFP_DESAA RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     1e-46  46%  188 aa  EFP_CHRSD RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-46  46%  188 aa  EFP2_PORGI RecName: Full=Elongation factor P 2;         Short=EF-P
    3::186     3e-46  45%  188 aa  EFP_METCA RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     3e-46  46%  189 aa  EFP_CHLAD RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     4e-46  45%  190 aa  EFP_PERMH RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-46  44%  188 aa  EFP_BDEBA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-46  46%  188 aa  EFP1_PORGI RecName: Full=Elongation factor P 1;         Short=EF-P
    5::187     7e-46  45%  189 aa  EFP_TERTT RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-46  46%  185 aa  EFP_DICT6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-46  49%  190 aa  EFP_AMOA5 RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     1e-45  45%  189 aa  EFP_CHLSY RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     1e-45  45%  189 aa  EFP_CHLAA RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-45  45%  189 aa  EFP_NITOC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-45  45%  185 aa  EFP_DICTD RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-45  43%  189 aa  EFP_SACD2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-45  44%  189 aa  EFP_DICNV RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     3e-45  45%  190 aa  EFP_SULSY RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     3e-45  47%  189 aa  EFP_FRAP2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     5e-45  44%  188 aa  EFP_COXBU RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     5e-45  44%  188 aa  EFP_COXBR RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     5e-45  44%  188 aa  EFP_COXBN RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     5e-45  44%  188 aa  EFP_COXB2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     6e-45  45%  190 aa  EFP_PSYCK RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     8e-45  46%  189 aa  EFP_FRATN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-44  45%  185 aa  EFP_PETMO RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-44  42%  185 aa  EFP_MYCH7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-44  43%  185 aa  EFP_MYCH2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-44  44%  187 aa  EFP_THISH RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-44  42%  189 aa  EFP_ALCBS RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-44  44%  188 aa  EFP_COXB1 RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     3e-44  45%  190 aa  EFP_PSYA2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-44  42%  185 aa  EFP_MYCHJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-44  45%  185 aa  EFP_KOSOT RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     7e-44  45%  190 aa  EFP_HAHCH RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATW RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATT RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATO RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATM RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATH RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRATF RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     7e-44  45%  189 aa  EFP_FRAT1 RecName: Full=Elongation factor P;         Short=EF-P;
    8::192     9e-44  46%  192 aa  EFP_ACIAD RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     1e-43  43%  188 aa  EFP_LEPBP RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     1e-43  43%  188 aa  EFP_LEPBA RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     2e-43  44%  188 aa  EFP_SULDN RecName: Full=Elongation factor P;         Short=EF-P;
    5::188     2e-43  46%  191 aa  EFP_PSYWF RecName: Full=Elongation factor P;         Short=EF-P;
    4::188     3e-43  43%  191 aa  EFP_MARMS RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-43  45%  186 aa  EFP_ACIF5 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-43  45%  186 aa  EFP_ACIF2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-43  42%  185 aa  EFP_UNCTG RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-43  40%  187 aa  EFP_DESAH RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-43  42%  186 aa  EFP_ACIC5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     6e-43  39%  188 aa  EFP_MYCMO RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-42  45%  185 aa  EFP_STRU0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-42  46%  186 aa  EFP_STRSV RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-42  46%  188 aa  EFP_GRAFK RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-42  41%  187 aa  EFP_SYNAS RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     1e-42  45%  188 aa  EFP_PSEHT RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-42  45%  189 aa  EFP_IDILO RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-42  46%  186 aa  EFP_STRGC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-42  45%  185 aa  EFP_STRS7 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-42  45%  185 aa  EFP_STREM RecName: Full=Elongation factor P;         Short=EF-P;
    5::189     3e-42  44%  189 aa  EFP_ACIBT RecName: Full=Elongation factor P;         Short=EF-P;
    5::189     3e-42  44%  189 aa  EFP_ACIBC RecName: Full=Elongation factor P;         Short=EF-P;
    5::189     3e-42  44%  189 aa  EFP_ACIB5 RecName: Full=Elongation factor P;         Short=EF-P;
    5::189     3e-42  44%  189 aa  EFP_ACIB3 RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     4e-42  43%  188 aa  EFP_VIBCM RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     4e-42  43%  188 aa  EFP_VIBCH RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     4e-42  43%  188 aa  EFP_VIBC3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-42  43%  188 aa  EFP_BACFR RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-42  43%  188 aa  EFP_BACFN RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-42  44%  185 aa  EFP_STRE4 RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-41  42%  188 aa  EFP_VIBVY RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-41  42%  188 aa  EFP_VIBVU RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-41  42%  188 aa  EFP_VIBPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-41  42%  185 aa  EFP_THELT RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-41  43%  191 aa  EFP_COLP3 RecName: Full=Elongation factor P;         Short=EF-P;
   22::184     2e-41  42%  187 aa  EFP2_GEOSL RecName: Full=Elongation factor P 2;         Short=EF-P
    5::186     3e-41  42%  188 aa  EFP_SODGM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-41  40%  185 aa  EFP_MYCA5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-41  42%  188 aa  EFP_BACTN RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     5e-41  42%  188 aa  EFP_VIBF1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-41  42%  187 aa  EFP_FLAPJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-41  40%  186 aa  EFP_MYCS5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-41  41%  187 aa  EFP_MYCLE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-41  41%  187 aa  EFP_MYCLB RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     7e-41  44%  188 aa  EFP_CHLT3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-41  42%  188 aa  EFP_BACV8 RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     9e-41  41%  188 aa  EFP_VIBHB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-41  42%  187 aa  EFP_ROSS1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-40  38%  187 aa  EFP_DESPS RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-40  41%  188 aa  EFP_PHOLL RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-40  40%  188 aa  EFP_LEPIN RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-40  40%  188 aa  EFP_LEPIC RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-40  41%  188 aa  EFP_HAMD5 RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     2e-40  42%  188 aa  EFP_VIBSL RecName: Full=Elongation factor P;         Short=EF-P;
    1::181     3e-40  39%  187 aa  EFP_MYCPU RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     3e-40  41%  190 aa  EFP2_CHLCV RecName: Full=Elongation factor P 2;         Short=EF-P
    3::185     5e-40  39%  188 aa  EFP_LEPBL RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     5e-40  39%  188 aa  EFP_LEPBJ RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     6e-40  39%  188 aa  EFP_RICFE RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-39  43%  186 aa  EFP_STRT2 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALTY RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALTI RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALSV RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALPK RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALPC RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALPA RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALNS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALHS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALG2 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALEP RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALDC RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALAR RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     1e-39  41%  188 aa  EFP_SALA4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-39  39%  185 aa  EFP_LAWIP RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-39  41%  185 aa  EFP_THEMA RecName: Full=Elongation factor P;         Short=EF-P;
   11::192     2e-39  38%  195 aa  EFP_RHOBA RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     2e-39  42%  188 aa  EFP_ENT38 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-39  40%  185 aa  EFP_DESVV RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     2e-39  40%  185 aa  EFP_DESVH RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     2e-39  40%  188 aa  EFP_YERE8 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-39  42%  187 aa  EFP_RUTMC RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-39  39%  188 aa  EFP_PECCP RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     2e-39  42%  188 aa  EFP_KLEP7 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     2e-39  42%  188 aa  EFP_KLEP3 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-39  41%  188 aa  EFP_ENTS8 RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     3e-39  40%  188 aa  EFP_XYLFT RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     3e-39  40%  188 aa  EFP_XYLFA RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     3e-39  40%  188 aa  EFP_XYLF2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     3e-39  43%  186 aa  EFP_STRTD RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     3e-39  43%  186 aa  EFP_STRT1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     3e-39  38%  188 aa  EFP_RICRS RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     3e-39  38%  188 aa  EFP_RICRO RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHISS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHIFL RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHIF8 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHIDS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHIBS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_SHIB3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-39  41%  188 aa  EFP_PHYMT RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-39  40%  187 aa  EFP_PARL1 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ESCF3 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOUT RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOSM RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOSE RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOLU RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOLI RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOLC RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOL6 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOL5 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOK1 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOHS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECODH RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECOBW RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO8A RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO81 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO7I RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO5E RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO57 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO55 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO45 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO27 RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     4e-39  41%  188 aa  EFP_ECO24 RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     4e-39  38%  190 aa  EFP2_PARUW RecName: Full=Elongation factor P 2;         Short=EF-P
    4::187     4e-39  40%  190 aa  EFP2_CHLMU RecName: Full=Elongation factor P 2;         Short=EF-P
    7::186     5e-39  39%  188 aa  EFP_YERPY RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPP RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPN RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPG RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPE RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPB RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERPA RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     5e-39  39%  188 aa  EFP_YERP3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-39  41%  185 aa  EFP_THESQ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-39  41%  185 aa  EFP_THEP1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     7e-39  38%  188 aa  EFP_RICAE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     7e-39  40%  184 aa  EFP_MYCMS RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     7e-39  41%  188 aa  EFP_CITK8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-39  43%  187 aa  EFP_AZOPC RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     7e-39  39%  190 aa  EFP2_CHLTR RecName: Full=Elongation factor P 2;         Short=EF-P
    1::185     9e-39  42%  185 aa  EFP_THENN RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     9e-39  37%  188 aa  EFP_RICPU RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     9e-39  41%  188 aa  EFP_PHOPR RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     1e-38  38%  188 aa  EFP_RICM5 RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     1e-38  40%  189 aa  EFP_LEGPH RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     1e-38  38%  187 aa  EFP_SILPO RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     1e-38  37%  188 aa  EFP_RICAH RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     1e-38  40%  189 aa  EFP_LEGPL RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-38  39%  188 aa  EFP_SERP5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-38  40%  187 aa  EFP_ROSCS RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     3e-38  38%  187 aa  EFP_SILST RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-38  42%  185 aa  EFP_MESFL RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     3e-38  40%  189 aa  EFP_LEGPC RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     3e-38  40%  189 aa  EFP_LEGPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-38  43%  185 aa  EFP_LACLS RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-38  43%  185 aa  EFP_LACLM RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     3e-38  42%  188 aa  EFP_HAEPS RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-38  38%  186 aa  EFP_BRUME RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-38  38%  186 aa  EFP_BRUMB RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-38  38%  186 aa  EFP_BRUAB RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-38  38%  186 aa  EFP_BRUA2 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-38  38%  186 aa  EFP_BRUA1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-38  38%  186 aa  EFP_BRUO2 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     6e-38  37%  188 aa  EFP_RICCN RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     6e-38  40%  188 aa  EFP_ERWT9 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     6e-38  38%  186 aa  EFP_BRUSU RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     6e-38  38%  186 aa  EFP_BRUSI RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     6e-38  38%  186 aa  EFP_BRUC2 RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     6e-38  39%  190 aa  EFP2_CHLPN RecName: Full=Elongation factor P 2;         Short=EF-P
    6::185     7e-38  40%  187 aa  EFP_XYLFM RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     9e-38  38%  188 aa  EFP_ERWCT RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     1e-37  39%  188 aa  EFP_PROMH RecName: Full=Elongation factor P;         Short=EF-P;
    5::187     2e-37  41%  187 aa  EFP_VESOH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-37  40%  187 aa  EFP_MAGSM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-37  43%  185 aa  EFP_LACLA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-37  40%  188 aa  EFP_PARD8 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-37  41%  188 aa  EFP_ACTP7 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-37  41%  188 aa  EFP_ACTP2 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-37  38%  188 aa  EFP_RHOCS RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     4e-37  39%  188 aa  EFP_NITMU RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     5e-37  36%  188 aa  EFP_RICCK RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     5e-37  39%  186 aa  EFP_PELUB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-37  41%  188 aa  EFP_FLAJ1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     6e-37  36%  188 aa  EFP_RICBR RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     6e-37  36%  188 aa  EFP_RICB8 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     6e-37  39%  187 aa  EFP_MESSB RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     8e-37  41%  188 aa  EFP_HAEDU RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     1e-36  36%  188 aa  EFP_STRMK RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     1e-36  36%  188 aa  EFP_RICPR RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     1e-36  38%  188 aa  EFP1_RHILO RecName: Full=Elongation factor P 1;         Short=EF-P
    1::184     2e-36  39%  187 aa  EFP_TREDE RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     2e-36  36%  188 aa  EFP_RICTY RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     4e-36  37%  188 aa  EFP_XANAC RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     5e-36  37%  188 aa  EFP_XANOM RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     5e-36  37%  188 aa  EFP_XANC5 RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     5e-36  36%  188 aa  EFP_ACICJ RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     9e-36  37%  187 aa  EFP_ROSDO RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     9e-36  36%  188 aa  EFP_GEMAT RecName: Full=Elongation factor P;         Short=EF-P;
    6::184     9e-36  36%  187 aa  EFP_FUSNN RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     9e-36  36%  190 aa  EFP_BARQU RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-35  37%  188 aa  EFP_XANCP RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-35  37%  188 aa  EFP_XANCB RecName: Full=Elongation factor P;         Short=EF-P;
    4::186     1e-35  37%  188 aa  EFP_XANC8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-35  38%  187 aa  EFP_TREPS RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     1e-35  38%  187 aa  EFP_TREPA RecName: Full=Elongation factor P;         Short=EF-P;
    9::190     1e-35  38%  192 aa  EFP_MANSM RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     1e-35  36%  191 aa  EFP_BARHE RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     1e-35  38%  190 aa  EFP_BARBK RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-35  37%  191 aa  EFP_BART1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-35  37%  186 aa  EFP_ELUMP RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-35  40%  188 aa  EFP_CHLP8 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     3e-35  39%  188 aa  EFP_MARMM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-35  39%  188 aa  EFP_CHLTE RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-35  39%  187 aa  EFP_BRAHW RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     3e-35  37%  188 aa  EFP_ANAPZ RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     3e-35  39%  187 aa  EFP1_GEOSL RecName: Full=Elongation factor P 1;         Short=EF-P
    3::186     3e-35  36%  186 aa  EFP_METI4 RecName: Full=Elongation factor P;         Short=EF-P;
    8::188     4e-35  38%  190 aa  EFP_HYPNA RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     6e-35  36%  188 aa  EFP_STRM5 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     1e-34  37%  188 aa  EFP_ACTSZ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-34  38%  188 aa  EFP_PELPB RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     2e-34  37%  188 aa  EFP_PASMU RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     2e-34  35%  187 aa  EFP_GRABC RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     2e-34  36%  188 aa  EFP_GLUOX RecName: Full=Elongation factor P;         Short=EF-P;
    7::186     3e-34  35%  187 aa  EFP_SPHAL RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     3e-34  37%  188 aa  EFP_HAES2 RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     3e-34  37%  188 aa  EFP_HAES1 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-34  34%  187 aa  EFP_SPHWW RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     4e-34  37%  188 aa  EFP_HAEIN RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     4e-34  37%  188 aa  EFP_HAEIG RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     4e-34  37%  188 aa  EFP_HAEIE RecName: Full=Elongation factor P;         Short=EF-P;
    5::186     4e-34  37%  188 aa  EFP_HAEI8 RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     5e-34  35%  188 aa  EFP_GLUDA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     5e-34  39%  188 aa  EFP_CHLCH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-34  39%  188 aa  EFP_CHLL2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     8e-34  36%  188 aa  EFPL_VIBVY RecName: Full=Elongation factor P-like protein;
    1::188     8e-34  36%  188 aa  EFPL_VIBVU RecName: Full=Elongation factor P-like protein;
    4::187     1e-33  35%  188 aa  EFP_MYCGA RecName: Full=Elongation factor P;         Short=EF-P;
    7::187     2e-33  37%  189 aa  EFP_BAUCH RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     3e-33  33%  188 aa  EFP_WOLPP RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-33  33%  187 aa  EFP_NOVAD RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     3e-33  40%  190 aa  EFP_MYCPN RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     4e-33  35%  188 aa  EFP_ANAMM RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     9e-33  40%  190 aa  EFP_MYCGE RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     9e-33  36%  190 aa  EFPL_ERWT9 RecName: Full=Elongation factor P-like protein;
    6::186     1e-32  35%  188 aa  EFP_ANAMF RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-32  36%  188 aa  EFP_UREPA RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-32  36%  188 aa  EFP_UREP2 RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     2e-32  35%  189 aa  EFP_EHRCR RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-32  36%  185 aa  EFP_BURCM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-32  36%  185 aa  EFP_BURA4 RecName: Full=Elongation factor P;         Short=EF-P;
    3::185     2e-32  31%  188 aa  EFP_MAGSA RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-32  35%  187 aa  EFP_JANSC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-32  36%  185 aa  EFP_BURS3 RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     2e-32  34%  188 aa  EFPL_VIBHB RecName: Full=Elongation factor P-like protein;
    1::185     3e-32  38%  188 aa  EFP_PROVI RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-32  36%  185 aa  EFP_BURCH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-32  36%  185 aa  EFP_BURCC RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-32  36%  185 aa  EFP_BURCA RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     3e-32  38%  185 aa  EFP_AZOSB RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     5e-32  33%  188 aa  EFP_WOLWR RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     5e-32  32%  188 aa  EFP_CAUCR RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     5e-32  32%  188 aa  EFP_CAUCN RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     6e-32  38%  185 aa  EFP_DECAR RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     8e-32  33%  188 aa  EFP_WOLTR RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     8e-32  35%  188 aa  EFP_UREU1 RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     8e-32  35%  189 aa  EFP_EHRRW RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     8e-32  35%  189 aa  EFP_EHRRG RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     8e-32  36%  185 aa  EFP_BURVG RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     1e-31  34%  188 aa  EFPL_VIBPA RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  36%  190 aa  EFPL_SERP5 RecName: Full=Elongation factor P-like protein;
    1::183     1e-31  37%  185 aa  EFP_AZOSE RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     1e-31  37%  190 aa  EFPL_SHISS RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SHIDS RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SHIB3 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALTY RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALTI RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALSV RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALPK RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALPC RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALPB RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALPA RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALNS RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALHS RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALG2 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALEP RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALDC RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_SALAR RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ESCF3 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOUT RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOSM RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOSE RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOLU RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOLI RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOLC RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOL6 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOL5 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOK1 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECOHS RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECODH RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO8A RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO81 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO7I RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO5E RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO57 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO55 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO45 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO27 RecName: Full=Elongation factor P-like protein;
    1::189     1e-31  37%  190 aa  EFPL_ECO24 RecName: Full=Elongation factor P-like protein;
    6::187     2e-31  34%  189 aa  EFP_EHRCJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-31  37%  185 aa  EFP_BURTA RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     2e-31  36%  190 aa  EFPL_PROMH RecName: Full=Elongation factor P-like protein;
    6::185     3e-31  33%  188 aa  EFP_WOLPM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-31  35%  185 aa  EFP_BURM1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     3e-31  37%  190 aa  EFPL_SALCH RecName: Full=Elongation factor P-like protein;
    1::189     4e-31  37%  190 aa  EFPL_SHIFL RecName: Full=Elongation factor P-like protein;
    1::189     4e-31  37%  190 aa  EFPL_SHIF8 RecName: Full=Elongation factor P-like protein;
    1::189     4e-31  37%  190 aa  EFPL_SHIBS RecName: Full=Elongation factor P-like protein;
    3::186     5e-31  32%  188 aa  EFP_METRJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     5e-31  37%  190 aa  EFPL_CITK8 RecName: Full=Elongation factor P-like protein;
    3::186     7e-31  33%  187 aa  EFP_ZYMMO RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     7e-31  35%  190 aa  EFPL_PSEA6 RecName: Full=Elongation factor P-like protein;
    1::189     7e-31  36%  190 aa  EFPL_KLEP3 RecName: Full=Elongation factor P-like protein;
    1::189     7e-31  36%  190 aa  EFPL_ENTS8 RecName: Full=Elongation factor P-like protein;
    1::188     7e-31  35%  188 aa  EFPL_ALISL RecName: Full=Elongation factor P-like protein;
    1::185     9e-31  36%  188 aa  EFP_PROA2 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     9e-31  31%  187 aa  EFP_ERYLH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURPS RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURP6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURP1 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURP0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURMS RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURMA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURM9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-31  36%  185 aa  EFP_BURM7 RecName: Full=Elongation factor P;         Short=EF-P;
    3::187     9e-31  32%  188 aa  EFP_BLOPB RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     9e-31  35%  188 aa  EFPL_MARAV RecName: Full=Elongation factor P-like protein;
    3::186     1e-30  32%  188 aa  EFP_METPB RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     1e-30  32%  188 aa  EFP_CAUSK RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-30  36%  185 aa  EFP_BURPP RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     2e-30  32%  188 aa  EFPL_VIBCM RecName: Full=Elongation factor P-like protein;
    1::188     2e-30  32%  188 aa  EFPL_VIBCH RecName: Full=Elongation factor P-like protein;
    1::188     2e-30  32%  188 aa  EFPL_VIBC3 RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  35%  190 aa  EFPL_KLEP7 RecName: Full=Elongation factor P-like protein;
    3::186     2e-30  32%  188 aa  EFP_METS4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     2e-30  34%  190 aa  EFPL_YERPY RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPS RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPP RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPN RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPE RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPB RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERPA RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  34%  190 aa  EFPL_YERP3 RecName: Full=Elongation factor P-like protein;
    1::189     2e-30  37%  190 aa  EFPL_ENT38 RecName: Full=Elongation factor P-like protein;
    1::188     3e-30  33%  189 aa  EFPL_HAHCH RecName: Full=Elongation factor P-like protein;
    1::189     4e-30  35%  190 aa  EFPL_YERE8 RecName: Full=Elongation factor P-like protein;
    4::186     6e-30  35%  188 aa  EFP_MYCPE RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     6e-30  35%  190 aa  EFPL_EDWI9 RecName: Full=Elongation factor P-like protein;
    3::186     7e-30  30%  187 aa  EFP_RHORT RecName: Full=Elongation factor P;         Short=EF-P;
    8::187     7e-30  36%  188 aa  EFP_RALSO RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-30  36%  185 aa  EFP_BURXL RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     7e-30  36%  185 aa  EFP_BURP8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     7e-30  36%  189 aa  EFPL_VIBSL RecName: Full=Elongation factor P-like protein;
   22::183     2e-29  39%  184 aa  EFP_VARPS RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-29  32%  189 aa  EFP_RHIME RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-29  36%  186 aa  EFP_POLSQ RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-29  32%  188 aa  EFP_BRASB RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-29  30%  188 aa  EFP_RHOPS RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-29  29%  188 aa  EFP_RHOPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     2e-29  34%  190 aa  EFPL_PHOLL RecName: Full=Elongation factor P-like protein;
    3::188     3e-29  33%  189 aa  EFP_ORITB RecName: Full=Elongation factor P;         Short=EF-P;
    1::189     3e-29  34%  190 aa  EFPL_PECCP RecName: Full=Elongation factor P-like protein;
    4::187     4e-29  32%  189 aa  EFP_SINMW RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     4e-29  29%  188 aa  EFP_RHOPT RecName: Full=Elongation factor P;         Short=EF-P;
    3::188     4e-29  33%  189 aa  EFP_ORITI RecName: Full=Elongation factor P;         Short=EF-P;
    5::185     4e-29  37%  190 aa  EFP1_LACJO RecName: Full=Elongation factor P 1;         Short=EF-P
    3::186     5e-29  30%  188 aa  EFP_RHOP2 RecName: Full=Elongation factor P;         Short=EF-P;
    6::188     5e-29  37%  189 aa  EFP_PSEU2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     5e-29  34%  191 aa  EFPL_PHOPR RecName: Full=Elongation factor P-like protein;
    1::189     5e-29  35%  190 aa  EFPL_ERWCT RecName: Full=Elongation factor P-like protein;
    1::183     5e-29  30%  184 aa  EFP1_PARUW RecName: Full=Elongation factor P 1;         Short=EF-P
    3::186     8e-29  30%  188 aa  EFP_RHOP5 RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     8e-29  36%  184 aa  EFP_DIAST RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     8e-29  35%  185 aa  EFP_BORA1 RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     8e-29  36%  184 aa  EFP_ACISJ RecName: Full=Elongation factor P;         Short=EF-P;
    8::190     1e-28  36%  191 aa  EFP_RALPJ RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     1e-28  37%  186 aa  EFP_RALME RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     1e-28  36%  184 aa  EFP_POLNA RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     1e-28  29%  188 aa  EFP_PHEZH RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     1e-28  37%  184 aa  EFP_ACIAC RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     1e-28  36%  190 aa  EFPL_PSEHT RecName: Full=Elongation factor P-like protein;
    4::187     1e-28  29%  189 aa  EFP2_RHILO RecName: Full=Elongation factor P 2;         Short=EF-P
    4::187     2e-28  30%  189 aa  EFP_RHISN RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-28  32%  189 aa  EFP_RHIEC RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     2e-28  36%  186 aa  EFP_RALEH RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-28  35%  186 aa  EFP_POLNS RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-28  30%  188 aa  EFP_OLICO RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     2e-28  36%  186 aa  EFP_CUPTR RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-28  32%  189 aa  EFP_AGRVS RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     3e-28  36%  186 aa  EFP_RALEJ RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     3e-28  34%  191 aa  EFPL_ALTMD RecName: Full=Elongation factor P-like protein;
    1::183     4e-28  35%  185 aa  EFP_BORPD RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     5e-28  35%  186 aa  EFP_LARHH RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     5e-28  34%  188 aa  EFPL_VIBF1 RecName: Full=Elongation factor P-like protein;
    1::188     5e-28  32%  188 aa  EFPL_SACD2 RecName: Full=Elongation factor P-like protein;
   22::183     7e-28  36%  184 aa  EFP_VEREI RecName: Full=Elongation factor P;         Short=EF-P;
    6::185     7e-28  36%  186 aa  EFP_THIDA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-28  34%  188 aa  EFP_PSEAE RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-28  34%  188 aa  EFP_PSEAB RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-28  34%  188 aa  EFP_PSEA8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     7e-28  34%  188 aa  EFP_PSEA7 RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     7e-28  36%  184 aa  EFP_POLSJ RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     7e-28  30%  188 aa  EFP_METC4 RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     7e-28  36%  184 aa  EFP_LEPCP RecName: Full=Elongation factor P;         Short=EF-P;
   22::183     9e-28  35%  184 aa  EFP_DELAS RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     9e-28  35%  185 aa  EFP_BORPE RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     9e-28  35%  185 aa  EFP_BORPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     9e-28  35%  185 aa  EFP_BORBR RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     9e-28  32%  191 aa  EFPL_SHESH RecName: Full=Elongation factor P-like protein;
    1::188     9e-28  35%  188 aa  EFPL_ALCBS RecName: Full=Elongation factor P-like protein;
    7::187     1e-27  36%  187 aa  EFP_BUCMP RecName: Full=Elongation factor P;       
    7::187     1e-27  33%  189 aa  EFP_BUCAI RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     1e-27  33%  191 aa  EFPL_COLP3 RecName: Full=Elongation factor P-like protein;
    4::187     2e-27  31%  189 aa  EFP_RHIRD RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-27  31%  189 aa  EFP_AGRT5 RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     2e-27  33%  188 aa  EFPL_VIBFM RecName: Full=Elongation factor P-like protein;
    4::187     2e-27  31%  189 aa  EFP_RHILW RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-27  30%  189 aa  EFP_RHIL3 RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     2e-27  31%  189 aa  EFP_RHIE6 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-27  34%  188 aa  EFP_PSEU5 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     2e-27  29%  188 aa  EFP_METNO RecName: Full=Elongation factor P;         Short=EF-P;
   24::189     2e-27  35%  192 aa  EFP_BORDL RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-27  34%  190 aa  EFP_PSEMY RecName: Full=Elongation factor P;         Short=EF-P;
    2::185     4e-27  29%  187 aa  EFP_BLOFL RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     4e-27  30%  185 aa  EFP1_CHLCV RecName: Full=Elongation factor P 1;         Short=EF-P
    1::183     6e-27  33%  184 aa  EFP_RHOFD RecName: Full=Elongation factor P;         Short=EF-P;
   24::189     1e-26  34%  192 aa  EFP_BORRA RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     1e-26  29%  188 aa  EFP_BRASO RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     2e-26  31%  189 aa  EFP_WIGBR RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     2e-26  32%  185 aa  EFP_METFK RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     4e-26  28%  189 aa  EFP_XANP2 RecName: Full=Elongation factor P;         Short=EF-P;
    4::187     6e-26  30%  189 aa  EFP_AGRRK RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     8e-26  33%  185 aa  EFP_NITEU RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     8e-26  30%  190 aa  EFPL_PSYIN RecName: Full=Elongation factor P-like protein;
    3::186     1e-25  28%  188 aa  EFP_NITWN RecName: Full=Elongation factor P;         Short=EF-P;
    7::185     1e-25  32%  187 aa  EFP_BUCAP RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-25  32%  188 aa  EFP_AZOVD RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     4e-25  35%  187 aa  EFP_CHRVO RecName: Full=Elongation factor P;         Short=EF-P;
    3::189     5e-25  30%  192 aa  EFP_BORAP RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     9e-25  33%  186 aa  EFP_SHEWM RecName: Full=Elongation factor P;         Short=EF-P;
    1::188     9e-25  31%  190 aa  EFPL_MARMS RecName: Full=Elongation factor P-like protein;
    1::185     1e-24  32%  188 aa  EFP_CHLPD RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-24  34%  188 aa  EFP_AERHH RecName: Full=Elongation factor P;         Short=EF-P;
    6::188     2e-24  34%  189 aa  EFP_PSEPF RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     2e-24  33%  188 aa  EFP_CELJU RecName: Full=Elongation factor P;         Short=EF-P;
    6::186     2e-24  34%  187 aa  EFP_TOLAT RecName: Full=Elongation factor P;         Short=EF-P;
    3::189     2e-24  30%  192 aa  EFP_BORBZ RecName: Full=Elongation factor P;         Short=EF-P;
    3::189     2e-24  30%  192 aa  EFP_BORBU RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     3e-24  34%  186 aa  EFP_SHELP RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-24  27%  188 aa  EFP_NITHX RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     3e-24  27%  188 aa  EFP_BRAJA RecName: Full=Elongation factor P;         Short=EF-P;
    4::189     3e-24  30%  192 aa  EFP_BORT9 RecName: Full=Elongation factor P;         Short=EF-P;
    3::189     3e-24  30%  192 aa  EFP_BORGA RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     5e-24  34%  186 aa  EFP_NEIMF RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     5e-24  34%  186 aa  EFP_NEIMA RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     5e-24  33%  188 aa  EFP_AERS4 RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     6e-24  31%  189 aa  EFP_PSEE4 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     6e-24  34%  186 aa  EFP_NEIMB RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     6e-24  34%  186 aa  EFP_NEIM0 RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     6e-24  34%  186 aa  EFP_NEIG1 RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     8e-24  31%  189 aa  EFP_PSEPW RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     8e-24  31%  189 aa  EFP_PSEPG RecName: Full=Elongation factor P;         Short=EF-P;
    1::183     8e-24  31%  185 aa  EFP_NITEC RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     1e-23  34%  186 aa  EFP_NEIG2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     1e-23  29%  188 aa  EFPL_XANCP RecName: Full=Elongation factor P-like protein;
    1::187     1e-23  29%  188 aa  EFPL_XANCB RecName: Full=Elongation factor P-like protein;
    1::187     1e-23  29%  188 aa  EFPL_XANC8 RecName: Full=Elongation factor P-like protein;
    1::186     2e-23  30%  186 aa  EFP_SHESH RecName: Full=Elongation factor P;         Short=EF-P;
    6::188     4e-23  33%  190 aa  EFP_PSEF5 RecName: Full=Elongation factor P;         Short=EF-P;
    3::186     5e-23  27%  188 aa  EFP_RHOSK RecName: Full=Elongation factor P;         Short=EF-P;
    6::188     7e-23  33%  189 aa  EFP_PSESM RecName: Full=Elongation factor P;         Short=EF-P;
    6::188     9e-23  33%  189 aa  EFP_PSE14 RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     3e-22  27%  188 aa  EFPL_XANC5 RecName: Full=Elongation factor P-like protein;
    1::187     3e-22  27%  188 aa  EFPL_XANAC RecName: Full=Elongation factor P-like protein;
    1::185     6e-22  31%  186 aa  EFP_SHEPA RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-22  31%  186 aa  EFP_SHEHH RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     1e-21  31%  189 aa  EFP_PSEPK RecName: Full=Elongation factor P;         Short=EF-P;
    6::187     1e-21  31%  189 aa  EFP_PSEP1 RecName: Full=Elongation factor P;         Short=EF-P;
    4::189     1e-21  30%  192 aa  EFP_BORHD RecName: Full=Elongation factor P;         Short=EF-P;
    1::186     2e-21  31%  188 aa  EFP_SHEAM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     6e-21  31%  186 aa  EFP_SHEFN RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     6e-21  26%  188 aa  EFPL_XANOR RecName: Full=Elongation factor P-like protein;
    1::187     6e-21  26%  188 aa  EFPL_XANOP RecName: Full=Elongation factor P-like protein;
    1::187     6e-21  26%  188 aa  EFPL_XANOM RecName: Full=Elongation factor P-like protein;
    1::186     8e-21  30%  186 aa  EFP_SHEDO RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     8e-21  26%  188 aa  EFPL_STRMK RecName: Full=Elongation factor P-like protein;
    1::187     8e-21  26%  188 aa  EFPL_STRM5 RecName: Full=Elongation factor P-like protein;
    1::185     1e-20  31%  186 aa  EFP_SHESW RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     1e-20  31%  186 aa  EFP_SHEPC RecName: Full=Elongation factor P;         Short=EF-P;
    1::187     5e-20  28%  188 aa  EFPL_XYLFM RecName: Full=Elongation factor P-like protein;
    1::187     7e-20  28%  188 aa  EFPL_XYLFA RecName: Full=Elongation factor P-like protein;
    1::187     9e-20  28%  188 aa  EFPL_XYLFT RecName: Full=Elongation factor P-like protein;
    1::187     9e-20  28%  188 aa  EFPL_XYLF2 RecName: Full=Elongation factor P-like protein;
    1::184     1e-19  28%  185 aa  EFP1_CHLPN RecName: Full=Elongation factor P 1;         Short=EF-P
    6::188     3e-19  32%  190 aa  EFP_PSEFS RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-18  28%  186 aa  EFP_SHEB9 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-18  28%  186 aa  EFP_SHEB8 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     3e-18  28%  186 aa  EFP_SHEB2 RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     4e-18  28%  186 aa  EFP_SHEPW RecName: Full=Elongation factor P;         Short=EF-P;
    7::187     7e-17  27%  189 aa  EFP_BUCBP RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-16  28%  186 aa  EFP_SHEON RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-16  28%  186 aa  EFP_SHESR RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-16  28%  186 aa  EFP_SHESM RecName: Full=Elongation factor P;         Short=EF-P;
    1::185     2e-16  28%  186 aa  EFP_SHESA RecName: Full=Elongation factor P;         Short=EF-P;
    1::184     3e-16  24%  185 aa  EFP1_CHLTR RecName: Full=Elongation factor P 1;         Short=EF-P
    1::184     3e-16  25%  185 aa  EFP1_CHLMU RecName: Full=Elongation factor P 1;         Short=EF-P
    1::185     9e-15  29%  191 aa  EFP_JANMA RecName: Full=Elongation factor P;         Short=EF-P;
    9::100     1e-09  36%  131 aa  IF5A_METM5 RecName: Full=Translation initiation factor 5A;AltName:
    6::108     2e-09  33%  132 aa  IF5A_PYRCJ RecName: Full=Translation initiation factor 5A;AltName:
    7::116     3e-09  33%  134 aa  IF5A_KORCO RecName: Full=Translation initiation factor 5A;AltName:
    6::108     5e-09  33%  132 aa  IF5A_THENV RecName: Full=Translation initiation factor 5A;AltName:
   13::100     5e-09  37%  131 aa  IF5A_METM6 RecName: Full=Translation initiation factor 5A;AltName:
   13::100     9e-09  37%  131 aa  IF5A_METMP RecName: Full=Translation initiation factor 5A;AltName:
    6::108     1e-08  31%  132 aa  IF5A_PYRAR RecName: Full=Translation initiation factor 5A;AltName:
   12::114     1e-08  32%  138 aa  IF5A_PYRAE RecName: Full=Translation initiation factor 5A;AltName:
    9::100     2e-08  34%  131 aa  IF5A_METVS RecName: Full=Translation initiation factor 5A;AltName:
   13::100     2e-08  36%  131 aa  IF5A_METM7 RecName: Full=Translation initiation factor 5A;AltName:
    8::118     3e-08  32%  136 aa  IF5A_METKA RecName: Full=Translation initiation factor 5A;AltName:
    6::108     5e-08  31%  132 aa  IF5A_PYRIL RecName: Full=Translation initiation factor 5A;AltName:
    7::107     5e-08  40%  135 aa  IF5A_IGNH4 RecName: Full=Translation initiation factor 5A;AltName:
    7::126     1e-07  33%  136 aa  IF5A_THEGJ RecName: Full=Translation initiation factor 5A;AltName:
    7::126     2e-07  33%  138 aa  IF5A_PYRAB RecName: Full=Translation initiation factor 5A;AltName:
    7::114     4e-07  32%  138 aa  IF5A_PYRHO RecName: Full=Translation initiation factor 5A;AltName:
    7::116     4e-07  32%  131 aa  IF5A_METS5 RecName: Full=Translation initiation factor 5A;AltName:
    7::115     5e-07  35%  131 aa  IF5A_SULAC RecName: Full=Translation initiation factor 5A;AltName:
    7::108     9e-07  30%  131 aa  IF5A_META3 RecName: Full=Translation initiation factor 5A;AltName:
    7::108     9e-07  32%  132 aa  IF5A_CALMQ RecName: Full=Translation initiation factor 5A;AltName:
    7::110     1e-06  30%  136 aa  IF5A_PYRKO RecName: Full=Translation initiation factor 5A;AltName:
    7::100     1e-06  31%  138 aa  IF5A_PYRFU RecName: Full=Translation initiation factor 5A;AltName:
    7::126     3e-06  32%  138 aa  IF5A_THESM RecName: Full=Translation initiation factor 5A;AltName:
    7::126     3e-06  32%  136 aa  IF5A_THEON RecName: Full=Translation initiation factor 5A;AltName:
    7::107     3e-06  34%  136 aa  IF5A_HYPBU RecName: Full=Translation initiation factor 5A;AltName:
    7::104     4e-06  32%  128 aa  IF5A_UNCMA RecName: Full=Translation initiation factor 5A;AltName:
    7::108     4e-06  31%  132 aa  IF5A_DESK1 RecName: Full=Translation initiation factor 5A;AltName:
    7::106     1e-05  33%  131 aa  IF5A_SULIY RecName: Full=Translation initiation factor 5A;AltName:
    7::106     1e-05  33%  131 aa  IF5A_SULIN RecName: Full=Translation initiation factor 5A;AltName:
    7::106     1e-05  33%  131 aa  IF5A_SULIM RecName: Full=Translation initiation factor 5A;AltName:
    7::106     1e-05  33%  131 aa  IF5A_SULIK RecName: Full=Translation initiation factor 5A;AltName:
    7::106     1e-05  33%  131 aa  IF5A_SULIA RecName: Full=Translation initiation factor 5A;AltName:
    7::111     2e-05  32%  131 aa  IF5A_STAMF RecName: Full=Translation initiation factor 5A;AltName:
    5::121     2e-05  29%  130 aa  IF5A_METTH RecName: Full=Translation initiation factor 5A;AltName:
    7::98      2e-05  32%  131 aa  IF5A_SULTO RecName: Full=Translation initiation factor
    7::95      5e-05  33%  132 aa  IF5A_METJA RecName: Full=Translation initiation factor
    7::113     6e-05  29%  131 aa  IF5A_SULSO RecName: Full=Translation initiation factor 5A;AltName:
    5::105     6e-05  29%  129 aa  IF5A_METS3 RecName: Full=Translation initiation factor 5A;AltName:
    7::106     8e-05  32%  131 aa  IF5A_SULIL RecName: Full=Translation initiation factor 5A;AltName:
    5::116     8e-05  31%  128 aa  IF5A_METMA RecName: Full=Translation initiation factor 5A;AltName:
    8::105     1e-04  29%  132 aa  IF5A_METST RecName: Full=Translation initiation factor 5A;AltName:
    8::116     1e-04  27%  126 aa  IF5A_HALMA RecName: Full=Translation initiation factor 5A;AltName:
    5::104     1e-04  27%  128 aa  IF5A_ARCFU RecName: Full=Translation initiation factor 5A;AltName:
   12::107     2e-04  34%  132 aa  IF5A_THEPD RecName: Full=Translation initiation factor 5A;AltName:
    8::109     3e-04  29%  129 aa  IF5A_THEAC RecName: Full=Translation initiation factor 5A;AltName:
    8::116     3e-04  25%  124 aa  IF5A_NATPD RecName: Full=Translation initiation factor 5A;AltName:
    7::116     3e-04  24%  127 aa  IF5A_METHJ RecName: Full=Translation initiation factor 5A;AltName:
    8::94      4e-04  30%  125 aa  IF5A_HALLT RecName: Full=Translation initiation factor
    7::94      4e-04  30%  139 aa  IF5A_AERPE RecName: Full=Translation initiation factor
    5::97      5e-04  29%  127 aa  IF5A_METBU RecName: Full=Translation initiation factor
    5::116     7e-04  28%  128 aa  IF5A_METBF RecName: Full=Translation initiation factor 5A;AltName:
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKM
EFP_ANOFW       MISVNDFRTGLTIEVDGDIWRVIEFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVSKAQIDNRKM
EFP_GEOKA       MISVNDFRTGLTIEVDGEIWRVLEFQHVKPGKGAAFVRSKLRNLRTGAIQERTFRAGEKVNRAQIDTRKM
EFP_GEOSW       MISVNDFRTGLTIEVDGDIWRVMDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVNRAQIDTRKM
EFP_GEOTN       MISVNDFRTGLTIEVDGEIWRVLEFQHVKPGKGAAFVRSKLRNLRTGAIQERTFRAGEKVNRAQIDTRKM
EFP_BACP2       MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVAKAQIETKTM
EFP_BACSU       MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVAKAQIETKTM
EFP2_LACJO      MISVNEFKNGLTIEYNNDLWRIVEFQHVKPGKGSAFVRSKLKSLRTGAVQEYTFRSTAKVNTADIQTKAM
EFP_BACLD       MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVARAQIETKTM
EFP_LISW6       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP_LISMO       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP_LISMH       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP_LISMF       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP_LISMC       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP_LISIN       MISVNDFKTGLTIEVDNGIWRVLDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRGGEKVAKAQIDNRKM
EFP2_LACAC      MISVNEFKNGLTIQYNNDLWRIVEFQHVKPGKGSAFVRSKLKSLRTGAVQEYTFRSTAKVETADIQTKSM
EFP_LACPL       MISTADFKNGLTIEVDNAIWRIVEFQHVKPGKGGAFVRSKLKNLRTGAVQDKTFRAGARMEQAPIEKSTM
EFP_BACHD       MISVNDFKTGLTIEVDNGIWQVMEFQHVKPGKGAAFVRSKLRNLRTGAVQEKTFRAGEKVSKAHIENRRM
EFP_LYSSC       MISVNDFRTGLTIVVDGQLYRVLDFQHVKPGKGAAFVRSKLRNLRNGSVNDKTFRAGEKVEKAQIDNRKM
EFP_BACSK       MISVNDFKTGLTIEVDNGIWQVMEFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVAKAHIENRRM
EFP_MACCJ       MISVNDFKTGLTIEVDNGIWRVIEFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVGKAQIDNKRM
EFP_BACCN       MISVNDFRTGLTITVDNDLWQVIEFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVEKAHIENRRM
EFP_STAEQ       MISVNDFKTGLTISVDNGIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEQAMIENRRM
EFP_OCEIH       MISVNDFKTGLTVEVDNDIWQVIEFQHVKPGKGAAFVRSKLRNLRSGNIQEKTFRAGEKVSKAHIENRKM
EFP_STAHJ       MISVNDFKTGLTISVDNGIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEQAMIENRRM
EFP_STAES       MISVNDFKTGLTISVDNGIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEQAMIENRRM
EFP_BACCQ       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC7       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC1       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACHK       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACCZ       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC0       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACAN       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACAH       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACAC       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACAA       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACA2       MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLRTGAIQEKTFRAGEKVAKAQIETKTM
EFP_BACCR       MISVNDFRTGLTISVDNALWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC4       MISVNDFRTGLTISVDNALWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC3       MISVNDFRTGLTIAVDNGLWQVLDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACWK       MISVNDFRTGLTISVDNALWQVMDFQHVKPGKGAAFVRSKLRNLRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_BACC2       MISVNDFRTGLTISVDNALWQVLDFQHVKPGKGAAFVRSKLRNIRTGSVQEKTFRAGEKVEKAHIENRRM
EFP_STACT       MISVNDFKTGLTISVDNGIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAW       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAT       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAS       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAR       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAN       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAM       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAE       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAC       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAAB       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAA9       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAA8       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAA3       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAA2       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAA1       MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRM
EFP_STAS1       MISVNDFKTGLTISVDNGIWKVLDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRGGEKVETALIENRRM
EFP_MOOTA       MISTNDFRTGLTIEVDGDVYTVVEFMHVKPGKGSAFVRTKLKNRRTGAVIERTFRAGEKVNRAHVERREM
EFP_HELMI       MISSNDFRTGSTIELDGDAYVVIEFQHVKPGKGAAFVRTKLKNIKTGSVVERTFRAGEKVPKARLERRQM
EFP_PELTS       MISTNDFRTGLTIELEGEVYQVIEFQHVKPGKGAAFVRSKLRNMRTGAVIEKTFNAGEKIPRARIERREM
EFP_DESHY       MISSNEFKTGLTIEVDNDVYTIIEFQHVKPGKGAAFVRTKLKNVKTGGITERKFNAGEKVPKAHVERREM
EFP_DESHD       MISSNEFKTGLTIEVDNDVYTIIEFQHVKPGKGAAFVRTKLKNVKTGGIIERKFNAGEKVPKAHVERREM
EFP_DESAP       MISTNEFRTGLTVEVDGDPCQVIEFMHVKPGKGSPFVRAKLKNLRTGAIAERTFNAGEKLPRAILERKEM
EFP_CARHZ       MISTNDFRTGLTIELDGEVYQVIEFQHVKPGKGSPFVRSKLRNLMTGAVIEKTFNAGEKVPKAHVDRREV
EFP_BREBN       MISVNDFRTGLTIEVDGNIFTVLEFQHVKPGKGAAFVRSKLRNLRSGNTTEMTFRGGEKVNPARIESSTM
EFP_HALOH       MISTNDFHNGLTIELDGTVYQVVKFQHSKTGRGGAFVRTKLRNIEDGGIIEKTFRAGEKVKKAHVDQKNM
EFP_NATTJ       MITSNDFKNGMTIEVDGEVYSIVEFQHVKPGKGAAFVRTKLRHMKSGNVSEKTFRAGEKVKRAHLEEREM
EFP_TRIEI       MISSNDFRPGVTIELDGSVWRVVEFLHVKPGKGSAFVRTKLKNVQNGNVVERTFRAGETVPQATLDKRAM
EFP_THETN       MIAAGDFRKGVTIEVDGQIFTVVDFMHVKPGKGAAFVRTKLKNIMTGAVIERTFSPTEKFEEAQIERREM
EFP_NOSP7       MISSNDFRPGVSIVLDGSVWRVLEFLHVKPGKGSAFVRTKLKNVQSGSVMEKTFRAGETVPQATLEKSTM
EFP_CYAP8       MISSNDFRTGTTIELDGSVWRVVEFLHVKPGKGSAFVRTKLKNAQTGSVVEKTFRAGETVPQATLEKRTM
EFP_THEPX       MIAAGDFRKGVTIEVDGQVFTVVDFMHVKPGKGAAFVRTKLKNVMTGAVIEKTFSPTEKFEEAVIERREM
EFP_THEP3       MIAAGDFRKGVTIEVDGQVFTVVDFMHVKPGKGAAFVRTKLKNVMTGAVIEKTFSPTEKFEEAVIERREM
EFP_SYMTH       MISVNDLRNGMTIEMDGTVYQVIEFLHVKPGKGAAFVRTKLKNILTGATIETTFRAGEKVEQANVDRREY
EFP_THEEB       MISSNDFRPGVSIELDGAVWRVVEFLHVKPGKGSAFVRTKLKNVQTGNVIERTFRAGETVPQATLEKRTM
EFP_EXISA       MVSVNDLKTGLTVKTDGSIWQVIEFQHVKPGKGAAFVRTKMRNLRNGAIQETTFRGGEKIERAHIERKRM
EFP_ACAM1       MISSNDFRTGVSIELDGSVWRVVEFLHVKPGKGSAFVRTKLKNVQSGSVVERTFRAGETVPQANLEKRVM
EFP_SYNP2       MISSNDFRTGTSIELDGSVWRVVEFLHVKPGKGSAFVRTKLKNAQTGSVVEKTFRAGETVPQAILDKRTM
EFP_PROM1       MISSNDFRTGTTIELDGAVWRVIEFLHVKPGKGSAFVRTKLKAVVSGSVVEKTFRAGEMVPQALLEKSKL
EFP_PROMT       MISSNDFRTGTTIELDGAVWRVIEFLHVKPGKGSAFVRTKLKAVVSGNVVEKTFRAGEMVPQALLEKSKL
EFP_SYNP6       MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKNAKTGNVVEKTFRAGETVPQAVLEKSTL
EFP_SYNE7       MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKNAKTGNVVEKTFRAGETVPQAVLEKSTL
EFP_DESRM       MISTSDFRTGLTVEIDNDVYQIIEFQHVKPGKGAAFVRTKMRNMRTGAVIERTFNPNEKLAPARIERQEV
EFP_SYNWW       MISVNDFKTGVTIELEGQAFQVVEFMHVKPGKGSAFVRAKLKNVKTGGTVEKTFRGGEKVPRAHLDKREM
EFP_EXIS2       MVSVNDLKTGLTIKTDGMIWQVLEFQHVKPGKGAAFVRTKMRNIRNGNIQEMTFRGGERVERAHIERNKM
EFP_CYAP7       MISSNDFRPGVSIELEGSIWKVVEFLHVKPGKGSAFVRTTLKNVQTGKVLERTFRAGETVPQATIEKRTM
EFP_CLOTH       MISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDM
EFP_SYNJB       MISSNDLRPGVSVEIDGAPYKVIEFLHVKPGKGAAFVRTKLKNMQTGNVVEKTFRAGETLPAATIEKVEM
EFP_SYNJA       MISSNDLRPGVSVEIDGAPYKVIEFLHVKPGKGAAFVRTKLKNMQTGNVVEKTFRAGEMLPAATIEKVNM
EFP_SYNSC       MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKAVKSGNVVEKTFRAGEMLPQAMLEKSSL
EFP_SYNS9       MISSNDFRTGTSIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKSVKNGSVVEKTFRAGEMLPQALLEKSSL
EFP_SYNPX       MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRSKLKAVKTGNVVEKTFRAGEMLPQALLEKASL
EFP_SYNPW       MISSNDFRTGTTIELDGAVWRVVEFLHVKPGKGSAFVRTKLKAVQSGNVVEKTFRAGEMLPQAILEKATL
EFP_MICAN       MISSNDFRSGTTIEIDGSVWRVVEFLHVKPGKGSAFVRTKLKNVQTGNVVERTFRAGETLPSATIEKRTM
EFP_GLOVI       MISSNDFRTGTTIELDGQVWRVIEFLHVKPGKGSAFVRTKLKNVMTGNVNERTFRAGETLPQAVVEKRDM
EFP_COPPD       MISTNDLRPGIIVDLDGTLYLIVTAQHVKPGKGSAFVRVKMKKLSDGSTIEQTFRAGEKVQRAYLETKQM
EFP_CALS8       MVEAGDFRRGLTIEYDGQIFQVIEFLHVKPGKGAAFVRTKLKNIKTGAVIEKTFRPDERMPLAHIERREM
EFP_ANATD       MVEAGDFRRGLTIEYDGQIFQVIEFLHVKPGKGAAFVRTKLKNIKTGAVIEKTFRPDERMPLAHIERREM
EFP_SYNS3       MISSNDFRTGTTIELDGAVWRVVEFLHVKPGKGSAFVRTKLKAVQSGSVVEKTFRAGEMLQQALLEKSTL
EFP_PROMA       MISSNDFRTGTTIELDGAVWRVVEFLHVKPGKGSAFVRTKLKAVQAGNVVEKTFRAGEMVPQALLEKATL
EFP_CYAA5       MISSNDFRTGTSIELDGSVWRVVEFLHVKPGKGSAFVRTKLKNAQTGSVVERTFRAGETVPQATLEKRTM
EFP_SYNY3       MISSNDFRTGTSIVMDGAVWKVVEFLHVKPGKGSAFVRTKLKSVQTGNVVEKTFRAGETVPQANIEKSVM
EFP_ANAVT       MISSNDFRPGVSIVLDGSVWRVIDFLHVKPGKGSAFVRTTLKNVQSGKVLEKTFRAGETVPQATLEKITM
EFP_PROM5       MISSNDFRTGTTIEIDGQVWRVVEFLHVKPGKGSAFVRTKLKSVRNGNVVEKTFRAGESVQQAVLEKSNL
EFP_CYAP4       MISSNDFRPGVSIEWNNGVWRVVEFLHVKPGKGSAFVRTKLKNVQNGNVVEQTFRAGEMVPQANLEKSLM
EFP_PROM4       MISSNDFRTGTTIELDGAVWRVIEFLHVKPGKGSAFVRTKLKAVQSGSVVEKTFRAGEMVPQALLEKTTL
EFP_ANASP       MISSNDFRPGVSIVLDGSVWRVIDFLHVKPGKGSAFVRTTLKNVQSGKVLEKTFRAGETVPQATLEKITM
EFP_PROMP       MISSNDFRTGTTIEIDGQVWRVVEFLHVKPGKGSAFVRTKLKSVRNGNVVEKTFRAGESVQQAVLEKSNL
EFP_PROMS       MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSVQSGNVVEKTFRAGEQVQQAILEKSNL
EFP_PROM9       MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSVQSGNVVEKTFRAGESVQQAILEKSNL
EFP_RHOE4       MASTSDFKNGLVLQIEGQLWTIIEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATVDRRDM
EFP_PROM2       MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSVQSGNVVEKTFRAGESVQQAILEKSNL
EFP_PROM0       MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSVQNGNVVEKTFRAGESVQQAILEKSNL
EFP_EUBR3       MISAGDFRNGVTIEFEGNIYQIIEFQHVKPGKGAAFVRTKLKNIISGGVVEKTFRPTEKCPTAHIDRKDM
EFP_SYNR3       MISSNDFRTGTTIELDGQVWRVVEFLHVKPGKGSAFVRTKLKSAQSGNVVEKTFRAGEMVASALLEKSTL
EFP_PROM3       MISSNDFRTGTSIELDGSVWRVVEFLHVKPGKGSAFVRTKLKAVQSGSVVEKTFRAGEMLPQALLEKSTL
EFP_ACIC1       MATTNDLKNGMTLDLDGELWNVVEFQHVKPGKGPAFVRTKLKHVLTGKVVDKTFNAGVKVDVATVDKRTM
EFP_RHOSR       MASTSDFKNGLVLQIEGQLWTIIEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATVDRRDM
EFP_PROMM       MISSNDFRTGTSIELDGSVWRVVEFLHVKPGKGSAFVRTKLKAVQSGNVVEKTFRAGEMLPQALLEKSTL
EFP_DEIGD       MISVTELRNGTKVEMDGGLWECLEYSHLKMGRGGAKVVTKFRNMETGSIVDRTFNSGEKLQDIYVEGKKM
EFP_SALAI       MATTNDLKNGMVLNLDGELWAVVEFQHVKPGKGGAFVRTTLKNVLSGKVVDKTFNAGTKVDTATVDKRTM
EFP_RHOOB       MASTSDFKNGLVLQIEGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATVDRRDM
EFP_MYCPA       MASTADFKNGLVLVIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKVETATVDRRDT
EFP_MYCA1       MASTADFKNGLVLVIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKVETATVDRRDT
EFP_EUBE2       MVDAGSFKNGITIQYENGIWQVIEFQHVKPGKGSPFVRAKLKNIISGGVIENSFRPTEKFDLAHIDRSEY
EFP_SALTO       MATTNDLKNGMVLNLDGELWAVVEFQHVKPGKGGAFVRTTLKNVLSGKVVDKTFNAGTKVETATVDKRTM
EFP_CORA7       MADTTDFKNGLVLKIDNKLQQIVEFQHVKPGKGPAFVRTKLKDVVSGKVTDKTFNAGVKVETANVDRRDM
EFP_CLOCE       MIVAGDFKNGVTFELDNNIFQVVEFQHVKPGKGAAFVRTKLKNIITGATVERTFNPTDKMPKAHIERKDM
EFP_MYCSS       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_MYCSK       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_MYCSJ       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_COREF       MASTADFKNGLVLKVDGKLQQIVEFQHVKPGKGPAFVRTKLKDVVTGKTVDKTWNAGVKVETATVDRRDM
EFP_FRASC       MATTNDLKNGMTLDIDGVLWNVVGFQHVKPGKGGAFVRTTLKNVLTGKVVDRTFNAGVKVDVATVDRREM
EFP_ENTFA       MIAASDLKAGMTFEQDGKLIKVMEASHHKPGKGNTVMRMKLKDVRTGSTTDTTMRPDEKVKKAHIDTKPV
EFP_ACHLI       MVSTSDFKTGLTIEVDGQIYVILDFLHSKTARSGALINTRLRNLRTKNIQEITFKSGDKVERAIIDRIKM
EFP_NOCFA       MADTSDFKNGLVLKIDGQLQQIVEFQHVKPGKGPAFVRTKLKNVVSGKIVDKTFNAGVKVETATVDRRDM
EFP_MYCS2       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_FINM2       MIQAGDFRKGTTFEMDGDVWQIIDFQHVKPGKGAAFVRTKIRSVMTGSNRDMTFNPNEKYEEARIETREM
EFP_CLOD6       MVSAGDFRKGVTFEKDGQPCLVVDFQHVKPGKGAAFVRTKYKNLKTGAIREESFNPSEKFPKAVIDTRQM
EFP_MYCVP       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_ARTAT       MATTNDIKNGTVLKLEGQLWNIIEFQHVKPGKGGAFVRTKMRNVMSGKVVDKTFNAGLKIETATVDRRDY
EFP_KOCRD       MATSNDIKNGTILKLDGNLWQTIEFQHVKPGKGGAFVRTKLRNVTSGKVVDKTFNAGAKIETATVDRSEY
EFP_CLOBM       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOBL       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOBK       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOBJ       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOBH       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOB6       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOB1       MISAGDLRKGTTFEQDGQVYVVVEFLHVKPGKGAAFVRTKLKNAITGAVTETTFNPTAKLQEAVIERKEM
EFP_CLOAB       MISAGDLRKGTTFELDGQVYNVVDFLHVKPGKGAAFVRTKLKNVITGAVTETTFNPTAKMQEAVIERKEM
EFP_MYCA9       MASTADFKNGLVLNIDGQLWQITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATVDRRDT
EFP_CORK4       MATTADFKNGLVLKLDNKLQQIVEFQHVKPGKGPAFVRTKLKDVVSGKVVDKTFNAGVKVETATVDRRDM
EFP_MYCMM       MASTADFKNGLVLQIDGQLWSIVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKVETATVDRRDT
EFP_CLOBB       MISAGDLRKGVTFEFDGQVFTVTDFLHVKPGKGAAFVRTKLRNVISGGVVDRTFNPTEKLQEAVIERKEM
EFP_CLOBA       MISAGDLRKGVTFEFDGQVFTVTDFLHVKPGKGAAFVRTKLRNVISGGVVDRTFNPTEKLQEAVIERKEM
EFP_CLAMS       MASTADIKNGVVLNMDGQLWTVIEFQHVKPGKGGAFVRTKVKNVMSGKVVDRTFNAGAKIETETVDRRDF
EFP_CLAM3       MASTADIKNGVVLNMDGQLWTVIEFQHVKPGKGGAFVRTKVKNVMSGKVVDRTFNAGAKIETETVDRRDF
EFP_MYCUA       MASTADFKNGLVLQIDGQLWSIVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKVETATVDRRDT
EFP_MYCGI       MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVVDKTYNAGVKVETATVDRRDA
EFP_PHYAS       MINTNDFKTGQTIKFNNQIYQIIEFLHVKPGKGTAFVRSKLRNLRTGSVIDHTFNAGIKLEPALINKIKM
EFP_SACEN       MASTNDLKNGLVLNLDGQLWSVVNFQHVKPGKGGAFVRTTLKNVLSGKVVDKTFNAGVKVDTANVDRREM
EFP_ARTCA       MATTNDIKNGTVLKLEGQLWNIIEFQHVKPGKGGAFVRTKMRNVMSGKVVDKTFNAGLKIETATVDRRDY
EFP_WOLSU       --SMSDLKKGLKVEIEGVPYKIVEYQHVKPGKGAAFVRVKMKSFFDGRVLEKTFHAGDKCEEPNLQEKNM
EFP_DEIRA       MISVTELRNGTKVQMDGGLWECLDYSHLKMGRGGAKVVTKFRNMESGSIVDRTFNSTEKLQDIYVEGKKM
EFP_CLOK5       MISAGDLRKGTTFEQDGQVYTVVDFLHVKPGKGAAFVRTKLRNVITGSVTDTTFNPSAKLQEAVIERKEM
EFP_ARTS2       MATTNDIKNGTVLKLEGQLWNIIEFQHVKPGKGGAFVRTKMRNVMSGKVVDKTFNAGLKIETATVDRRDY
EFP_AQUAE       -IDINRIQKDIFIEHKGEPYRVLDYEHVKPGKGQAFVRVKAKNMLTGNVTELTFKASDRIPLADFEQVYA
EFP_FRASN       MATTNDLKNGMTLDIDGVLWNVVGFQHVKPGKGGAFVRTTLKNVLTGKVVDRTFNAGIKVDVATVDRREM
EFP_DEIDV       MISVTELRNGTKVEMDGGLWECLDYSHLKMGRGGAKVVTKFRNMETGSIVDRTFNSGEKLQDIYVEGKKM
EFP_LEIXX       MASTADIKNGIVINIDGQLWSVIEFQHVKPGKGGAFVRTKLKNVTTGKTVDRTYNAGAKIDITNVDRRDY
EFP_THEYD       MISTSEFKKGLKIEYKGEPYEIIDFQHVKMQQRAPIVRTKIKHLKTGRVLEENFPAGEKFEKPELEEKQM
EFP_CORU7       MATTADFKNGMVLMIDGKLQQIVEFQHVKPGKGPAFVRTKLKDVVSGKTVDKTFNAGVKVEQATVDRRDM
EFP_ONYPE       MINTNDFKTGQTIKFNNQIYQILEFLHVKPGKGAAFVRTKLRNLRTGSVIDYTFNAGIKVQPALITKIKM
EFP_ALKOO       MISASDFRKGVTFEMNGEPYVVLDFQHVKPGKGAAFVRTKYKNLKNGGTREEAFNPSDKFPKAHIETKEM
EFP_RUBXD       MISTNQFRNGSAIRVDGKRFTILSFQHVKPGKGHAFVRTRLRNMDTGAVIERTFRAGEKVESIRTDSRPM
EFP_DESAD       MISTKDFRNGLKIEIDGKPYEIVEFQHFKPGKGGAFVRTKLRNMFTGRITDQTFRSGEKVKKPDMATKEM
EFP_CORDI       MATTADFKNGLVLKIDNKLQQIIEFQHVKPGKGPAFVRTKLKDVVSGKVTDKTFNAGVKVETATVDRRDM
EFP_CLOTE       MISAGDLRKGNTFELDGQVYTVVDFLHVKPGKGAAFVRTKLRNVLNGGLKETTFNPTEKFQEAVIERKEM
EFP_NOCSJ       MATTNDLKNGMVLNIDGQLWAVVEFQHVKPGKGPAFVRTKLKNVESNKTVDKTFNAGTKVETATVDRRTM
EFP_CLOPH       MISAGDFRNGLTLEIDNAVYQVIEFQHVKPGKGAAFVRTKLRDIKNGGLTERTFRPQEKYPQAHIERSDM
EFP_AYWBP       MINTNDFKTGKTIKFNNQIYQILEFLHVKPGKGSAFVRTKLRNLRTGSVIDYTFNAGIKVQPALITKIKM
EFP_CLONN       MISAGDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVISGGVTETTFNPTAKLQEAVIERKEM
EFP_STRGG       MASTNDLKNGLVLKLDGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATIDRRDM
EFP_HELAH       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_DESOH       MYEAGELRKGLKVEIDGDPYVIMEFEFVKPGKGQALYKCKLKNMLTGSQYDHTYRSGDKVGRANLEERKM
EFP_STRAW       MASTNDLKNGLVLKLDGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATIDKRDM
EFP_BEUC1       MASTNDLKNGLVLDLDGQLWTVVEFQHVKPGKGPAFVRTKLKHVLSGKTVDKTFNAGIKVDTATVDKRDM
EFP_HELPH       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_HELP2       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_DESMR       MLSTTDFRRGLKIEMDGVPYEIVDFLHVKPGKGGAFIRTKLKNMINGRVVENTFRSGEKMVKPDLESKDM
EFP_HELPY       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_HELPS       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_HELPG       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_CAMJR       --SMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCEAPNLEDKTM
EFP_CAMJJ       --SMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCEAPNLEDKTM
EFP_CAMJE       --SMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCEAPNLEDKTM
EFP_CAMJD       --SMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCEAPNLEDKTM
EFP_CAMJ8       --SMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCEAPNLEDKTM
EFP_HELHP       -IGMSELKKGLKIEIDGIPYRITEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLQEKTM
EFP_CORJK       MATTADFKNGLVLKVDGKLQQIVEFQHVKPGKGPAFVRTKLKDVVSGKTIDKTWNAGVKVETATVDRRDM
EFP_ALHEH       --STNEFKGGLKIMLDGDPYTIVENEFVKPGKGQAFNRVKVRNLKTGKVIDRTFKSGESVEAADVLETEM
EFP_HELPJ       -IGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKSFLDGKVIEKTFHAGDKCEEPNLVEKTM
EFP_DESDG       MYSTTDFRRGLRIEIDGTPFEIVDFQHFKPGKGGAIVRTKMRNLLTGRIMDNNFRSGEKVGRPDMENRDM
EFP_LACF3       MIQTIDLKKGMVFEKDGKLLKVLAINHHKPGKGNTLMQMDIQDVRSGSIVHTTMRPSEKVEQVMVNKKNA
EFP_BIFA0       --TTNDIKNGSILNLDGQLWQVIKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMDFETVDNRTL
EFP_CORGL       MATTADFKNGLVLKNEGKLQQIIEFQHVKPGKGPAFVRTKLKDVVTGKTIDKTWNAGVKVETATVDRRDV
EFP_CORGB       MATTADFKNGLVLKNEGKLQQIIEFQHVKPGKGPAFVRTKLKDVVTGKTIDKTWNAGVKVETATVDRRDV
EFP_STRCO       MASTNDLKNGLVLKLEGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATVDKRDM
EFP_STRPZ       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRPG       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRPD       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRPC       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRPB       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRP8       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRP6       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRP3       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRP1       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_HALHL       --STNEFKGGLKIMLDGDPFTIVENEFVKPGKGQAFNRVKLRNLKTNRVVEKTFKSGESVEAADVMETEL
EFP_ALKMQ       MISAGDFRKGVTFVMDGHPYVVIDFQHVKPGKGAAFVRTKYKNLKTGSTREEAFNPSDKFPRAHIETKEM
EFP_STRPM       MIEASKLKAGMTFESEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_CAMLR       ---MGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKSFIDGKVLEKTFHAGDKCESPNLEEKQM
EFP_MYCTU       MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKXXXXXXXXXXX
EFP_MYCTA       MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKXXXXXXXXXXX
EFP_MYCBT       MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKXXXXXXXXXXX
EFP_MYCBP       MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKXXXXXXXXXXX
EFP_MYCBO       MATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKXXXXXXXXXXX
EFP_HYDS0       -IDINRIQRDMFIEYKGEPYRVVDYDHVKPGKGQAFVRVKAKNMNTGNAIEITYKSSDSIELADFEQVFA
EFP_BIFLO       --TTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTL
EFP_BIFLI       --TTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTL
EFP_BIFLD       --TTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTL
EFP_STRPF       MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDETFEQAIIETVPA
EFP_THEAB       MVDVGSLSKGMYIKYEGEIYRVIDVNKHFRARGSGLIRTKLKNMSTGLVREVNFNSGEKVEEAEITFRKA
EFP_CAMFF       --SMGDLKKGLKIELDGVPYKIVEYQHVKPGKGAAFVRVKIKSFVNGKVLEKTFHAGDKCESPNLVEKEM
EFP1_LACAC      MVQAINLKKGMIFSQDGKLIKVLKANHHKPGKGNTVMQMDLRDVKSGAVVHKTMRPTEKVDLVEVTKKSA
EFP_STRMU       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTVMRMKLRDVRTGSTFDTTYRPEEKFEQAIIETRPA
EFP_STRA5       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRA3       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRA1       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRZT       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRZP       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRZJ       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRR6       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRPS       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRPN       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRPJ       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRPI       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRP7       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRP4       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRP2       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_FERNB       MIEVGDLEKGMYIKYEGDIYRVVDVNKHFRARGSGLIRTKLKSLSTGLIRDANFASGEKVEEAELSFRKA
EFP_THEM4       MIDVGSLSKGMYIKYDGDIYRVVDVNKHFRARGSGLIRTKLKNLSSGLVREVNFNSGEKVEEAEVTFRKA
EFP_SULNB       -IGMGDIKKGVRLELDGNPYKVTEFQHVKPGKGAAFVRVKIKNLKTGKVIEKTVHAGDKFEVPELEQKTM
EFP_CLOPS       MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEM
EFP_CLOPE       MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEM
EFP_CLOP1       MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEM
EFP_DESDA       MYSTTDFRKGLKIEVEGIPYEIVDFQHFKPGKGGAMVRTKLRNILTGRMQDITFRSGEKVNKPDLETRDM
EFP_TROWT       MASTSDIRNGVVLNINGQLNTVIEFQHVKPGKGGAFVRTKLKNILTGKVVDKTFNAGASVVLENVDRRDC
EFP_TROW8       MASTSDIRNGVVLNINGQLNTVIEFQHVKPGKGGAFVRTKLKNILTGKVVDKTFNAGASVVLENVDRRDC
EFP_LACRJ       MIQTIDLKKGMVFERDGKLLKVLQINHHKPGKGNTLMQMDIQDLRSGSIVHTTMRPSEKVEQVNVDKRSA
EFP_LACRD       MIQTIDLKKGMVFERDGKLLKVLQINHHKPGKGNTLMQMDIQDLRSGSIVHTTMRPSEKVEQVNVDKRSA
EFP_HERA2       MVSTGEVRKGLTLIIDGELFRVMEANHVKQGRGTAFLRLTLRNVRTSATTVKTFMAGERFEVARLSTRNV
EFP_SALRD       MADTSDFRNGMTFIWKDDLWEIVDFLHVKPGKGGAFVRTTLKNVKDGHEVEETFRAGAKVDEVRVERREH
EFP_DESVM       MYSTTDFRKGLKIEIDGTPFEIVEFQHFKPGKGGAMVRTKLRNLLNDRMVDNTFRSGEKVGRPDMETREM
EFP_THET8       MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETREL
EFP_THET2       MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETREL
EFP_MYCAP       MINVNTFKPGITFEDDGDIFVVLEAQHSKQGRGQANVKAKVKNLRTGSTVIKSYTGGVMVSRAHIDKRPM
EFP_DESAA       MINAGELRKNTKLMIEGEPYVMLEVQFVKPGKGVAFYKCKMRNLMTGSLLERTYRSGDTFEPAALEEKKM
EFP_CHRSD       --STNEFKGGLKVMLDGDPCSILENEFVKPGKGQAFSRVKLRNLITGRVWERTFKSGESLEGADVLELDM
EFP2_PORGI      MATTADFRNGMCLEIEGQYYFIVEFLHVKPGKGPAFVRTKLKNVTTGRILDKTWNSGVKVEEVRIERRPY
EFP_METCA       IVSTSEFKNGLKVMLDGDPCTMLESEFVKPGKGQAFNRVKLRNLKTGRVVERTFKSGETLETADVVDVEM
EFP_CHLAD       --TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPM
EFP_PERMH       -IGINQIKKDMFIVHDGQPYRVLDYDHVKPGKGQAFVRVKAKNMKTGNVIEITYKSSESIELADFEQRQM
EFP_BDEBA       MYETSDFRKGLKIMLEGKPYVIVDFQHVKPGKGNQFTRTKLRNMLTGQNLESTFKSGEKFEVPNVENKEM
EFP1_PORGI      MATTADFRNGMCLEIEGQYYFIVEFLHVKPGKGPAFVRTKLKNVATGRILDKTWNSGVKVEEVRIERRPY
EFP_TERTT       --STNEFKSGLKVMLDGDPCSIVENEFVKPGKGQAFNRVKMKNLKSGRVWERTFKSGESLEGADVVDRDM
EFP_DICT6       MISVNDFYPGLTIELDGEIYIVLEYQHVHMAQGQATVRVKLKNLKTGNVIRKTFKSDEYVPQAFINKREA
EFP_AMOA5       MATTSDFRNGLCIEFNNDLYTIVEFQHVKPGKGGAFVRTKLKSLTNGKVIDNTFNSGVKITTARIERKTY
EFP_CHLSY       --TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPM
EFP_CHLAA       --TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPM
EFP_NITOC       --STSEFKSGLKVMMDGDPYTIMENEFVKPGKGQAFNRVKLRNLKTGRVIDRTFKSGDSLEAADVIETQL
EFP_DICTD       MISVNDFYPGLTIELEGEIYIVLEYQHVHMAQGQATVRVKLKNLKTGNVIRKTFKSDEYVPQAFINKREA
EFP_SACD2       --SASDFRSGLKVMLDGDPCAIVENELVKPGKGQAFARVRLRNLKTGRVWERTFKSGETLEGADVMDRDM
EFP_DICNV       --STNEFRGGLKIMLDGDPYTIVENEFVKPGKGQAFNRTKVRNLKTGRVLERTFKSGESVEAADVLEMNM
EFP_SULSY       -IDINRIARDQFILVDNQPYKVVSYEHVKPGKGQAFVRVKAKNMRTGNVTEFTFKSSDSIELADFEQRFM
EFP_FRAP2       --STNEFKGGLKILIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELNA
EFP_COXBU       --STNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEM
EFP_COXBR       --STNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEM
EFP_COXBN       --STNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEM
EFP_COXB2       --STNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEM
EFP_PSYCK       --STNEFKSGLKVMLDGNPCAILENEFVKPGKGQAFNRVKLRNLRSGKVLEQTFKSGDSLEAADVMDTEM
EFP_FRATN       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_PETMO       MIDVGDLRKGDMIVYQNEMYRVIEANKHFMGRGSGLIRTRLKSVITGLIKEVSFSSGEKVEEADISFRKA
EFP_MYCH7       MINVNEFRPGITFEFENEIYVVISAQHSKQGRGQANVKTKVKNLRTGAITIKTFSGGERVEKAHIEKISM
EFP_MYCH2       MINVNEFRPGITFEFENEIYVVISAQHSKQGRGQANVKAKVKNLRTGAITIKTFSGGERVEKAHIEKISM
EFP_THISH       --STSEFKSGLKILMDGDPYAIIENEFVKPGKGQAFNRVKVRNLKTGRVLEKTFKSGDSVEAADVMDTNM
EFP_ALCBS       --STSEFKSGLKVMLDGDPCSIIENEFVKPGKGQAFSRVKLRNLRNGKVWERTFKSGDSLEGADVMDVSM
EFP_COXB1       --STNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEM
EFP_PSYA2       --STNEFKAGLKVMLDGNPCAILENEFVKPGKGQAFNRVKLRNLRSGKVLEQTFKSGDSLEAADVMDTEM
EFP_MYCHJ       MINVNEFRPGITFEFENEIYVVISAQHSKQGRGQANVKTKVKNLRTGAITIKTFSGGERVEKAHIEKISM
EFP_KOSOT       MVEVGDIRKGMALIIDNDIYIVLDVNKHFTARGSGIIRTKMKNIRTGYVREFKFNSGEKVEEASLSLRHV
EFP_HAHCH       --STNEFKSGLKIMLDGDPCSIIENEFVKPGKGQAFNRVKFRNLKSGRVGERTFKSGDSVEGADVVDLDM
EFP_FRATW       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRATT       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRATO       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRATM       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRATH       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRATF       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_FRAT1       --STNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTT
EFP_ACIAD       --STNEFKQGLKVMLDGNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDSLEAADIVEVEM
EFP_LEPBP       -LGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKM
EFP_LEPBA       -LGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKM
EFP_SULDN       -IGMGDIKKNIRLIIGEVPCKVIEFQHVKPGKGAAFVRMKAKSFLNGRVFEKTVHAGDKFEVPEITFKTM
EFP_PSYWF       --STNEFKAGLKVMYDGNPCAIIDNEFVKPGKGQAFNRVKLRNLRTGKVLEQTFKSGESLEGADVVDTEM
EFP_MARMS       -ISTSEMRSGSKVMVDGDPCAIIDNEHVKPGKGQAFNRIKLRNLKTGRVWERTFKSGDTLETADVMDTDM
EFP_ACIF5       -ISAFDIRPGNILEYEKGLWRVLKTDFVKPGKGGAFVQVEMKNIETGTKSNTRFRSGEAMEKAVVEPRTM
EFP_ACIF2       -ISAFDIRPGNILEYEKGLWRVLKTDFVKPGKGGAFVQVEMKNIETGTKSNTRFRSGEAMEKAVVEPRTM
EFP_UNCTG       MISTSDFKNGTNILVDGEPYQIAWFQNHKPGKGGAVMRVKLRHLKKGGIIERTFKSGEKFKALTITRQKK
EFP_DESAH       MYDASDLRKGLKFEIDGDPFVIVDFQFKKPGKGQALYKCKLRNMISGAQFERTFRSGDKFNEASLEEHDM
EFP_ACIC5       -IPATQMRPGMIIKHNGELHAVFSVEHRTPGNLRAFIQAKLRNLRSGAMFEHRFRSPDPIERVIVDEIPM
EFP_MYCMO       MVNVNNFKNGITFQEEDEIFSVIEAQHSKQGRGQASVKAKVKNLRTGAITIKSYTGGDKVKKAHIEKIEM
EFP_STRU0       MIEASKLRAGMTFESEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STRSV       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_GRAFK       MASTSDIRNGLCIRYNHDIYKITEFLHVKPGKGPAFVRTKLKSVTTGKVLDNTFSAGHKIEEIRVETHKF
EFP_SYNAS       MYSASDLRKNLRIKLEGDPYIITEFNFVKPGKGQALYRCKLKNMITGNQFERTFRSVDNFEAADLQEKKM
EFP_PSEHT       --STNEFKGGLKIMMDGEPSSIIENEMVKPGKGQAFNRVRIRKLISGKVLEKTFKSGESVEGADVMDTDL
EFP_IDILO       --STSEFKGGLKIMQDGEPCSIVENEMVKPGKGQAFNRVKIRKLISGKVVEKTFKSGESVEGADVIELEL
EFP_STRGC       MIEASKLKAGMTFETDGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRS7       MIEASKLRAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_STREM       MIEASKLRAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_ACIBT       --STNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEM
EFP_ACIBC       --STNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEM
EFP_ACIB5       --STNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEM
EFP_ACIB3       --STNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEM
EFP_VIBCM       -VSTNEFKGGLKIMLDNEPCVILENEYVKPGKGQAFNRVRIRKLLTGKVLEKTFKSGDTAEVADVVDIDL
EFP_VIBCH       -VSTNEFKGGLKIMLDNEPCVILENEYVKPGKGQAFNRVRIRKLLTGKVLEKTFKSGDTAEVADVVDIDL
EFP_VIBC3       -VSTNEFKGGLKIMLDNEPCVILENEYVKPGKGQAFNRVRIRKLLTGKVLEKTFKSGDTAEVADVVDIDL
EFP_BACFR       MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPY
EFP_BACFN       MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPY
EFP_STRE4       MIEASKLRAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPA
EFP_VIBVY       -VSTNEFKGGLKLMIDSEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGDTCEVADVMDIDL
EFP_VIBVU       -VSTNEFKGGLKLMIDSEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGDTCEVADVMDIDL
EFP_VIBPA       -VSTNEFKGGLKLMLDNEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGDTCEVADVMDIDL
EFP_THELT       MVEVGDLKKGMVIMVNGEPHRVVDVSKHHMAMGRGIIRTKLKSVVTGFVKDVNFSSGERVEEANLSFRQA
EFP_COLP3       --STNQFKAGLKIMLDGEPCNILENELVKPGKGQAFSRVKIRKLVSGKVLEKTFKSGETVEGADVMEVEL
EFP2_GEOSL      ---------------------VIAFEFSKPGKGQALYRTKMRNMITGVILDRTYRSGETFEPARLEERRM
EFP_SODGM       --STNEFRSGLKIMLDGEPCAIIENEFVKPGKGQAFNRVRLRKLVSGKVLEKTFKSGDSVEAADVMDINL
EFP_MYCA5       MINVNDLKSGVTFQLEGAIYVVLEASHSKQGRGQANVKVKVKDLRTGSTTIRSFTGGEKVERAMIEKTNM
EFP_BACTN       MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPY
EFP_VIBF1       -VSTNEFKGGLKFMLDNEPCSIIENEYVKPGKGQAFNRVKLRRLLSGKTLEKTFKSGESFELADVVDVEL
EFP_FLAPJ       MASTSDIRNGLCIKFNHDIYKIIEFLHVKPGKGPAFVRTKLRSLSNGKVLDNTFSAGHKIDEVRVETHTY
EFP_MYCS5       MIEVNKFKPGITFQDSGNIYVVLEATHSKQGRGQANVKAKAKNLRTGATTILSFTGGDKVEPAHIEKRKM
EFP_MYCLE       MATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKXXXXXXXXXXX
EFP_MYCLB       MATTADFKNGLVLVIDGQLWTIIGFQHVKPGKGPAFVRTKLKNVLSGKVVDKTYNAGVKXXXXXXXXXXX
EFP_CHLT3       MATTSDLAKGVILRFNGNLHILEEISHHTPGNKRGFYQAKMRNLRNGRIVENKFRSGEAVEIVSTERRKH
EFP_BACV8       MINAQDIKIGTAIRMDGKLYFCIDFLHVKPGKGNTFMRTKLKDVVNGYVLERRFNIGEKLEDVRVERRPH
EFP_VIBHB       -VSTNEFKGGLKLMLDNEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGDTCEVADVMDIDL
EFP_ROSS1       MATTSDLRTNMIIRYNGQLHRVVEFYHHAPGNWRAMVIMKLKNLETGKTIEERVRAGSEIEIVRVEKRPM
EFP_DESPS       MLSASDLRKGLKLDIEGSPYIIIDFDFSKPGKGQALYRCKMRNMITGNQLVKTYRSSDKFEKASLEERKM
EFP_PHOLL       --STNEFRSGLKIMLDGEPCAILESEFVKPGKGQAFARVRIRKLISGKLLEKTFKSTDSVESADVMDMNL
EFP_LEPIN       -LGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNM
EFP_LEPIC       -LGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNM
EFP_HAMD5       --SSNEFRSGLKIMLDGEPCSIIESEFVKPGKGQAFVRTRIRKLISGKLLEKTFKSTDSVEGADVVDMNL
EFP_VIBSL       -VSTNEFKGGLKFMLDNEPCAIIDNEYVKPGKGQAFNRVKLRKLLSGKVLEKTFKSGESFELADVVDVEL
EFP_MYCPU       MINVNEFKPGITFEDEGNIYVVLTAQHSKQGRGQANVKAKVKNLRTGSTTLKSYTGGDKVQKAHIEKKPM
EFP2_CHLCV      -VSTSEFRVGLRIEIDGQPYLILQNDFVKPGKGQAFNRIKVKNFLTGRVIERTFKSGESVETADVREQQM
EFP_LEPBL       -LGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNM
EFP_LEPBJ       -LGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNM
EFP_RICFE       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDYLEKAELEQKDY
EFP_STRT2       MIEASKLRAGMTVTNDGKLLKVLEASHHKPGKGNTIMRMKLRDVRSGSTFDTSYRPEEKFEQAIIETVPA
EFP_SALTY       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALTI       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALSV       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALPK       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALPC       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALPA       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALNS       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALHS       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALG2       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALEP       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALDC       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALAR       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SALA4       ----NDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_LAWIP       MYSTTDFRKGLKIEIDGVPYDIIDFQHFKPGKGGAMVRTKLRNILNGRVIDNTFRSGEKVERPNLESRDM
EFP_THEMA       MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLIRTKLKNVKTGFVREVNFPSGEKVQEAELSFRKA
EFP_RHOBA       --NTSDFRKGLKVQIDGEPYLITEMNFVKPGKGNAMYKCKMKNLIRGTTLDRTYKGGDSLEAADVETTTV
EFP_ENT38       ----NDFRAGLKIMMDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_DESVV       MYSTTDFRKGLKIELDGTPFEIVDFQHFKPGKGGAMVRTKLRNILNGRVVDNTFRSGEKVGRPDLESRDM
EFP_DESVH       MYSTTDFRKGLKIELDGTPFEIVDFQHFKPGKGGAMVRTKLRNILNGRVVDNTFRSGEKVGRPDLESRDM
EFP_YERE8       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDLNL
EFP_RUTMC       --AINQFKNGLKLILDGNPCSIVNNEIVKPGKGQTFNRVKFKDLITGKTLIKTFKSGETLEGADVMELDL
EFP_PECCP       --SSNDFRSGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSAEGADVVDTNM
EFP_KLEP7       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_KLEP3       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ENTS8       --SSNDFRAGLKIMMDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGSRVEKTFKSTDSAEGADVVDMNL
EFP_XYLFT       ---MNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDM
EFP_XYLFA       ---MNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDM
EFP_XYLF2       ---MNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDM
EFP_STRTD       MIEASKLRAGMTVTNDGKLLKVLEASHHKPGKGNTIMRMKLRDVRSGSTFDTSYRPEEKFEQAIIETVPA
EFP_STRT1       MIEASKLRAGMTVTNDGKLLKVLEASHHKPGKGNTIMRMKLRDVRSGSTFDTSYRPEEKFEQAIIETVPA
EFP_RICRS       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSADYLEKAELEQKDY
EFP_RICRO       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSADYLEKAELEQKDY
EFP_SHISS       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SHIFL       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SHIF8       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SHIDS       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SHIBS       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_SHIB3       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_PHYMT       MISTNDFKTGQTIKFNNNLFQIVSFLHVKPGKGAAFVRCKLKNLRTGSIIDNTFNSGIKVELAFINKNKI
EFP_PARL1       -INGNEIRPGNVIEHEGGLWAAVKVQHVKPGKGGAFAQVELKNLVDGRKLNERFRSAETVERVRLEQKDY
EFP_ESCF3       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOUT       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOSM       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOSE       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOLU       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOLI       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOLC       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOL6       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOL5       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOK1       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOHS       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECODH       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECOBW       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO8A       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO81       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO7I       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO5E       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO57       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO55       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO45       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO27       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_ECO24       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP2_PARUW      -MSTSEIRGGVKVEVEAQPYTIISNEFVKPGKGQAFNRIKMKHLLTGRVIERTFKSGEKLNLADVAEEEM
EFP2_CHLMU      -VSTSEFRVGLRVEIDGQPYVILQNDFVKPGKGQAFNRIKVKNFLTGRVIEKTFKSGESIETADVREQQM
EFP_YERPY       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPS       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPP       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPN       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPG       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPE       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPB       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERPA       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_YERP3       ----NDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNL
EFP_THESQ       MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLIRTKLKNVKTGLVREVNFPSGDKVPEAELSFRKA
EFP_THEP1       MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLIRTKLKNVKTGLVREVNFPSGDKVPEAELSFRKA
EFP_RICAE       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSANYLEKAELEQKDY
EFP_MYCMS       -MSVNDLRPGTTFLYDGNIYLVLEQAFSKTGRQQGKVTVKAKNMRTGARVELTFTGGEKVDKAMIERKEM
EFP_CITK8       ----NDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNL
EFP_AZOPC       MATTADFKSGMCLNLEGRYYYIVEFLHVKPGKGPAFVRTKLKSVTTGRVIEKTFNAGVKIDEVRIERRLY
EFP2_CHLTR      -VSTSEFRVGLRVKIDGQPYVILQNDFVKPGKGQAFNRIKVKNFLTGRVIEKTFKSGESIETADVREQQM
EFP_THENN       MIEVGDLKKGMFIIYDGEIYRVLEASKHFMGRGSGLVRTKLKNVKTGLVREVNFPSGEKVPEAELSFRKA
EFP_RICPU       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSADYLDKAELEQKDY
EFP_PHOPR       --STNEFRSGMKIMLDNEPCVIIENEFVKPGKGQAFSRVKIRKLLSGKVLEKTFKSGXXXXXXXXXXXXL
EFP_RICM5       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNARFSSSDYLEKAELEQKDY
EFP_LEGPH       --STNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEM
EFP_SILPO       -INGNEIRPGNVLEHNGGLWAAVKVDHVKPGKGGAFAQVELRNLRNGSKLNERFRSADKVERVRLEQKDQ
EFP_RICAH       -ISANSIRTGNILVCNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGIKRNDRFSSSDYLEKAELEQKDY
EFP_LEGPL       --STNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEM
EFP_SERP5       --SSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSCEGADVVDTNM
EFP_ROSCS       MATTSDLRTNMIIRHNGQLHRVMEFYHHAPGNWRAMVIMKLKNIETGKTIEERVRAGSEIEIVRVEKRPM
EFP_SILST       -INGNEIRPGNVLEHNGGLWAAVKVDHVKPGKGGAFAQVEMKNLRNGSKLNERFRSADKVERVRLEQKDQ
EFP_MESFL       -MSVNDLRPGTTFIYEGNLFVVIEQSFSKTGRQQGKVSVKAKNLRTGSRVEITFTGGEKVEKAMIERKDM
EFP_LEGPC       --STNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEM
EFP_LEGPA       --STNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEM
EFP_LACLS       MVLAKDLKSGMTFLNGEKLLRVMEASHHKPGKGNTIMRMKLKDVRSGSTFDDTYRPEDKFEQAVIETVTA
EFP_LACLM       MVLAKDLKSGMTFLNGEKLLRVMEASHHKPGKGNTIMRMKLKDVRSGSTFDDTYRPEDKFEQAVIETVTA
EFP_HAEPS       --STNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGSTVEAADVVDYNY
EFP_BRUME       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAESVERVRLEQKDF
EFP_BRUMB       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAESVERVRLEQKDF
EFP_BRUAB       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAESVERVRLEQKDF
EFP_BRUA2       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAESVERVRLEQKDF
EFP_BRUA1       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAESVERVRLEQKDF
EFP_BRUO2       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAETVERVRLEQKDF
EFP_RICCN       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSANYLEKAELEQKDY
EFP_ERWT9       --SSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSAEGADVVDTNL
EFP_BRUSU       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAETVERVRLEQKDF
EFP_BRUSI       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAETVERVRLEQKDF
EFP_BRUC2       -INGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAETVERVRLEQKDF
EFP2_CHLPN      -VSTSEFRVGLRIEIDGQPYLILQNDFVKPGKGQAFNRIKVKNFLTGRVIERTYKSGESVETADIVERSM
EFP_XYLFM       ---MNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDM
EFP_ERWCT       --SSNDFRSGLKIIFESEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSLEGADVVDTNM
EFP_PROMH       --NTNDFRSGLKIMLDGEPAVITECEFVKPGKGQAFARVRLRKLISNKLLEKTFKSTDSAEGADVMDINL
EFP_VESOH       --SINQFKNGLKLMLDSNPCSILNNEIVKPGKGQAFNRVKFKDLITGKTLIKTFKSGEFLEGADVMELDL
EFP_MAGSM       MLSHTEMKQGKRVLIDDQPWIIVKADFVKPGKGQAFTKIKVKNLMDGRVIERTFXXXXXXXXXXXXXXEM
EFP_LACLA       MVLAKDLKSGMTFLNGEKLLRVMEASHHKPGKGNTIMRMKLKDVRSGSTFDDTYRPEDKFEQAVIETVTA
EFP_PARD8       MINSQDIKKGTCIRLDGKLYFCVDFLHVKPGKGNTIMRTTLKDVVKGGQIERRFNIGEKLEDVRVERRPY
EFP_ACTP7       --STNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNY
EFP_ACTP2       --STNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNY
EFP_RHOCS       -VNANTMRKGHILEDGGKLYVITAANIVQPGKGGAFIQLEMKDVRTGTKTSMRFRTQETVERARLDEHEM
EFP_NITMU       -VLATEIRVGNLIEWDKRIWRVLKCYHVHVGRGGAFMQVEMKDIEAGTKTNQRIRTEDKVERAFVEPREM
EFP_RICCK       -ISANSIRTGNILVYSNDLWVVSRTEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDYLEKAELEQKDY
EFP_PELUB       ----SEIRVGMLIEYKNDLWQVLKTQHVKPGKGGAFAQVEMKSVNKNTKLNERFRSSESVEKASLDETKF
EFP_FLAJ1       MASTSDIRNGLCIKFNHDIYKIIEFLHVKPGKGPAFVRTKLKSLTSGKVLDNTFSAGHKIDVIRVETHTF
EFP_RICBR       -ISANSIRTGNILVYNNDLWVVSKQEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDHLEKAELEQKDY
EFP_RICB8       -ISANSIRTGNILVYNNDLWVVSKQEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDHLEKAELEQKDY
EFP_MESSB       -INGNEIRPGNVIEHNGGLWVAVKTNAVKPGKGGAYNQVELKNLIDGTKLNERFRSAETVEKVRLEQKDF
EFP_HAEDU       --STNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNY
EFP_STRMK       ---MNDVKNGMKILVNNQPAVIIDTEYVKPGKGQAFTRVKYRLIKDGRTQEVTMKSTDSLDAADVVDTDM
EFP_RICPR       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNDRFSSSDYLEKAELEQKDC
EFP1_RHILO      -INGNEIRPGYVIEHDGGLWVAVRTNTVKPGKGGAYNQVELKNLINGTKLNERFRSAETVEQIRLDLKDF
EFP_TREDE       MIRGGDIAKGTVLLNKGTPYLVVEREFVNPGKGAAFARVKMKNLRDGSVLMQTIKTADTVEDAVVDTHKC
EFP_RICTY       -ISANSIRTGNILVYNNDLWVVSKTEHTQPGKGGAYVQVEMKNLKTGTKRNGRFSSSDYLEKAELEQKDC
EFP_XANAC       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_XANOM       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_XANC5       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_ACICJ       ----NLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLKTGNKTNERWRTADTVERLMTDNRDY
EFP_ROSDO       -INGNEIRPGNVLEHNDGLWAAVKVDHVKPGKGGAFAQVEMRNLRNGSKLNERFRSADKVERVRLEQKDQ
EFP_GEMAT       --SATQIRRGMVLVFEGDPCRVIEFRHHTPGNLRAMVQAKLKNLRTGSNFEHRFRAADTIVKADMETHEL
EFP_FUSNN       -----ELRAGSTIKIGNDPFVVLKAEYNKSGRNAAVVKFKMKNLISGNISDAVYKADDKMDDIKLDKVKA
EFP_BARQU       -INGNEIRPGNVIEHQGSLWVAIKCNAVKPGKGGAFNQVEMKNLIDGTKFNERFRAAETVERVRLEQKDF
EFP_XANCP       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_XANCB       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_XANC8       -VGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKXXXXXXXXXXXXXXM
EFP_TREPS       MIRGGDIAKGTVLLHKGAPYLVVEREFVNPGKGAAFARVKMKHLRDGSVLTQTVKTSDTVEDAVVDSHRA
EFP_TREPA       MIRGGDIAKGTVLLHKGAPYLVVEREFVNPGKGAAFARVKMKHLRDGSVLTQTVKTSDTVEDAVVDSHRA
EFP_MANSM       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_BARHE       -INGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVEMKNLIDGTKLNERFRAAETVERVRLEQKDF
EFP_BARBK       -INGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVELKNVIDGTKLNERFRAAETVEKVRLEQKDF
EFP_BART1       -INGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVELKNLLDGTKLNERFRAAETVERVRLEQKDF
EFP_ELUMP       MISTTDFKEGLIFENEGEIVEIVDYQHHRKSQARAVVRVKLRKLGSGSYVETSYRPEDKFKEVSVEKRPF
EFP_CHLP8       MVSISNVSKGAIIRWKGEPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQVDVIVTERKKY
EFP_MARMM       -INGNEIRPGNVLMHQDTLWVAVKTDHVKPGKGGAFAQVELKNLLDGRKLNERFRAADKVEKVRLEQKDY
EFP_CHLTE       MVSISNVSRGAIIRWNGAPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQVDVIVTERKKY
EFP_BRAHW       MLPVNDLRKGDAIILDGETYLVVDAHFHRAQQRKANVKTKLKNMLKGNMIEKTFSSTESVEEADLSYKKA
EFP_ANAPZ       ----NDIRPGQVLDHNGALYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRADGYVNRAIIEEVSF
EFP1_GEOSL      MLTTSDFKRGLVIKLDNSPCLIVHFQSPSARGASTMVKTRYRNLLTGQVLDKTFRSGDKVEEADFERHKG
EFP_METI4       -VNASDVGKGQAIRHNGAICLVLETMHRTPGNLRAFVQMVLRNLKTGKSFVERFGSQDKVELLSLVRKRC
EFP_HYPNA       -----DIRRGNIIETDGQLYVVLKAESFRPGKGTPTTTIEMRRISDGIKVVNTFKTSEKLEKAFVEEVEH
EFP_STRM5       ---MNDVKNGMKILVNNEPAVISETEFIKPGKGQAFTRVRYRFIKSGRTVEMTMKXXXXXXXXXXXXXNM
EFP_ACTSZ       --TTTDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_PELPB       MISISNVSKGAIIRFKGEPHSIESLMHRTPGNLRAFYQANMRNLKSGRNVEYRFSATESVDVIITERKQY
EFP_PASMU       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_GRABC       ----NLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLKTGNKTNERWRTADTVERLMTEEKDY
EFP_GLUOX       ----NLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLKTGNKTNERWRTADSVERLVTEDKDY
EFP_SPHAL       -----EIRPGNIIEFEGGIWKVTKIQHTQPGKGGAYMQVEAKNLIDGRKLNNRFRSADTVEKVRLDTKDF
EFP_HAES2       --TTSDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_HAES1       --TTSDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_SPHWW       -ISGVDIRPGNIIEYEGGIWRAVKIQHTQPGKGGAYMQVEMKNLIDGRKNNVRFRSAETVERVRLDTKDF
EFP_HAEIN       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_HAEIG       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_HAEIE       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_HAEI8       --TTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNL
EFP_GLUDA       ----NLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLKTGNKTNERWRTADTVERLLTEEKEY
EFP_CHLCH       MPSISTVSKGSIIRFKGEPHSIESLIHRTPGNLRAFYQANMKNLKTGRNVEYRFSSSETVDVIVTERKQY
EFP_CHLL2       MTSISNVSKGSIIRFKGEPHIIESLVHRTPGNLRAFYQANMKNLKTGRNVEYRFSASESVDLIVTERKQY
EFPL_VIBVY      MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGGSKIYKMRCTDLATGARVEERYKSDDVVETVEMNKKAV
EFPL_VIBVU      MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGGSKIYKMRCTDLATGARVEERYKSDDVVETVEMNKKAV
EFP_MYCGA       IIHAKDLRSGHTFTLDGKIYLVIENSFNKTAMREGIVKCKVKNLRTGSITTEVL-TGMKLEQANIEKVKM
EFP_BAUCH       ----NEFRVGLKIMLNGEPYAIIENEFVKPGKGQPFNRVRLRQLLSGKIIEKIFKSGDAVEAADIIDRHL
EFP_WOLPP       ----NDIRPGQVLEHNGGLFSVISIMHTQPGKGGAYIQAEMKNIQTGAKYYERFRSDATIRRAILDEEEY
EFP_NOVAD       -ISGVDIRPGNILEYEKGIWKVAKTQHTQPGKGGAFMQVEMKNLIDGRKTNVRFRSADTVERVRLDTKDF
EFP_MYCPN       MIEAKSLRSGQTIGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRTGAIVWIEF-TGDKLEQVIIDKKKM
EFP_ANAMM       ----SDIRPGQILDHNGSLYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRSDGYVKRAIVEEVEY
EFP_MYCGE       MIEAKNLRNGQTIGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRTGAIVWLEF-TGDKLEQVIIDKKKM
EFPL_ERWT9      MPRANEIKKGMAVNLNGKLLLVKDIDVQSPSARGASTLYKMRDIRSGMKVEERFKGDEIIDTISLSRRQV
EFP_ANAMF       ----SDIRPGQILDHNGSLYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRSDGYVKRAIVEEVEY
EFP_UREPA       IIQAKDLRAGHTFLYKGNIYQVIENSFNKTAMREGIVKCKVKNLRTGAITIEVL-TGEKLEQAVIEKSKM
EFP_UREP2       IIQAKDLRAGHTFLYKGNIYQVIENSFNKTAMREGIVKCKVKNLRTGAITIEVL-TGEKLEQAVIEKSKM
EFP_EHRCR       ----SDIRPGHVLEHNNALYLVVKVMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAIVDESDY
EFP_BURCM       MKTAQELRVGNVVQIGSDAWVIAKTEYNKSGRNAAVVKMKMKNLLTNAGQESVYKADDKFDVVMLDRKEV
EFP_BURA4       MKTAQELRVGNVVQIGSDAWVIAKTEYNKSGRNAAVVKMKMKNLLTNAGQESVYKADDKFDVVMLDRKEV
EFP_MAGSA       -INANLIRPGNILEHNGRQYAVLKTQIVQPGKGGAFITVEMRDIRTGNKTNERWRTADTIEKCNVEAKEC
EFP_JANSC       -INGNEIRPGNVLEHNGGLWAAVKVDHVKPGKGGAFAQVELRNLRNGSKLNERFRSADKVERVRLEQKDQ
EFP_BURS3       MKTAQELRVGNVVQIGSDAWVIAKAEYNKSGRNSAVVKMKMKNLLTNAGQEAVYKADDKFDVVVLDRKEV
EFPL_VIBHB      MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGGAKIYKMRCTDLNTGARVDERYKSDDVVETVEMNKRAV
EFP_PROVI       MTSISNVSKGAIIRFKGEPHIVESLVHRTPGNLRAFYQANMRNLKSGRNVEYRFSATESVDVIITERKEY
EFP_BURCH       MKTAQELRVGNVVQIGSEAWVIAKAEYNKSGRNSAVVKMKMKNLLSNAGQESVYKADDKFEVVVLDRKEV
EFP_BURCC       MKTAQELRVGNVVQIGSEAWVIAKAEYNKSGRNSAVVKMKMKNLLSNAGQESVYKADDKFEVVVLDRKEV
EFP_BURCA       MKTAQELRVGNVVQIGSEAWVIAKAEYNKSGRNSAVVKMKMKNLLSNAGQESVYKADDKFEVVVLDRKEV
EFP_AZOSB       MKTAQELRSGNVIMVGSDPLVVQKAEYNKSGRNAAVVKMKLKNLLTGAPSESVYKADDKFEVVQLDRKEV
EFP_WOLWR       ----NDIRPGQVLEHNGGLFLVVGIMHTQPGKGGAYIQAEMKNIKTGAKHYERFRSDATIRRAILDEEEY
EFP_CAUCR       -VAASSLRKGSVVDMDGKLYVVLSAENIHPGKGTPVTQLNMRRISDGVKVSERYRTTEQVERAFVDDRNH
EFP_CAUCN       -VAASSLRKGSVVDMDGKLYVVLSAENIHPGKGTPVTQLNMRRISDGVKVSERYRTTEQVERAFVDDRNH
EFP_DECAR       MKTAMELRSGNVIMVGADPLVVQKSEYNKSGRNAAVVKMKLKNLLTGAASEAVYKADDKFEVVVLDKKEV
EFP_WOLTR       ----NDIRPGQVLEHNGGLFLVVSIMHTQPGKGGAYIQAEMKNIKTGAKLYERFRSDATIRRAILDEEEY
EFP_UREU1       IIQAKDLRAGHTFLYKGSIYQVIENSFNKTAMREGIVKCKVKNLRTGAITVEVL-TGEKVEQAIIEKSKM
EFP_EHRRW       ----SDIRPGYVLEHNNALYLVVKIMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAILDEADY
EFP_EHRRG       ----SDIRPGYVLEHNNALYLVVKIMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAILDEADY
EFP_BURVG       MKTAQELRVGNVVQIGSDAWVIAKTEYNKSGRNAAVVKMKMKNLLTNAGQEAVYKADDKFDVVVLDRKEV
EFPL_VIBPA      MPKASEIKKGFAIESNGKTLLVKDIEVTTPGGGAKIYKMRCTDLTTGARVDERYKSDDVVETVEMNKRAV
EFPL_SERP5      MAKANEIKRGMAISYNGKLLLVIDVQSPSARGASTLYKMRFSDVRTGLKVEERFKGDDILDTISLSRRKV
EFP_AZOSE       MKTAQELRSGNVIMVGADALVVQKAEYNKSGRNSAVVKMKLKNLLTGAPSESVYKADDKFEVVQLDKKEV
EFPL_SHISS      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_SHIDS      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_SHIB3      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_SALTY      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALTI      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALSV      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALPK      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALPC      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALPB      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALPA      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALNS      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALHS      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALG2      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALEP      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALDC      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SALAR      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_ESCF3      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOUT      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOSM      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOSE      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOLU      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOLI      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOLC      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOL6      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOL5      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOK1      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECOHS      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECODH      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO8A      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO81      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO7I      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO5E      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO57      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO55      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO45      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO27      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_ECO24      MPRANEIKKGMVLNYNGKLLLVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFP_EHRCJ       ----SDIRPGHILEHNNALYLVVKVMHTQPGKGGAYIQAEMKNLKTGAKQYERFRTDGDIKRAIVDESDY
EFP_BURTA       MKTAQELRVGNVVMVGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLTNAGQESVYKADDKFDVVVLDRKEV
EFPL_PROMH      MAKANEIKRGMAISYNNKLLLVIDIQAPSARGASTLYKMRFTDIRTGQKVEERFKGDDILDTINLTRRAV
EFP_WOLPM       ----NDIRPGQVLEHNGGLFLVVGIMHTQPGKGGAYIQAEMKNIKTGAKHYERFRSDATIRRAILDEEEY
EFP_BURM1       MKTAQELRVGNVVQIGSDAWVISKTEYNKSGRNAAVVKLKMKNLLTNAGQESVYKADDKFDVVMLDRKEV
EFPL_SALCH      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFPL_SHIFL      MPRANEIKKGMVLNYNGKLLLAKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_SHIF8      MPRANEIKKGMVLNYNGKLLLAKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFPL_SHIBS      MPRANEIKKGMVLNYNGKLLLAKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYV
EFP_METRJ       -VIASTLRKGNVVEKDGKLYVILFAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREH
EFPL_CITK8      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPARGAATLKMRFSDVRTGLKVEERFKGDDIVDTVTLSRRGV
EFP_ZYMMO       -ISGVDIRPGNILEYEGGLWRAAKIQHTQPGKGGAYMQVEMKNLIDGRKTNVRFRSAETVERVRLDTKDF
EFPL_PSEA6      MPKASEVKKNAAIEHNDKVYVVKDINKLTPSAGASLYRMRLYEVTTGAKADESFKADEMIKTADFVRQPV
EFPL_KLEP3      MPRANEIKKGMVLNYNGKLLIVIDIQSPSARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRFV
EFPL_ENTS8      MPRANEIKKGMVLNYNGKLLIVKDIDIQSPSARGAATLYKMRDVRTGQKVEERFKGDDILDTITLTRRFV
EFPL_ALISL      MPKASDIKKGSAIEHNGKVYFVKEITKLTPSAGATLFRMRMYDVATGSKADESFKTDEIITLADFSRRSA
EFP_PROA2       MTSISNISKGSIIRFRNEPHIIESLVHRTPGNLRAFYQAGMKNLKTGRNVEYRFSANESVDLIVTERKQY
EFP_ERYLH       -ISGVDIRPGNIIEYEGGIWKVAKIQHTQPGKGGAYMQVEMKNLQDGRKTNVRFRSADTVEKVRLDTQDY
EFP_BURPS       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURP6       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURP1       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURP0       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURMS       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURMA       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURM9       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BURM7       MKTAQELRVGNVVMIGNDAWVVSKTEYNKSGRNAAVVKMKLKNLLNGGGQESVYKADDKFEVVVLDRKEV
EFP_BLOPB       LYNINEFRTGLKIIQNREPCVIISHESIKPGKGQAFSRVRFRQIISGKILEKTFKSGDFLESANIMEIRL
EFPL_MARAV      MPKASEIKKNQAVEYEGRVYFVKDIERSVPQAGGSLYRMRMYDVVTNQKLDETFKDSDMLNLADLVRREA
EFP_METPB       -VIASTLRKGNVVDKDGKLYVILTAENIHPGKGTPVTQLDMRRITDGVKISERYRTTEQVERAFVEDRDH
EFP_CAUSK       -VAASSLRKGFVVDMDGKLYVVLNVENIHPGKGTPVTQLNMRRISDGVKVSERYRTTETVERAFVDQRDH
EFP_BURPP       MKTAQELRTGNVVMIGADAMVVQKAEYNKSGRNSAVVKMKFKNLLTGAGMESVYKADDKFDVVVLERKEV
EFPL_VIBCM      MPKASELKKGFAIISNGKTLLIKDIEVTTPGGGSKIYKLRCTDLNTGARVDERYKSDDVLDTVEMNKRPI
EFPL_VIBCH      MPKASELKKGFAIISNGKTLLIKDIEVTTPGGGSKIYKLRCTDLNTGARVDERYKSDDVLDTVEMNKRPI
EFPL_VIBC3      MPKASELKKGFAIISNGKTLLIKDIEVTTPGGGSKIYKLRCTDLNTGARVDERYKSDDVLDTVEMNKRPI
EFPL_KLEP7      MPRANEIKKGMVLNYNGKLLIVIDIQSPSARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRFV
EFP_METS4       -VIASSLRKGNVVEKDGRLYVILSAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREH
EFPL_YERPY      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPS      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPP      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPN      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPE      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPB      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERPA      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_YERP3      MAKANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDENLDTITLTRRAV
EFPL_ENT38      MPRANEIKKGMVLNYNGKLLIVKDIDVQSPSARGAATLYKMRDVRTGLKVEERFKGDDIVDTVTLTRRFV
EFPL_HAHCH      MPRASEIKKGEVVDLNGQLLIVKDIEHSPSARGAATLKMRFSNVRTGLKYEESFKGDDMLSTTQLERRQV
EFPL_YERE8      MARANEIKRGMAVNLNGKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDEILDTITLTRRSV
EFP_MYCPE       IIHAKDLRPGNTFIYKNNLYLVIENSFNKTAMREGIVKCKVKNLRTSSITVEVL-TGEKLERAIIDKVKA
EFPL_EDWI9      MARANEIKRGMAVNYNGKLLLVRDIDIQSPSARGAATLYKMRDVRTGLKVEERFKGDDLLETITLSRRPV
EFP_RHORT       -MQANQIRPGQVLEHQGKRWTVLKIQLIQPGKGGAFIAVEMRDVDSGNKTNERWRTADTVERLEVREIDC
EFP_RALSO       -----ELRAGNVFMIGNDPMVVLKTEYSRSGRNAAVVKMKYKNLLTGAPSESVFKADDKMDQIILDKKEC
EFP_BURXL       MKTAQELRTGNVVMIGADAMVVQKAEYNKSGRNSAVVKMKFKNLLTGAGMESVYKADDKFDVVVLERKEV
EFP_BURP8       -----ELRTGNVVMIGNDAMVVQKAEYNKSGRNAAVVKMKFKNLLTGAGMETVYKADDKFDVVVLDRKEV
EFPL_VIBSL      MPRASEIKKGFAINVDGKTVLVKDIEVTTPGGGQKIYRFRGHDVATGVKTEVRHKADEIVETIDVTKRAV
EFP_VARPS       ---------------------VLKTEYSRGGRNSATVRMKLKSLIANFNTEVVFKADDKIDQIVLDKKEC
EFP_RHIME       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREH
EFP_POLSQ       MKTAQELRVGNVVMIGTDAMVVLKAEYSRSGRNSSVVKMKFKNLLTGAPNEGVFKADDKFDVVILDKKEC
EFP_BRASB       -VIASSIRKGNVIEQDGKLYVVVTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKVTIEERNY
EFP_RHOPS       -VIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKVSERYKTTDQVEKATIEERNY
EFP_RHOPA       -VIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKVTIEERNY
EFPL_PHOLL      MAKANEIKRGSAVSYNGKLLLVIDIQAPSARGASTLYKMRFTDIRTGQKVEERFKGDDILDTISLTRRSV
EFP_ORITB       -ILANAIREGNILEYQNNLWIVSKKDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYLEKATLEQRNY
EFPL_PECCP      MARANEIKRGMVVNYNDKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGDDILDTITLTRRTV
EFP_SINMW       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREH
EFP_RHOPT       -VIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDHVEKVTIEERNY
EFP_ORITI       -ILANAIREGNILEYQNNLWIVSKKDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYLEKATLEQRNY
EFP1_LACJO      -----ELKKGMIFNQDGKLIEVLKSNHHKPGKGNTVMQMDLRDVMSGAVVHKTMRPSEKVDLVNVSLKKA
EFP_RHOP2       -VIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEERNY
EFP_PSEU2       -----ELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEA
EFPL_PHOPR      MPKASEIKKFAAIEHNGKVFLVKDIKKLTPSAGASLYRMRLYDVATGSKTDESFKADEMITLADFRRHPV
EFPL_ERWCT      MARANEIKRGMVVNYNDKLLLVKDIDVQSPSAASTLYKMRFSDVRTGLKVEERFKGXXXXXXXXXXRRTV
EFP1_PARUW      MATSNQLTPGMTLSINNKLYRVESSVKVTVPKGTPFIKAKLKDLSNNEMVEKSFKLNQPIKDVSLIERRL
EFP_RHOP5       -VIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEDSNF
EFP_DIAST       ---------------------VLKTEYARGGRGAATVRMKLKALLSNMGTEVVFKADDKIDNVILDKKEC
EFP_BORA1       MKTAQELRVGNVVMVGKDPLVVQKTEYNKSGRNAAVVKLKFKNLLTGSASESVYKADEKFDIVMLERKEC
EFP_ACISJ       ---------------------VLKTEYARGGRGAATVRMKLKALLSNMGTEVVFKADDKIDNVILDKKEC
EFP_RALPJ       -----ELRAGNVFMIGNDAMVVLKTEYSRSGRSGAVVKMKYKNLLTGAGGESVFNADDKMDQVILEKKEA
EFP_RALME       -----ELRVGNVFMIGSDPMVVQKAEYNKSGRNAAVVKMKYKNLLTEAPGESVFKADDKFEVVVLERREC
EFP_POLNA       ---------------------VLKTEYSRGGRNSATVRMKLKSLIANFNTEVVFKADDKIDQVILDKKEC
EFP_PHEZH       -VSASSLRKGNVVDLDGKLYVVLSAQNIHPGKGTPVTQLDMRRISDGVKVSERYRTTETVERATVDDRDY
EFP_ACIAC       ---------------------VLKTEYARGGRGAATVRMKLKALLNNMGTEVVFKADDKIDNVILDKKEC
EFPL_PSEHT      MPKASEVKKGTAIDFNGRVLVVKDIRSVPQGRGGSLYRMRLYDVVTGSKVDETFKDSDMLTLADLTRREA
EFP2_RHILO      -VIASSLRKGNVVDKDGKLYVILFAENIHPGKGTPVTQLDMRRIGDGVKVSERYRTTEQVERAYVEEREH
EFP_RHISN       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREH
EFP_RHIEC       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNF
EFP_RALEH       -----ELRVGNVFMIGGDPMVVQKAEYNKSGRNAAVVKMKYKNLLTDAPGESVFKADDKFEVVVLERREC
EFP_POLNS       MKTAQELRVGNVVMIGTDAQVVLKAEYSRSGRNSSVVKMKFKNLLTGAPNEGVYKADDKFDVVILDKKEC
EFP_OLICO       -VIASSIRKGNIIDQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERAHVEDHDY
EFP_CUPTR       -----ELRVGNVFMIGGDPMVVQKAEYNKSGRNAAVVKMKYKNLLTDAPGESVFKADDKFEVVVLERREC
EFP_AGRVS       -VIASSVRKGNVLEVDGKLYVVLTAQNFHPGKGTPVTQIDMRRIVDGVKVSERWRTTEQVERAFVEDVNH
EFP_RALEJ       -----ELRVGNVFMMNGAPMVVQKAEYNKSGRNAAVVKMKYKNLLTEAPGESVFKADDKFEVVVLERREC
EFPL_ALTMD      MPKASEIKKNNTVVFDGKTCIVRDIERSVPQAGGSIYRMRMYDVVTGAKYDETFKDSDTLDMADLIRRPA
EFP_BORPD       MKTAQELRVGNVVMVGKDPLVVQKAEYNKSGRNAAVVKLKFKNLLTGSGSESVYKADEKFDVVVLDRKEC
EFP_LARHH       -----ELRSGNVFMLDGQPMVVQKTEYNKSGRNAAVVKMKMKNLLTGSASEAVYKADEKFDIVVLDKKEC
EFPL_VIBF1      MPKASDIKKGSAIEHNGKVFFVKEISKLTPSAGATLFRMRMYDVATGAKSDESFKADDMINLADFSRRSA
EFPL_SACD2      MPKASDIKKNQAIEHNGKVYLIKDYKSTSQGRGGSIYRVRMYEVATGLKVDESFKADEMITLADFSRHQA
EFP_VEREI       ---------------------VLKTEYARGGRGAATVRMKLKSLIANFGTEIVLRADDKIDNVILDKKEC
EFP_THIDA       -----ELRAGNVVMIGKDPMVVQKAEFSKSGRNASVVKMKLKNLLTGAGMESVYRADDKFDTVTLDRKEC
EFP_PSEAE       MKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEV
EFP_PSEAB       MKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEV
EFP_PSEA8       MKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEV
EFP_PSEA7       MKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEV
EFP_POLSJ       ---------------------VLKTEYSRGGRNSATVRMKLKSLIANFNTEVVFKADDKMDQVILDKKEC
EFP_METC4       -VIASTLRKGNVVDKDGKLYVILTAENIHPGKGTPVTQLDMRRITDGVKISERYRTTEQVERAFVEDRDH
EFP_LEPCP       ---------------------VLKTEYSRGGRNSATVRMKLKSLLSNSGTEVVFKADDKMDQIILDKKEC
EFP_DELAS       ---------------------VLKTEYARGGRGAATVRMKLKSLLGNMGTEVVFKADDKIDNVILDKKEC
EFP_BORPE       MKTAQELRVGNVIMVGKDPLVVQKTEYNKSGRNAAVVKLKFKNLLTGSGSESVYKADEKFDVVVLERKEC
EFP_BORPA       MKTAQELRVGNVIMVGKDPLVVQKTEYNKSGRNAAVVKLKFKNLLTGSGSESVYKADEKFDVVVLERKEC
EFP_BORBR       MKTAQELRVGNVIMVGKDPLVVQKTEYNKSGRNAAVVKLKFKNLLTGSGSESVYKADEKFDVVVLERKEC
EFPL_SHESH      MPKASEVKKNTAIEFNNNVYLIRDIERSVPQSGGSLYRMRMYDVATGSKLDHTFKADEMINLADLSRHEV
EFPL_ALCBS      MTRASELKKSDVIEVNGTLYRQIEVQSPSARGAATLYRVKASAVGGGPKFEERFKGDDDVATVALQRRAV
EFP_BUCMP       ----NNFRSGCKIIFENEPYLIESSEFVKPGKGQAFVRVKLRKLLTRQLIEKTFKSTDYLEIADVIEHTL
EFP_BUCAI       ----NNFRSGRKIIFENEPCLIESSEFVKPGKGQSFVRVKLRKLLTKQLIEKTFKSTDSLEIADIIEYTL
EFPL_COLP3      MPKASDIKKNAAIEHNGKVLIVRDITRSVPQAGGSLYRMRLYDVVTGGKVDETFKAEDMLNFADLSRRPS
EFP_RHIRD       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGTKVSERWRTTEQVERAFVEDLNF
EFP_AGRT5       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGTKVSERWRTTEQVERAFVEDLNF
EFPL_VIBFM      MPKASDIKKGSAIEHNGKVFFVKEISKLTPSAGATLFRMRMYDVATGSKADESFKADDMINLADFSRRSA
EFP_RHILW       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVSF
EFP_RHIL3       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVSF
EFP_RHIE6       -VIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNF
EFP_PSEU5       MKTAQEFRAGQVAIINGAPWVIQKAEFNKSGRNSAVVKMKLKNLLNGSATETVYKADDKLEPVILERKEV
EFP_METNO       -VIASSLRKGNVVEKDGRLYVILSAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREH
EFP_BORDL       ---------------------VLEREFSKMGRGGSIVRLKLKNLKNKSVIKETLKGSDTVEEIEVLEVNS
EFP_PSEMY       MKTAQEMRVNSVALIDGQPWLIQKAEFTKSGRNSAIVKMKLKNLLNGSKTETVYKADDKMEPVILERKEV
EFP_BLOFL       LYNINELKVGLKVIQNKEPYVIIKNECIKPGKGQSFNRVRFKQIKSGKILEKTLKPGDLVESANIVETEL
EFP1_CHLCV      MVLSSQLSVGMFISTKDGLYKVVAVSKVTGNKGESFIKASLKAADSDVIVERNFKIGQEIKEAQFESRNL
EFP_RHOFD       MKTAQEIRVGNVIMYGKDPMVVLRTEYSRGGRNSSTVRMKLKSLIANFNTEVVYKADDKLEQVILDKKEC
EFP_BORRA       ---------------------VLEREFSKMGRGGSIVRLKLKNLKNKSVIKETLKGSDTVEEIEVLEVNS
EFP_BRASO       -VIASSIRKGNVIEQDGKLYVVVSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEERNY
EFP_WIGBR       --SANQSKSGLKILLKNEPCLILENQFVKPGKGQPFNRIKIKKLISGKIFTKIFKSNEKLIYADVLDVKV
EFP_METFK       MKTAQELRVGNVVMIGNDPLVVQKTEYNKSGRNAAVVKMKFKNLLTEAASEAVYKADDKFDVVILEKKEV
EFP_XANP2       -VIASSLRKGNVVDIDDKLYVVLTAENIHPGKGTPVTQLDMRRISDGVKISERYRTTEQVERAFVEDRPH
EFP_AGRRK       -VIASSVRKGNVLDVDGKLYVVLTAANFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNF
EFP_NITEU       MKTAQELRVGNVFMLGKDPMVVLKTEFTKSGRNSSVVKMKYKNLLTESPGEAVYKADDKFDIVVLDKKEV
EFPL_PSYIN      MPKASDIKKNTAIEYNNNVYIIRDIERSVPQAGGSLYRMRMYDVVSGSKIDQTFKDNEMLPLADLVRRNV
EFP_NITWN       -VIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERATIEDHNF
EFP_BUCAP       ----NNFRSGRKIIFEKEPCLIESSEFVKPGKGQSFVRVKLRKLLTKQLIEKTFKSTDSLEIADVSEYTL
EFP_AZOVD       MKTAQEFRAGQVAMINGEPWVIQKAEFNKSGRNAAVVKMKLKNLLNGQATETVYKADDKFEPVILERKEV
EFP_CHRVO       MKTAQELRAGNVFMVGSDPMVVQKAEFSKSGRNASVVKMKMKNLLTGAGSEAVYRADDKFDVVVLDRKDC
EFP_BORAP       VVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEASV
EFP_SHEWM       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKMKLKNVLLDSSTETTFKGEDKMDDIILERLDC
EFPL_MARMS      MPKASEIKKNIAISYDNKTYIVKDIERSVPQAGGSLYRMRMYDVVTGRKLDETFKDSDMIDLADLVRRQV
EFP_CHLPD       MTSISNVSKGSIIRFKGEPHIIESLIHRTPGNLRAFYQANMKNLKTGRNVEFRFSASESVDVIVTERKPY
EFP_AERHH       MKTAQEIRAGNVVMIGTEPMVVQKAEFNKSGRNSAVVKMKLKGLLNGSATETVFKADDKLEVVQLERKEC
EFP_PSEPF       -----ELKPGTVIRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_CELJU       -----ECRAGNVVMIDGSPWVVQKAEYNKSGRNAAVVKMKLKNLLSGINTETVYKADDKFEDILLDRKEV
EFP_TOLAT       -----EIRVGNVIMIGKDPMVVLKTEFNKSGRNSAVVKMKMKNLLSGAGAETVFKADDKLDTVQLERKEC
EFP_BORBZ       VVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSA
EFP_BORBU       VVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSA
EFP_SHELP       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKMKLKNLLQESSTETTFKGEDKMEDIILDRLDC
EFP_NITHX       -VIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERATIEDHNF
EFP_BRAJA       -VIASSIRKGNVIEQDGKLYVVVSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEERNF
EFP_BORT9       -IKSGDIEKGTFLLFKGMPHIVLEREFSKMGRGGSIVRXXXXXXXXXSVVKETLKGADTVEEIEVLEVAS
EFP_BORGA       VVKSSEIEKGSFLLIKGTPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSA
EFP_NEIMF       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFP_NEIMA       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFP_AERS4       MKTAQEIRAGNVVMIGTEPMVVQKAEFNKSGRNSAVVKMKLKGLLNGSATETVFKADDKLDVVQLERKEC
EFP_PSEE4       -----ELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_NEIMB       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFP_NEIM0       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFP_NEIG1       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFP_PSEPW       -----ELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_PSEPG       -----ELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_NITEC       MKTAQELRVGNVFMLGRDPMVVLKTEFTKSGRNSSVVKMKYKNLLTESPGEAVYKADDKFDIVVLEKKEV
EFP_NEIG2       MKTAQELRAGNVFMVGNDPMVVQKTEYIKGGRSSAKVSMKLKNLLTGAASETIYKADDKFDVVILSRKNC
EFPL_XANCP      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGAKLDASFDADDNLPEVELLRRQS
EFPL_XANCB      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGAKLDASFDADDNLPEVELLRRQS
EFPL_XANC8      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGAKLDASFDADDNLPEVELLRRQS
EFP_SHESH       MKTAHEIRPGNVIMLNGSPWVVQKTETTRSGRNAAIVKMKLKNVLLDSTTETTFKGEDKMEDIILERLDC
EFP_PSEF5       -----ELKPGTVIRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_RHOSK       -VIASSLRKGNVVDIDGRLYVVLTAQNFHPGKGTPVTQVDMRRISDGTKVSERWKTTEQVERATVDEREY
EFP_PSESM       -----ELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEA
EFP_PSE14       -----ELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEA
EFPL_XANC5      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGVKTDASFDADDNLPEVELLRRQS
EFPL_XANAC      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGVKTDASFDADDNLPEVELLRRQS
EFP_SHEPA       MKTAHELRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKLKLKHVLQDSSTESTFKGEDKMEDIILERLDC
EFP_SHEHH       MKTAHELRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKLKLKHVLQDSSTESTFKGEDKMEDIILERLDC
EFP_PSEPK       -----ELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_PSEP1       -----ELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEA
EFP_BORHD       -IKSGEIEKGSFLLFKGMPHIVLEREFSKMGRGGAIVRXXXXXXXXXSVVKETLKGADTVEEIEVLEVSS
EFP_SHEAM       MKTAHEIRPGNVIMFNDSPWVVQKTETTRSGRNAAIVKMKLKNLLIDSSTETTFKGEDKMDVIVLERLDC
EFP_SHEFN       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKLKLKNVLLDSGTEQTFKGEDKLDDIILERLDC
EFPL_XANOR      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGVKTDASLDADDNLPDVELLRRLS
EFPL_XANOP      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGVKTDASLDADDNLPDVELLRRLS
EFPL_XANOM      -MKANDIKKGNVVEYNGGIYQIRDIERSSPQGRGGNVRFRMYSVPGGVKTDASLDADDNLPDVELLRRLS
EFP_SHEDO       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKLKLKHVLLDSGTEQTFKGEDKMDVIVLERLDC
EFPL_STRMK      -MKANDIKKGNVVEYNNGVYQIRDIERSSPQGRGGNVRFRMYSVPGGNKLDASFDADDNLVEVELLRRQS
EFPL_STRM5      -MKANDIKKGNVVEFNNGVYQIRDIERSSPQGRGGNVRFRMYSVPGGNKLDASFDADDNLVEVELLRRQS
EFP_SHESW       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEDKLEDIVLDRLDC
EFP_SHEPC       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEDKLEDIVLDRLDC
EFPL_XYLFM      -MKASEMKKGSIVEYNNGTYQIRDIQRSSPGRGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREA
EFPL_XYLFA      -MKASEMKKGSIVEYNNGTYQIRDIQRSSPGRGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREA
EFPL_XYLFT      -MKASEMKKGSIVEYSNGTYQIRDIQRSSPGRGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREA
EFPL_XYLF2      -MKASEMKKGSIVEYSNGTYQIRDIQRSSPGRGNVRFRFVMYSVPGGSKLEASFDADEMLTAVELLRREA
EFP1_CHLPN      MVLSSQLSVGMFISTKDGLYKVTSVSKVAGPKGESFIKVALQAADSDVVIERNFKATQEVKEAQFETRTX
EFP_PSEFS       -----ELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEA
EFP_SHEB9       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEDKLEDIILDRLDC
EFP_SHEB8       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEDKLEDIILDRLDC
EFP_SHEB2       MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEDKLEDIILDRLDC
EFP_SHEPW       MKTAHEVRPGNVIMLDGNPWVVLKTETSRSGRXXXXXXXXXXXXXXDSTTETSFKGEDKLDVIVLDRLDC
EFP_BUCBP       ----NQLKIGLKIIYNNEPCIVVSNEFIKPGKGQAFFRVRXXXXXXXXXIDKTCKYSDCFKIANVIEITA
EFP_SHEON       MKTAHEVRPGNVIMFEGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEXXXXXXXXXXXXC
EFP_SHESR       MKTAHEVRPGNVIMFEGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEXXXXXXXXXXXXC
EFP_SHESM       MKTAHEVRPGNVIMFEGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEXXXXXXXXXXXXC
EFP_SHESA       MKTAHEVRPGNVIMFEGSPWVVQKTETTRSGRNAAIVXXXXXXXXXXSGTETTFKGEXXXXXXXXXXXXC
EFP1_CHLTR      MVLSSQLSVGMFISTKDGLYXXXXXXXXXGNKGDTFIKVSLQAAGSDVTVERNFKAGQEVKEAQFEPRNX
EFP1_CHLMU      MVLSSQLSVGMFISTKDGLYXXXXXXXXXXXXXDTFIKVALQAAGSDVVVERNFKAGQEVKEAQFEPRXX
EFP_JANMA       MKPAKEIRVGNIIMVDSKPMIVLRSDVNGSSRTGFTYKWKMKNLLTNTPMENVFRGXXXXXXXXXXXXXX
IF5A_METM5      ---LGSLKVGQYVVIDGVACRVMDTTHSKPGKGGAKVRLVAMGIFESVKKEHVGPASSRIDVPLIDKRKG
IF5A_PYRCJ      -VEVGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARVVAVGVFDGAKRTLSLPVDAQIEVPIIEKFTA
IF5A_KORCO      --SAGDLRKGSYVILDDEPCEVLEVSKSKPGKGSAKVRVEARGIFDGARRSKIFPADALVEIPIVDKKTA
IF5A_THENV      -VEAGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTA
IF5A_METM6      -------KVGQYIVIDGIACKVMDYAHSKPGKGGAKVRLVAVGIFEPVKKEHVGPASSRIDIPIIDKRKG
IF5A_METMP      -------KVGQYVVIDGIACRVMDTAHSKPGKGGAKVRLTAMGIFEPVKKEHVGPASSRIDVPLIDKRKG
IF5A_PYRAR      -VEVGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARIVAVGMFDGGKRTLSLPVDAQIEVPIIEKFTA
IF5A_PYRAE      -VEAGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTA
IF5A_METVS      ---LGQVKVGQYVVIDGIACRVMDTAHSKPGKGGAKVRMVAVGIFEPVKKEYVGPAGSRIDIPLIDKRKG
IF5A_METM7      -------KVGQYVVIEGVACKVMDTAHSKPGKGGAKVRLVAVGIFEPVKKEHVGPASSRIDIPLIDKRKG
IF5A_METKA      -VEVRQLKKGKYIMIDDEPCKIVEYTTSSPGKGSAKARIVAVGLFDGKKRTLTKPVDAKVDVPVIERKTA
IF5A_PYRIL      -VEVGELKEGSYVVIDGEPCRVVEIEKSKTGKGSAKARIVAIGVFDGGKRTLSLPVDAQIEVPIIEKFTA
IF5A_IGNH4      --TLGELKPGNFIMIDGEPCKIVEMSKAKTGKGSAKAHVVAISLISGA--KKTFVADTRVEVPIIEKRVG
IF5A_THEGJ      -VQVSKLKPGRYIIIDGEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKRVG
IF5A_PYRAB      -VQVSKLKPGRYIIIDDEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTA
IF5A_PYRHO      -VQVSKLKPGRYIIIDDEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTA
IF5A_METS5      --TVGEMKEGSYIVIDGEPCRVVEVTKAKTGKGSAKANIIAVSIFTGAKKTLMAPVDSTVEVPIIEKRMG
IF5A_SULAC      --TVGDLKVGSYVMIDGEPCRVVEITKAKTGKGSAKANVVAIGLFTGQKRSLMAPVDQQVEVPIIEKHVG
IF5A_META3      -VELGSLKVGQYIVIDEVPCRIVDMTKSKPGKGGAKIRLTAMGLFENVKKEHVGPTSSRADVPLIDKRKG
IF5A_CALMQ      --SAGDIKEGSYIMIDNMPCRVVEVEKSKTGKGSAKARIVGIGVIDGVKRTIVVPTDAAVEVPVIEKFTA
IF5A_PYRKO      -VQVSKLKPGRYIIIDGEPCRIVNVTVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKRVG
IF5A_PYRFU      -VQVSKLKPGRYIIIDDEPCRIVNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKRTA
IF5A_THESM      -VQVSKLKPGRYILIDDEPCRIANITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTG
IF5A_THEON      -VQVSKLKPGRYILIDGEPCRIGNITVSSPGKGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKRTA
IF5A_HYPBU      --TLGELKVGSYIVIDGEPCRIVEMSKAKTGKGSAKAHVVAVCLFSGNKKTLTAPVDARVEVPIIDKRIG
IF5A_UNCMA      ---VKSLKEGKFVIIDDEPCQIVSVQHSKPGKGAAKARVDAIGLFDGSKRSIVQPVDAKIYVPIVERKNA
IF5A_DESK1      --TLGNLKVGSFIVIDGEPCRIVEMSRAKTGKGSAKANVVAIGLFSKAKKTLVAPVDTQVEVPVIEKHVG
IF5A_SULIY      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_SULIN      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_SULIM      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_SULIK      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_SULIA      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_STAMF      --TLGELKPGNFIIIDGEPCRIVEMSKAKTGKGSAKAHVVAIGLFTGNKKTLVAPVDQRVEVPVIEKRVG
IF5A_METTH      VVEVKTLKVGKYVIIDGEASKITNISTSSPGKGSAKARVEAVGIFDNQKRSFVKPVDSKVDIPIIDKRTA
IF5A_SULTO      --TVGDLKVGNYVVIDGEPCRVVEISKAKTGKGSAKANIVAIGLFTGQKRTLMAPVDQQVEVPIIEKHIG
IF5A_METJA      -VNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG
IF5A_SULSO      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_METS3      VVEIKTLKVGKYIVLGGEASKITSLTTSSPGKGAAKARLEAVGIFDNQKRSIVKPVDTKVDIPIIDKRVG
IF5A_SULIL      --TVGELKVGSYVVIDGEPCRVVEVTKAKTGKGSAKANVVAIGVFSGAKKTLMAPVDQQVEVPIIEKHIG
IF5A_METMA      -VEVKELKEGKYVIIDDEACVIKSITKSKPGKGAAKARVEAIGLFDGQKRSYIGSVANKVYVPIVERKSA
IF5A_METST      ---IKTLKQGKYLVLGGEASKITSISTSSPGKGAAKARIEAVGIFDNQKRSLVKPVNAKVDIPIIDKRVG
IF5A_HALMA      ---VRELDEGSYVMIEDTPCKINSYSTAKPGKGSAKARIDAKGVFDGKKRSLSQPVDAKVWVPIVNRKQG
IF5A_ARCFU      -VEVRQLREGGYVVIDDEPCEILSISVSKPGKGAAKARIDAIGIFDSQKRSIVQPVTAKIYVPIVERKRA
IF5A_THEPD      -------KVGSFIVIDGEPCKVVEVEKSKTGKGSAKARIVGIGFFDGGKRSIVVPTDARVEVPIIKKFTA
IF5A_THEAC      ---VRELKVGRYILIDDAPCKIVEITMSKPGKGEAKGRIVAIGVFDNQKRSVVYPVKHKVKIPIIEKKNA
IF5A_NATPD      ---VRDLQEGNYVMIEDVPSKITSYSTSKPGKGSAKARVEGTGVFDGQKRNFTQPVDAKVWVPIVNRKQG
IF5A_METHJ      ---VGKLKEGKYLLVDDEPCKILSISVSKPGKGAAKARLDVVGIFDGVKRSIVQPVSAKVYAPIVERRNA
IF5A_HALLT      ---VRELQEGSYVMMDSSPCKINHYSTAKPGKGSAKARVEGKGVFDEKKRSLSQPVDAKVWVPIIQRKQG
IF5A_AERPE      --TLGDLKKGSYIVIDGEPCRIVEMSRAKTGKGSAKAHVVAICVFSGQKKSLVAPVDTRVQIPVIEKRLG
IF5A_METBU      -VEVKELKEGKYVLADDEPCVIKSIQKSKPGKGSAKARIEAIGIFDGQKRSIISSVSAKTYVPIVERKSA
IF5A_METBF      -VEVKELKEGKYVIIDDEACVIKSITKSKPGKGAAKARVEAIGLFDGQKRSYIGSVANKIYVPIVERKTA


                         .         .         *         .         .         .         .:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPNTVDLEVKETEPGI
EFP_ANOFW       QYLYANGDQHVFMDMESYEQIELPAKQIEHELKFLKENMEVFIMMYQGETIGVELPNTVELKVVETEPGI
EFP_GEOKA       QYLYANGDQHVFMDMETYEQIELPAKQIEHELKFLKENMEVFIMMYQGETIGVELPNTVELKVVETEPGI
EFP_GEOSW       QYLYANGDQHVFMDMETYEQIELPAKQIEHELKFLKENMEVYIMMYQGETIGVELPNTVELKVVETEPGI
EFP_GEOTN       QYLYANGDLHVFMDMETYEQIELPAKQIEYELKFLKENMEVFIMMYQGETIGVELPNTVELKVVETEPGI
EFP_BACP2       QYLYANGDQHVFMDTSSYEQLELSETQIKDELKYLLENMSVQIVMYGAETLGVELPNTVELEVVETEPGI
EFP_BACSU       QYLYANGDQHVFMDTSSYEQLELSATQIEEELKYLLENMSVHIMMYQDETLGIELPNTVELKVVETEPGI
EFP2_LACJO      QYLYNDGTSFVFMDTNTYEQLEIPEAQVERESKFLKENMVVNVITHEGETLGVDLPNTVDLEVAETEPNI
EFP_BACLD       QYLYANGDQHVFMDTTSYEQLELNEKQIEHELKFLLENMSVQIMMYQTETIGIELPNTVELKVVETEPGI
EFP_LISW6       AYLYADGSNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP_LISMO       AYLYADGTNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP_LISMH       AYLYADGTNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP_LISMF       AYLYADGTNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP_LISMC       AYLYADGTNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP_LISIN       AYLYADGTNHVFMDNESYEQIELPEDQIAHELKFLKENMEINIIMYQGETIGIDLPNTVELVVTATDPGI
EFP2_LACAC      QYLYNDGSSYVFMDTSTYDQLAIPNEQIGDEANYLLENMVVSVITHEGETLGIQLPNTVDLKVAKTEPNI
EFP_LACPL       QYLYADGDSYVFMNTETYEQIEIPGDHIQDELKFLKENMEVQVTLYKGEVLGIDLPNTVTLEVAETEPGI
EFP_BACHD       QYLYASGDVHTFMDNETFEQLELSTAQIEHELKFLKENMEVHVISYQGETLGVEVPNTVELTVTETEPGI
EFP_LYSSC       QYLYAQGDEHVFMDLESYEQTELASSAIEYELKFLKENMEVHIQSYQGEMLGVELPNTVQLEVTETEPGI
EFP_BACSK       QYLYASGDTHTFMDNETYEQLELQTAQIEYELKFLKENMEVHVISYESETLGVEVPNTVILEVVETEPGI
EFP_MACCJ       QYLYASGDQHVFMDTESYEQIELSEDTIEYELKFLKENMEVHIQMYEGETLGVELPNTVTLQVTETEPGI
EFP_BACCN       QYLYASGEAHVFMDNGTYEQIELSEAQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELKVVETEPGI
EFP_STAEQ       QYLYADGDNHVFMDNETFDQIELPGDYLKDELNYLKANMEVQVQSYESEVIGVELPKTVELEVTETEPGI
EFP_OCEIH       QYLYASGDAHAFMDTNTYDXXXXXXXXXXXXLKFIKENMEVSIVSYENEILGVDLPNNVELTVTETEPGI
EFP_STAHJ       QYLYADGDNHVFMDNETFDQTELSADYLKDELKYLKANMEVQIQSYEGETIGVELPKTVELEVTETEPGI
EFP_STAES       QYLYADGDNHVFMDNETFNQIELPGDYLKDELNYLKANMEVQVQSYESEVIGVELPKTVELEVTETEPGI
EFP_BACCQ       QYLYASGESHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACC7       QYLYASGESHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACC1       QYLYASGESHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACHK       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACCZ       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACC0       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACAN       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACAH       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACAC       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACAA       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACA2       QYLYANGDQHVFMDTSSYXXXXXXXXXXXXXXKYLLENMSVHIMMYQSETLGIELPNTVELKVVETEPGI
EFP_BACCR       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVAIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACC4       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVAIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACC3       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVSIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_BACWK       QYLYASGESHVFMDNETYEQIELGENQIERELKFLKENMGVSIMTYQDEVLGVELPNTVELTVSETEPGI
EFP_BACC2       QYLYASGEAHVFMDNGTYEQIELGEKQIERELKFLKENMEVAIMTYQGEVLGVELPNTVELQVTETEPGI
EFP_STACT       QYLYDDGDMHVFMDNQTFEQTELPGDYLENELKFLKANMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAW       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAT       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAS       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAR       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAN       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAM       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAE       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAC       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAAB       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAA9       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAA8       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAA3       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAA2       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAA1       QYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGI
EFP_STAS1       QYLYADGDTHVFMDNQTFEQTELPADYLEYELNFLKANMEVQIQSYENETLGVELPKTVELTVTETEPGI
EFP_MOOTA       QYLYNDGDNYYFMDTETFEQLSLRKEQLEDAIKYLKDNMNIFVLTYNGETIGIELPNSVELKVVETEPGI
EFP_HELMI       QYLYSDGDDYTFMDVENFEQITLQRDQIEEQLRFLKENMNVHVLTWNGNLMGVELPNTVELKVVATEPGI
EFP_PELTS       QYLYSDGKEYNFMDMETYDQVTMSAAQLGDAVKYLKENMNIQVLLFQGKSIGVELPNFVELEVIDTTPGI
EFP_DESHY       QYLYKDGDHFVAMDNETYEQTSLTEAQIGDGVKYLKENMNLGILFFNGTVIGVDLPNTVILEVAHTEPGV
EFP_DESHD       QYLYKDGDHFVAMDNETYEQTSLTEAQIGDGVKYLKENMNLGILFFNGTVIGVDLPNTVILEVAHTEPGV
EFP_DESAP       QYLYNDGANYYLMDNETYDQVGLSAGQLGDGVKYLKENMIINVVYHRGQVLGVDLPNTVELTVIETTPGI
EFP_CARHZ       QYLYNDGDNFYCMDMETYDQFPLTKEQFGDAINYVKENTNLWVLFFKDKVIGVELPNFVELKVIDTPPGI
EFP_BREBN       QYLYASGDEYTFMNTETYEQMTFTRNQIERELRFLKENMNVQIMQYNGETIGIQLPNTVELVVTECEPGV
EFP_HALOH       QYLYHNGDDYVFMDTDTYEQLSISNEQLGDKVDYLKENMSLEVLMYENRPIDINLPTFVELEVEKTQPGI
EFP_NATTJ       QFLYAAGDMYNFMDTESFEQYTLTKDQLEDKTQFIKENMIITVLFHNGEEISIELPVFVELAVSETEPGV
EFP_TRIEI       QHTYKDSDQFVFMDMETYEETNLSSEQIGERVKYLNEGMEVNVIMWGEQVIEVELPNSVVLEVIETDPGV
EFP_THETN       QYLYNDGEFYYFMDTETYEQIPLSYDKVEEAMKYIKENMIVTVKFYKGEAFSVEPPTFVELEVIDTEPGV
EFP_NOSP7       QHTYKEGDEFVFMDMETYEEGRLTRTQIGDRVKYLKEGMEAEVIKWGDQVLGVELPKSVVLEIVQTDPGL
EFP_CYAP8       QHTYKDGDQYVFMDMETYEEARLNPEQMGTSVNYLKEEMEADIVFWGDQVLEVQLPTSVILEVTETDPGV
EFP_THEPX       QYLYNDGELYYFMDTETYEQIPLNYDKVEDAIKYIKENMVVTVKFYKGEAFSVEPPTFVELEVVETEPGF
EFP_THEP3       QYLYNDGELYYFMDTETYEQIPLNYDKVEDAIKYIKENMVVTVKFYKGEAFSVEPPTFVELEVVETEPGF
EFP_SYMTH       QFLYADQGVWVFMNNETFEQIELTEEQVGNAPNFLLENMTVQIASWKGQVIGVDLPNTVELKVVETEPGF
EFP_THEEB       QHTYKDGEDYVFMDMESYEEARLTPAQVGDRAKYLKEGMEVNIVKWGEQVLEVELPNSVVLEVVQTDPGV
EFP_EXISA       QYLYPMGDTYVFMDNESYEQLELTSAQVKSALPYLLENMEVSIADYEGEILGIELPTSVVLTIVEADPGV
EFP_ACAM1       QHTYKDGDQFVFMDMESYEEASLSQEQIGTRVKYLKEGMEVNVIQWGEQVLEVELPTSVVLEVTQTDPGV
EFP_SYNP2       QHTYKEGEQFVFMDMETYEEVRLTEAQIGDRVKYLMEEMEVNVLFWNSQVIDVELPNTVVLEVTETDPGV
EFP_PROM1       QHTYMDGDEFVFMDMTSYEETRLTAKQIGESRKYLKEGMEVNVVSWNEKPLEVELPNSVVLEIKETDPGV
EFP_PROMT       QHTYMDGDDFVFMDMTSYEETRLTAKQIGESRKYLKEGMEVNVVSWNEKPLEVELPNSVVLEIKETDPGV
EFP_SYNP6       QYTYKDGDDFVFMDMETYEEGRLTAATIGDRVKYLKEGMEANVITWNGQVIEVELPNSVVLEVIETDPGV
EFP_SYNE7       QYTYKDGDDFVFMDMETYEEGRLTAATIGDRVKYLKEGMEANVITWNGQVIEVELPNSVVLEVIETDPGV
EFP_DESRM       QYLYNDGESYNMMNMETYDQFTVSKADMGDAIKWLKENMTLTIASFNGNIIAVDLPNTVELAVVETAPGI
EFP_SYNWW       QYLYNDGEGYVCMDTENYEQISISKESIGEGAKWLMENMILGVLFFQGNIIGVDLPNFVEMLVVDTEPGV
EFP_EXIS2       QYLYPMGETYVFMDTESYEQLELTTAQVEAALPFLLENMEVQIAIYNGEVLGIELPNTIVMTIVEAEPGV
EFP_CYAP7       QHTYKEGEQFVFMDMETYEEARLNPEQLGDGAKYIKENMEVNVLYWGEQVLNIELPTSVILEVTDTDPGV
EFP_CLOTH       QYLYNDGDLYYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGF
EFP_SYNJB       QYLYAEGNNLVFMDMETYEQAPITAAQIGSAVKYLKENMQVSILRWNGQVIDVELPNTVVLEVVETDPGV
EFP_SYNJA       QYLYSEGDNFVFMDMETYEQAPLSAAQIGSAVKYLKENMEVAILRWKGQVIDVELPNTVVLEVVETDPGV
EFP_SYNSC       QHTYMEGEDYVFMDMATYEETRLSADQIGESRKYLKEGMEVNVVSWNDTPLEVELPNSVVLEIKETDPGV
EFP_SYNS9       QHTYMEGDDYVFMDMSSYEETRLTAAQIGDSRKYLKEGMEVNVVSWNDTPLEVELPNSVVLEIKETDPGV
EFP_SYNPX       QHTYMEGEDYVFMDMSTYEETRLSADQIGESRKYLKEGMEVNVVSWNGSPLEVELPNSVVLEITETDPGV
EFP_SYNPW       QHTYMEGEDYVFMDMGTYEETRLSAKQIGESRKYLKEGMEVNVVSWNDKPLEVELPNSVVLEIKETDPGV
EFP_MICAN       QHTYKEGDQFVFMDMETFEEATLTPVQMGDRAKYLKEGMEVNILFWNDQVLDIELPTSVILEITDTDPGV
EFP_GLOVI       QFVYPQGDNYVFMDMESYEQEALTRETLGDGAKYLKEGMSVSILKWQERVIGVDLPNTVVLQVVETDPGV
EFP_COPPD       QYLYSDGEHFVFMDTDTYEQVTLSGDIMSDVQQWLKEGMMVNVQFYQGKAVGIEVPTFVELEVVETEPGV
EFP_CALS8       QYLYNDGELYYFMDTQTYEQIALNQEMVGDALKFVKENMTVTILSHNGSVFGVEPPRFVELEVIDTEPGF
EFP_ANATD       QYLYNDGELYYFMDTQTYEQIALNQEMVGDALKFVKENMTVTVLSHNGVVFGVEPPRFVELEVIDTEPGF
EFP_SYNS3       QHTYMEGEDFVFMDMSTYEETRLTAKQIGDSRKYLKEGMEVNVVTWNEKPLEVELPNSVVLEIAQTDPGV
EFP_PROMA       QHTYMESGDYVFMDMSTYEETRLTANQIGDSRKYLKEGMEVNVVSWNEKPLEVELPNSVVLEVKETDPGV
EFP_CYAA5       QHTYKEGEQYVFMDMETYEEVRLSPEQMGTTVNYIKEEMEADVLFWNDTVLEVQLPTSVILEVTDTDPGV
EFP_SYNY3       QHTYKDGDQYVFMDMETFEEVSIAPDTLGDKAKFIKEEMEVSVVTWDGTILDVELPTSVVLEIVETDPGV
EFP_ANAVT       QHTYKEGDEFVFMDMESYEEGRLSASQIGDRVKYLKEGMEVNVIRWGEQVLEVELANSVVLEVIQTDPGV
EFP_PROM5       QHTYVESGDYVFMDMTSFEETRLSSDQIGRGSKYLKEGMEVNVIFYKDKVLEVELPISITLKVTETDPGV
EFP_CYAP4       QHTYKEGDQYVFMDMETYEEARLTAAQIGDRVKYLKEGMEASVIRWGEQVMEVELPNSVVLEVVQTDPGV
EFP_PROM4       QHTYMDSGDYVFMDMSSYEETRLTAAQIGESRKYLTEGMEVNVVSWNERPLEVELPNSVVLTVKETDPGV
EFP_ANASP       QHTYKEGDEFVFMDMESYEEGRLSAAQIGDRVKYLKEGMEVNVIRWGEQVLEVELANSVVLEVIQTDPGV
EFP_PROMP       QHTYVESGDYVFMDMISFEETRLSSDQIGRGSKYLKEGMEVNVIFYKDKVLEVELPISITLKVTETDPGV
EFP_PROMS       QHTYVESGDYVFMDMTSFEETSLTSEQIGKGAKYLKEGMEVNVIFHNGKVLEVELPISITLKVTETDPGV
EFP_PROM9       QHTYVESGDYVFMDMTSFEETRLSSEQIGKGSKYLKEGMEVNVILHNGKVLEVELPISITLKVTETDPGV
EFP_RHOE4       TYLYHDGSDYIFMDGDTYDQVSISESTVGDQSRFLLENMAVQVATHEDVPLFVELPVTVELVVKHTDPGL
EFP_PROM2       QHTYVESGDYVFMDMSSFEETRLTSEQIGRGAKYLKEGMEVNVIFHNGKVLEVELPISITLKVTETDPGV
EFP_PROM0       QHTYVESGDYVFMDMTSFEETRLSSEQIGKGAKYLKEGMEVNVIFHNGKVLEVELPISITLKVTETDPGV
EFP_EUBR3       QYLYADDDFYHFMDVETYDQIDLPKDEVGDALKFVKENEMCKVCSHKGNVFAVEPPLFVELTVTETEPGF
EFP_SYNR3       QHTYMEGEDFVFMDMASYEETRLTAKQIGEGRKYLKEGMEVNVVSWKDNPIEVELPNSVVLEVTETDPGV
EFP_PROM3       QHTYMESGDYVFMDMSSYEETRLTAQQIGDSRKYLKEGMEVNVVSWNGNPLEVELPNSVVLEITETDPGV
EFP_ACIC1       QYLYREGDSFVFMDTETYDQYHIPAQTVGDAANFLLENAEAVVALHEGTPLYVELPAAVELTITYTEPGV
EFP_RHOSR       TYLYHDGTDYIFMDGDTYDQISISEATVGDGARFMLENMAVQVATHEDVPLFVELPVTVELVVQHTDPGL
EFP_PROMM       QHTYMESGDYVFMDMSSYEETRLTAQQIGDSRKYLKEGMEVNVVSWNGNPLEVELPNSVVLEITETDPGV
EFP_DEIGD       QYLYRDGDDYVFMDMETFDQVHLPPALVGDTAKFMKENTEVEVAMYGDKALSITLPNQVILKIVQTDPGV
EFP_SALAI       QYLYADGEDYVFMDLETFDQITVLGDTVGEAANYLLPEAEAVVATHESVPLYVELPTSVVLEVTYTEPGL
EFP_RHOOB       TYLYHDGTDYIFMDGDTYDQISISEATVGDGARFMLENMAVQVATHEDVPLFVELPVTVELVVQHTDPGL
EFP_MYCPA       TYLYRDGSDFVFMDSQDYEQHPLPESLVGDAARFLLEGMPVQVAFHNGSPLYIELPVSVEMEVTHTEPGL
EFP_MYCA1       TYLYRDGSDFVFMDSQDYEQHPLPESLVGDAARFLLEGMPVQVAFHNGSPLYIELPVSVEMEVTHTEPGL
EFP_EUBE2       QYLYADGDLYNFMNTETYDQIALSADQVGDSLKFVKENEMVKLCSHEGNVFAIEPPISVELEVTETEPGI
EFP_SALTO       QYLYADGEDFVFMDLETFDQINVLGDTVGEAANYLLPEAEATVATHEGVPLYVELPTSVVLEITYTEPGL
EFP_CORA7       TYLYNDGQNYVVMDDKTYEQYELPFDKFGDAGKFLLENMRVQVSFHDGEALFGELPISVDLKVEHTEPGL
EFP_CLOCE       QYLYNDGDLYYFMDVESYEQLPINKETIGNTLDLVKENDIVKILSHKGNVFGIEPPTFVELEVTETDPGF
EFP_MYCSS       TYLYRDGSDFVFMDSEDYEQHPLPESLVGRAADFLLESMPVQIAFHDGVPLYLELPVTVELLVASTEPGL
EFP_MYCSK       TYLYRDGSDFVFMDSEDYEQHPLPESLVGRAADFLLESMPVQIAFHDGVPLYLELPVTVELLVASTEPGL
EFP_MYCSJ       TYLYRDGSDFVFMDSEDYEQHPLPESLVGRAADFLLESMPVQIAFHDGVPLYLELPVTVELLVASTEPGL
EFP_COREF       TYLYNDGSSYILMDDKTFEQFELPLDAFGDAGRFLLENMRVQVSFHDGEALFGELPVSVDLRVEHTDPGL
EFP_FRASC       TYLYRDGADFVFMDSESYDQIPIPPDVVGGTADYMLENTVATVALHDGAPLYVELPASVELTISQTDPGV
EFP_ENTFA       QYLYSQDDMAIFMDLETYEQYEVPTALIEEELKYLLENMEVKIQFYGEEVIGLTLPTTVILRVAETQPSI
EFP_ACHLI       QYLYASGDTHVFMNMETYEQIEVDKSQIEYELNFLYESLEVEINFYGTEIIGVNLPEKLVLEVKETVPGV
EFP_NOCFA       TYLYHDGSDYVFMDGETFDQISISEATIGSSARFLLENMAVQVAMHEGAPLYVELPVSVELEVTHTDIGL
EFP_MYCS2       TYLYRDGSDFVFMDSEDFEQHPLPESLVGRLADFLLESMPVQIAFHDGTPLYLELPVSVELEVTHTEPGL
EFP_FINM2       QYLYNDGTLYYFMDPDSYEQLPIDKASVEEAILYIKENDMATIKFFKGKAFQVSPPNFVELEITQTEPGI
EFP_CLOD6       QYLYNDGELYYFMDQENFEQIPLNYEQVEDAIKFLKENEVATIRFYQGQPFQVEAPNFAELEVTDTEPGI
EFP_MYCVP       TYLYRDGSDFVFMDSEDYEQHPLPEALVGRAADFLLESMPVQIAFHDGSPLYLELPVTVELVVASTEPGL
EFP_ARTAT       QYLYQDGEDFVFMDTQDYDQITVSGATVGDATNFMLENQMVNIAIHEGTPLYIELPPSVVLEITYTEPGL
EFP_KOCRD       QYLYQDGDDYVFMDNSTYDQITVPGVVVGDAANFMLENQNVTVAIHEGAPLYIEMPPSVVLEITYTEPGL
EFP_CLOBM       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOBL       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOBK       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOBJ       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOBH       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOB6       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOB1       QYLYTDGELYYFMDQETFEQIPLNYDKVEEAIKFLKENMFATIKFFKGEAFSVEAPNFVELLISHTEPGA
EFP_CLOAB       QYLYSDESFYYFMDQETYEQIPLSFDQVENAIKYLKENMFATIKFYKGEAFSVEAPNFVELKIVSCEPGV
EFP_MYCA9       TYLYRDGDSFVFMDSQDYEQHHLSPELVGDAHRFLLEGMTVQVAFNEGAALYIELPVSVELEVTHTEPGL
EFP_CORK4       TYLYNDGTDYVVMDDKNYEQIPLSPELMGDGARFLLENMPVQVSFYEDQPLFVELPVSVELKVKHTDPGL
EFP_MYCMM       TYLYRDGSDFVFMDSQDYEQHPLPESLVGDAARFLLEGMPVQVAFHDGAPLYIELPVTVEIVVTHTEPGL
EFP_CLOBB       QYLYSDGELYYFMDQETFEQIPLNAEKVEDAIKYLKENMFAVIKFFKGSAFSVEAPNFVELQITYTEPGV
EFP_CLOBA       QYLYSDGELYYFMDQETFEQIPLNAEKVEDAIKYLKENMFAVIKFFKGSAFSVEAPNFVELQITYTEPGV
EFP_CLAMS       QYLYADGENFVFMDTSDYDQITLSAAQVGDAKNFMLENQDVTVALHNGEGLYVELPASVVLTITYTEPGL
EFP_CLAM3       QYLYADGENFVFMDTSDYDQITLSAAQVGDAKNFMLENQDVTVALHNGEGLYVELPASVVLTITYTEPGL
EFP_MYCUA       TYLYRDGSDFVFMDSQDYEQHPLPESLVGDAARFLLEGMPVQVAFHDGAPLYIELPVTVEFVVTHTEPGL
EFP_MYCGI       TYLYRDGSDFVFMDSEDFEQHPLPEALVGRLAGFLLESMPVQIAFHDGVPLYLELPVTVELLVAHTEPGL
EFP_PHYAS       QFLYSSQEKYIFMNTQTYEQLEINKDQLKEKLHYLYEGLLVEIIFYNNEILTISLPDKISLKVTYAEPGV
EFP_SACEN       TYLYNDGTDYVFMDPDTYDQXXXXXXXXXXXXXYMLENSQVVVARHDDNPLYVELPASVELDIQHTDPGV
EFP_ARTCA       QYLYQDGADFVFMDTSDYDQITVSGATVGDATNFMLENQMVNIAIHEGNPLYIELPPSVVLEITYTEPGL
EFP_WOLSU       QYLYHDGDHFQFMDVESYEQIALSDEQVGDVAKWMTDGMTVSILFHNNKAISVDVPQVVELKITETPPNF
EFP_DEIRA       QYLYPDGDDYVFMDMETFDQVHLGKNIVSDAAKFMKENTEVEVAMYGDKALSISLPNQVILKITQTDPGV
EFP_CLOK5       QYLYSDGELYYFMDQETFEQIPLEYAKVQEAIKFLKENMFAIIKFYKGEAFSVEAPNFVELQVTHTEPGV
EFP_ARTS2       QYLYQDGADFVFMDTQDYDQITVSGATVGDATNFMLENQMVNIAIHEGTPLYIELPPSVVLEITYTEPGL
EFP_AQUAE       TYSYNDGENYYFMNTQTYDMIAVPKEKIEEEAKFLKEGMEVIVFLYKGQPIGIELPKHVELQVVETEPAF
EFP_FRASN       TYLYRDGADFVFMDSESYDQIXXXXXXXXXXADYMLENTIATVALHDDAPLYVELPASVELTISATDPGV
EFP_DEIDV       QYLYKDGADFMFMDMDTFEQVILPPSLVGDAAKFMKENTEVEVAMYGEKALTITLPNQVILKIVETDPGV
EFP_LEIXX       QYLYQDGADFVFMDTSDYDQITIPGPIVGDAANFMLENQNVTVALHEGSPLYVELPASVVLEITYTEPGL
EFP_THEYD       QYLYSQGDSYVFMDMESYEQISIPKERIGDAIYYIKDEMIVDVIYYKGEPLVIEPPMFVELRVAETEPAF
EFP_CORU7       TYLYNDGSAYVLMDDKTFEQVELQPELMGDGAKFLLENSRVNVSFHDGQALFAELPANVDLKIEHTDPGL
EFP_ONYPE       QFLYALEDNYIFMNTQNYEQLEINKHQLKDFLKYLYEGLLVDIIFYNDEIVGITLPDKISIKVAYTEPGA
EFP_ALKOO       QYLYSDGELYYFMDNETFEQTPLTYEEVEDAIKFLKENDNATIKFYHGKPFQVDPPNFVELQITETEPGV
EFP_RUBXD       SFLYRDGDLYYFMDQETYEQVAIPEDVVGEAKDFITPNGEVSVLYADGEVVSVQPPAHVELEVVETDPGV
EFP_DESAD       QYLYKDGEDYVLMDLESYEQMNVAADVIATAGGFLKEGETNKALLYNGEVIGIELPASVILEVTQTDPGV
EFP_CORDI       TYLYNDGSSYVVMDEKTFEQAELAPHIFGDAARFLLENTTVQVSFHEGEPLFAELPISLDLRIEHTDPGL
EFP_CLOTE       QYLYTDGELYYFMDQQTFEQIPLNFEQVEGAIKFLKENMFAIIKFYKGEAFSVEAPNFVELQITHTDPGA
EFP_NOCSJ       QYLYNDGSSYVFMDVQSYDQLEIAPEIVGNAKNFLLENQEAIVATNEGRVLFIELPASVELEITFTEPGL
EFP_CLOPH       QYLYSDGELYNFMNVETFDQIALNDEAVGDSLKFVKENDMVKMLSHQGNVFAIEPPLFVELVIVDTEPGF
EFP_AYWBP       QLIYVLEDNYIFMNTQNYEQLEINKYQLKDFLKYLYEGLLVDIIFYNDEIVGISLPEKISIKVAYTEPGA
EFP_CLONN       QYLYSDGELYYFMDQETFEQIPLNFEQVENAIKFLKENMFAIIKFYKGAAFSVEAPNFVELQIVECEPGI
EFP_STRGG       QFSYMDGEYFVFMDMDTYDQLMVDRKAVGDAANFLIEGFTASVAQHEGEVLYVELPAAVELTIQHTDPGV
EFP_HELAH       QYLYHDGDAYQFMDIESYEQIALSDSQVGEASKWMLDGMQVQVLLYNDKAISVDVPQVVALKIVETAPNF
EFP_DESOH       EYLYFDGENYCFMDCTTYDQIFVPPSQVAEVLDLLKENTVCDVLFFDNRAIGVTLPNFVELAITEADPWV
EFP_STRAW       QFSYMDGEYFVFMDMDTYDQLMVDRKSVGDAANFLIEGFTATVAQHEGEVLFVELPAAVELVIQETEPGV
EFP_BEUC1       QYLYKDGDDFVFMDSSDYEQFHVGPQIVGDAANFMLENTEVIVALHEGNPLYVELPTSVVLEITYTEPGL
EFP_HELPH       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_HELP2       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_DESMR       QYLYRESEDFVFMDMESYEQMHAGAAQLGEKGGYLKDGMELKMLLYKGQPLDIDLPASVVLQVAETEPGV
EFP_HELPY       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_HELPS       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_HELPG       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_CAMJR       QYLYDDGENCQFMDTQTYEQVAISDDDVGEAKKWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNF
EFP_CAMJJ       QYLYDDGENCQFMDTQTYEQVAISDDDVGEAKKWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNF
EFP_CAMJE       QYLYDDGENCQFMDTQTYEQVAISDDDVGEAKKWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNF
EFP_CAMJD       QYLYDDGENCQFMDTQTYEQVAISDDDVGEAKKWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNF
EFP_CAMJ8       QYLYDDGENCQFMDTQTYEQVAISDDDVGEAKKWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNF
EFP_HELHP       QFLYHDGGAFQFMDTTTYEQIALSDDQVGDVAKWIIDGLNVQILFHNEKAISVDVPLVVELTITETAPNF
EFP_CORJK       TYLYNDGTSFVLMDEKTYDQIELAPHLMGDGAKFLLENTSVQVSFHEGEPLFAELPVSVELKIEHTDPGL
EFP_ALHEH       QFLYSDGEFFHMMDPETFEQKAAPASAVGDAAKWLKEQAMCTVILWNDEPLTVEPPNFVELRVVETDPGV
EFP_HELPJ       QYLYHDGDTYQFMDIESYEQIALNDSQVGEASKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNF
EFP_DESDG       QFLYREDANLVFMDMTTYEQIYMPEETTEGKAGFLKEGQTIRVLLFNGTPLAIELPAALVLEVTETEPGA
EFP_LACF3       QYLYDEGNTSVFMDLETYEQYEIDQSQISEEKKYLTENMQVQMNFVDSELVGVELPATVTLEVVETQPEI
EFP_BIFA0       QYSYEDGDNFVFMDMTTFDQIMIPKTLVGDKAKYLLEGTDCIVSFHDGQPLSVELPASVVLTITHTEPGL
EFP_CORGL       TYLYNDGTSFIVMDDKTFEQYELSPDAFGDAGRFLLENMRVQVSFHEGEALFGELPVSVDLRVEHTDPGL
EFP_CORGB       TYLYNDGTSFIVMDDKTFEQYELSPDAFGDAGRFLLENMRVQVSFHEGEALFGELPVSVDLRVEHTDPGL
EFP_STRCO       QFSYMDGDYFVFMDMETYDQLMIDRKVVGDAANFLVEGFEATVAQHEGEVLFVELPAAVELTIQETEPGV
EFP_STRPZ       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSNVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRPG       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRPD       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRPC       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRPB       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRP8       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRP6       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRP3       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_STRP1       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_HALHL       QYLYNDGEFWYFMDPTSFEQKAAPSSAVGDAANWIKEQDTCTVILWNDTPLQVEAPNFVDLKVIETDPGV
EFP_ALKMQ       QYLYNDSDLYYFMDNETYEQVPLTLVEVEDAIKYLKENDSAIIKFYEGRPFQVEPPIFVELKVIETEPGV
EFP_STRPM       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_CAMLR       QYLYDDGENCQFMDTQTYEQVAISDEDVGEAKKWMLDGTMVDVLFHNGKAIGVEVPQVMELKIIETAPNF
EFP_MYCTU       XYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGL
EFP_MYCTA       XYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGL
EFP_MYCBT       XYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGL
EFP_MYCBP       XYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGL
EFP_MYCBO       XYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGL
EFP_HYDS0       EFSYKDADEYHFLTQNTHEMISINAEDIKEEAKFLKEGMTVVVFIYKNKPIGIELPKAVELEVIETDPGF
EFP_BIFLO       QYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGL
EFP_BIFLI       QYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGL
EFP_BIFLD       QYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGL
EFP_STRPF       QYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLYILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSI
EFP_THEAB       SYIYNDGEKYYFMDNETFEQYGIPVSDIEEEKNYLVENTEVDLIMHDGKPIGIQLPTSVVLEVVETEPGF
EFP_CAMFF       QYLYDDGEFCQFMDVESYEQVAISDEDIGEAKKWMIDGMMVQILFHNGKAIGVEVPQVVELKIVETQPNF
EFP1_LACAC      QYLYNEGDNYTFMDTDTYDQYEVSADQLGDDIKFLMPNIVVDMFTDDNKIIGIELPSTVEMTVKETQPGI
EFP_STRMU       QYLYQMDDTAYFMDTENYEQYEIPIVNIENELKFILENSEVKIQFYGSEVIGVTIPTTVELVVTDTQPSI
EFP_STRA5       QYLYKMDDTAYFMNNETYDQYEIPTVNIENELLYILENSEVKIQFYGTEVIGVQIPTTVELTVAETQPSI
EFP_STRA3       QYLYKMDDTAYFMNNETYDQYEIPTVNIENELLYILENSEVKIQFYGTEVIGVQIPTTVELTVAETQPSI
EFP_STRA1       QYLYKMDDTAYFMNNETYDQYEIPTVNIENELLYILENSEVKIQFYGTEVIGVQIPTTVELTVAETQPSI
EFP_STRZT       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRZP       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRZJ       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRR6       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRPS       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRPN       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRPJ       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRPI       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRP7       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRP4       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_STRP2       QYLYKMDDTAYFMNTETYDQYEIPVVNVENELLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSI
EFP_FERNB       EYLYNDGENYYFMDLQTYEQYAIPESEVDEAKYYLIENTQVDLVMHDEKPIGINLPTTVVLEVIETEPNF
EFP_THEM4       SYIYNDGEMYYFMDAETFEQYGIPETEIEDEKNYLVENTEVDLIMHDGKPIGIQLPTSVVLEVVETEPGF
EFP_SULNB       QYLYDDGEMLQFMDTTTFDQIGLTHEQVKETFDFMIDGMEADILFHNGEAISVEIPQTVVLKIVETPPNF
EFP_CLOPS       QYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSV
EFP_CLOPE       QYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSV
EFP_CLOP1       QYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSV
EFP_DESDA       QFLYRQDDDLIFMDMTTYEQLQMPVSTTDGKEGFLKDGQECRVLLYKGNPLDIDIPVSMVLAVVETEPGA
EFP_TROWT       TYLYRDADSFVFMDLADYDQIRLTASQVASAANYLSDNQKVVIATHNNAPLYVDLPPSVVLAVTHTEPGV
EFP_TROW8       TYLYRDADSFVFMDLADYDQIRLTASQVASAANYLSDNQKVVIATHNNAPLYVDLPPSVVLAVTHTEPGV
EFP_LACRJ       QYLYDEGDSAVFMDLESYEQYSLNHDLLGDDKNYLVENMKVILNFVNGDIIGVELPTTVELTVAETEPMI
EFP_LACRD       QYLYDEGDSAVFMDLESYEQYSLNHDLLGDDKNYLVENMKVILNFVNGDIIGVELPTTVELTVAETEPMI
EFP_HERA2       QYLYRE-DNYIYMNTETYDQFPVSVDLLEDALLYIRENETFDVLTYEDEVLDISLPPSVEMVVVETEPNY
EFP_SALRD       QYLYEDDYGLHFMDQESYEQFSMPPEQVEGR-EFLKEGGDVDIVFRAEEPLRTEVPQKVDLEVTETTPGV
EFP_DESVM       QYLYREGDDLVFMDLTTYEQLHIAEDTTDGKAGFLKEAQQVRVLLYNGKPLDIDLPVSLVLEVTDTEPGA
EFP_THET8       QYLYPEGEEMVFMDLETYEQFAVPRSRV-VGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGV
EFP_THET2       QYLYPEGEEMVFMDLETYEQFAVPRSRV-VGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGV
EFP_MYCAP       SYLYSDGENIILMDTETYEQVEIPVSHVEWELNFLKEGMIVKIRKYKEEILDIELDANVVLEVTEAPDAV
EFP_DESAA       QYLYAQGDEYYFMDVKTYDQVMLTEEAVGDAKEYLIDNLEMDILFFENKAIGITLPNFVELEVTQADPWV
EFP_CHRSD       EYLYSDGDMWHFMRTDSFEQYAVDKKAMGDVEKWLKEQVVYTVTLWNDNAIAVSAPNFIELEVVETDPGL
EFP2_PORGI      QYLYQDEMGYNFMHPETFEQITIPGASI-DGVQFLKDGDMVEVMVHATSVLTCELPPHVKLRVTYTEPGL
EFP_METCA       QYLYNDGELWHFMVPESFEQYAADQNAVADAKKWLKEQDICILTLFNNVPLAVQPPNFVELTITETDPGV
EFP_CHLAD       QYLYREGDSFVFMDNDTFDQIPVSAELVGDAVKFMKENETVDLVYDADQIIGVELPIFVNLKVVETTVAV
EFP_PERMH       SYSYFDGDSYWFIDMNTGDMIAVPASVLGDEAQFLKEGMEVFIFLDKGQPIGVELPKSAVYEVIETEPGF
EFP_BDEBA       SFLYKDDTGYNFMSQETFEQIAMSEEDLGEAKYYLTENLKVVILFYNEKAVACDVPKAVNLTVAQTDPGI
EFP1_PORGI      QYLYQDEMGYNFMHPETFEQITIPGASI-DGVQFLKDGDMVEAMVHATSVLTCELPPHVKLRVTYTEPGL
EFP_TERTT       QYLYNDGEFWHFMEPESFEQFQGDASVVGDSAKWLNEQDTVVVTLYNGSPLAVTPPNHVELEIVETDPGL
EFP_DICT6       EYLYKQGDEYYFIDNESFEQYVLTEEQLGEAINYLKEGNTVSVLFYEGNPIGIXXXXXXXXXXXXXDPGL
EFP_AMOA5       QFLYKDGAGYHLMDNNTFEQLDLDEKAIQNPL-LIKEGQELD-VLFHQETIGCELPPFVELKVTYTEPGL
EFP_CHLSY       QYLYREGDSFIFMDNDTFDQIPVSADLVGDAVRFMKENETVDLVYDAEKIIGVELPIFVNLKVVETTVAV
EFP_CHLAA       QYLYREGDSFIFMDNDTFDQIPVSADLVGDAVRFMKENETVDLVYDAEKIIGVELPIFVNLKVVETTVAV
EFP_NITOC       QYLYSDGEFWHLMSPETYEQYSADAAAVGDSTKWLKEQDTCTVTLWNGAPLLVSPPNFVTLKVTETDPGI
EFP_DICTD       EYLYKQGDEYYFIDNESFEQYILTEEQLGDAIKYLKEGNTVSVLFYEGNPIGIXXXXXXXXXXXXXDPGL
EFP_SACD2       EYLYTDGEFWHFMEPDSFEQYQADANAVGDSAKWLREQDKVIVTLFNGSPLAITPPNHVELEIVETDPGL
EFP_DICNV       QYLYKDEDNWYFMNPETFEQLPXXXXXXXXXEKWLLEQDECTVVLWNNNIISVTPPNFVERKIVDTDPGL
EFP_SULSY       NYSYTDGTYYYFLDTNTYETFAVPAEAMEHEAQFLKEGMQVVVFLDRGNPIGIELPKHEVYEVIETEPGF
EFP_FRAP2       VYSYFDGDSYVFMHPETFEQYMVSQEALGETKKWLKDQDEYQIILFNGQPISIIAPNFVNLEIVETDPGL
EFP_COXBU       QYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGV
EFP_COXBR       QYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGV
EFP_COXBN       QYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGV
EFP_COXB2       QYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGV
EFP_PSYCK       NYLYNDGEFWHFMHPESFEQIQADKTAMSDSIKWLKENALCTITLFNGAPLSVTPPNFVELQITETDPGV
EFP_FRATN       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAPNFVNLEIIETDPGL
EFP_PETMO       QYLYNDGDHYYFMLLDTYEQYSLPAQELEDEKFYLTENLEVDLIFFNGNPVSIQLPTVVVLTVIDTEPNF
EFP_MYCH7       SFLYNDGESIVLMDDSTYEQVAIENTKITWELNFLTEGIKVKLRKFNNEILDIELPAKIELKITSTFDAV
EFP_MYCH2       SFLYNDGVSIVLMDDSTYEQVAIENTKITWELNFLTEGIKVKLRKFNNEILDIELPAKIELKITSTFDAV
EFP_THISH       QYLYTDGEFWHFMVPDTFEQHAAGEAAVADAIKWLKEQDMCVVTLWNGVPLAVSPPNFVELTITQCDPGV
EFP_ALCBS       QYIYSDGEFWHFMDQTSFEQKQADETAVRDAKQWLKEEDICEVTLYNGEPLSVSPPNFVELEIIETDPGL
EFP_COXB1       QYSYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGV
EFP_PSYA2       NYLYNDGEFWHFMHPESFEQIQADKTAMSDSTKWLKENALCTITLFNGAPLSVTPPNFVELQITETDPGV
EFP_MYCHJ       SFLYNDGASIVLMDDSTYEQVAIENTKITWELNFLTEGIKVKLRKFNNEILDIELPAKIELKITSTFDAV
EFP_KOSOT       QYLYRDGDLFYFMDLETYEQYALDKDIIGEAVYYLKENMELDLQFHDSTPIGVVLPNTVILEVVETAPSY
EFP_HAHCH       EYLYTDGEFYHFMLTDSFEQHAADVSAVGDTTKWLKEQDVYTVTLYNGAPLSVSPPNFVELEIVETDPGV
EFP_FRATW       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRATT       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRATO       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRATM       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRATH       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRATF       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_FRAT1       VYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGL
EFP_ACIAD       DYLYNDGELWNFMDPVTFEQIAADKVAMGDAAKWLKDNEKCSIMLFNGVPLNVSAPNFVVLKIVETDPGV
EFP_LEPBP       QYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGL
EFP_LEPBA       QYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGL
EFP_SULDN       QYLYDDGEQYQFMDNDSYEQIGLSYEQCDDASKWFKDGIQVDMIFYKGNAISVSAPEVMELLITDTPPNF
EFP_PSYWF       NYLYNDGEFWHFMHPETFEQLQADANAMADAKQWLKENDLCTITLFNGVPLSVTAPNFVELEIVETDPGV
EFP_MARMS       EYLYTDGEFWHFMAVDSFEQHAADETAVGDTIKWLKEQEKYVVTLYNGAPLAVAAPNFIELEVKETDPGV
EFP_ACIF5       QYLYADATGYVFMDNENFEQLILSEDLLEGQTGYLLPNTEIQVNLHNERPIGVELPPVVILEVREAEPSI
EFP_ACIF2       QYLYADATGYVFMDNENFEQLILSEDLLEGQTGYLLPNTEIQVNLHNERPIGVELPPVVILEVREAEPSI
EFP_UNCTG       RFLYKESNNFNFMDMDTYEQITVHPELLGKMVNFLKENLEVEAIYLENELIGIDLPVIIEMTIAEAEHGI
EFP_DESAH       EYLYSEGGNFCFMNSVSFEQEFLGKDQVGDAVNLLKDNTVCTVLFFNGKAIGLTLPNFVNLRIVQSDPWA
EFP_ACIC5       EFLYNDGDDYYFMNTENFEQTHLKRDTLGDAVEYLTANLQITVSFFDGVAVGIELPQTVELTVVETEPGL
EFP_MYCMO       NFLYDEGENIVLMDNATYEQISIPKTRVEWEMNFLVEGAKVHIRKFADEILDIEIPVNIELKVIDAPEAV
EFP_STRU0       QYLYKMDDTAYFMNTETYDQYEIPVVNVEQELLYILENSDVKIQFYGSEVIGXXXXXXXXXXXXXXQPSI
EFP_STRSV       QYLYQMDDTAYFMNTETYDQYEIPVVNVEEELKFILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXQPSI
EFP_GRAFK       QFLYEDGEFWHFMNVEDYTQIRLTENALDMP-KLIKEGEVVTILI-NTEPLSVDMPASVVLEVTHTEPGV
EFP_SYNAS       QFLYTEEDRYCFMDNTSYEQIFLTADQVGDAAHFLIDNLEVEILLFEDKPLGISLPNFVDLVVTKADPWA
EFP_PSEHT       AYLYTDGEFWHFMNNETFEQIAADEKALGDAGKWLVENDVCTITLWNGNPIVVTPPNFVELEITETDPGL
EFP_IDILO       SYLYNDGEFWHFMNNETFEQVPADEKAVGEAEKWLVEQDVCTLTLWEGKPINVQPPNFVELEITETDPGL
EFP_STRGC       QYLYQMDDTAYFMNTETYDQYEIPVVNVEDELKYILENSDVKIQFYGSEVIGXXXXXXXXXXXXXXQPSI
EFP_STRS7       QYLYKMDDTAYFMNTETYDQYEIPVANVEQELLYILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_STREM       QYLYKMDDTAYFMNTETYDQYEIPVANVEQELLYILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_ACIBT       NYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGV
EFP_ACIBC       NYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGV
EFP_ACIB5       NYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGV
EFP_ACIB3       NYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGV
EFP_VIBCM       DYLYNDGEFYHFMNNSTFEQLAADAKAVGENAKWLVENNTCMLTLWNGNPIAVTPPNFVELEVTETDPGV
EFP_VIBCH       DYLYNDGEFYHFMNNSTFEQLAADAKAVGENAKWLVENNTCMLTLWNGNPIAVTPPNFVELEVTETDPGV
EFP_VIBC3       DYLYNDGEFYHFMNNSTFEQLAADAKAVGENAKWLVENNTCMLTLWNGNPIAVTPPNFVELEVTETDPGV
EFP_BACFR       QYLYKEGEDYIFMNQETFDQHPIAHDLI-NGVDFLLEGAVVEVVSASTETLYADMPIKVQMKVTYTEPGL
EFP_BACFN       QYLYKEGEDYIFMNQETFDQHPIAHDLI-NGVDFLLEGAVVEVVSASTETLYADMPIKVQMKVTYTEPGL
EFP_STRE4       QYLYKMDETAYFMNTETYDQYEIPVANVEQELLYILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_VIBVY       DYLYSDGEFYHFMNNETFEQIAADAKAVGENVKWLVENNTCMLTLWNGNPIAVTPPNFVELEVIETDPGL
EFP_VIBVU       DYLYSDGEFYHFMNNETFEQIAADAKAVGENVKWLVENNTCMLTLWNGNPIAVTPPNFVELEVIETDPGL
EFP_VIBPA       DYLYSDGEFYHFMNNETFEQIAADAKAVGENAKWLVENNTCMITLWNGNPITVTPPNFVELEVTDTDPGL
EFP_THELT       QFLYSDGAHYHFMALDDYEQYILSEEDLQDAKWYLIENLELSLVFLEDKPIGVQLPNVVTLKVVETEPSF
EFP_COLP3       AYLYADGEFWHFMNNETFEQIGAEEKALGETVKWLVEGDICTITLWNGTPITVTAANFVEIDITETDPGL
EFP2_GEOSL      QYLYKEDTHYTFMDNQTFEQVQMDEDAVGDAKNFLIDNLEVDILLFGEKAIGVTLPNFVNLRVVQTDPWV
EFP_SODGM       TYLYNDGEFWHFMNNENFEQLAADAKVVGDNAKWLVEQAECVLTLWNGQPIAVTPPNFVELEITETDPGL
EFP_MYCA5       DFLYNSGEAIVLMDQETFEQIEIPLNHVEWELNFLKEGQKVMVRKFQEEVLDIELPANVTLKVVSAPDAV
EFP_BACTN       QFLYKEGEDYIFMNQETFDQHPIAHDLI-NGVDFLLEGAVLDVVSASTETLYADMPIKVQMKVTYTEPGM
EFP_VIBF1       DYLYNDGEFYHFMNSVSFEQIAADVKAVGDTAKWLVENDTCTLTLWNDNPITVTPPNFVELEVTETDPGL
EFP_FLAPJ       QYLYAEGDQFHFMNIESFEQITL-DKKILDNPGLLKEGTNV-MVQVNTETLSVDMPASIILEVTYAEPGV
EFP_MYCS5       NFLYSDDSNIYLMDSSDYSQIEIDLLKVEWEMNFLKENSEVQVRMFQDEILDIELPANVDLKVTYAPDAV
EFP_MYCLE       XYLYRDGANFVFMDSQDYEQHPLPESLVGDTARFLLEGMSVQVAFHNGXXXXXXXXXXXXXXXXXXXXGL
EFP_MYCLB       XYLYRDGANFVFMDSQDYEQHPLPESLVGDTARFLLEGMSVQVAFHNGXXXXXXXXXXXXXXXXXXXXGL
EFP_CHLT3       QYLYQDGLDYVMMDGDTYEQLHISNELIGEQAKFLKESMEVDLV-FTTEIIQAEVPVFVELEVTETDPTT
EFP_BACV8       QYLYMEGADYIFMNQETFDQIPIAHDLI-NGVDFLLEGMVVDVVSASTETLFADVPVKVQMKITYTEPGL
EFP_VIBHB       DYLYSDGEFYHFMNNETFEQIAADAKAVGDNAKWLVENNTCMITLWNGNPITVTPPNFVELEVTDTDPGL
EFP_ROSS1       QFLYRDGDVYHFMDTETFEQIEVPEEMIGEPAKFLKENEMADILFYDNKILGVEPPLFVTLQVTEASVAV
EFP_DESPS       QFLYSQGEEYHFMDNENYDQLFITKDMLGDNIYFLQDNMDVDVLFFDEKPIDITLPIFVNLEVTRADPWV
EFP_PHOLL       TYLYNDGEFWHFMNNETFEQLAADEKAVGDNAKWLVEQAECILTLWNGQPISVTPPNFVELEITDTDPGL
EFP_LEPIN       TICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGL
EFP_LEPIC       TICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGL
EFP_HAMD5       IYLYNDGDFWHFMNNDTFEQLAADVKATGESAKWLVEQAECILTLWNGQPISVTPPNFVELQIVDTDPGL
EFP_VIBSL       GYLYNDGEFYHFMNNETFEQIXXXXXXXXXXXXWLVENDVCTLTLWNDNPITVTPPNFVEIEVTETDPGL
EFP_MYCPU       DYLYNDGSNIILMDQESFEQIEIDVKKVEWELNFLTEGMKILVRQYQNEILDIEIPINIELKVINAPDAV
EFP2_CHLCV      RFLYSDQEGATFMDDETFEQEMIFWDKIENIRQWLLEDTIYTLVLYNGNVIGVEPPIFMELTIAETAPGV
EFP_LEPBL       TICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGL
EFP_LEPBJ       TICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGL
EFP_RICFE       QFLYFEGDDLVLMDTKHFEQINVPKEILEEKLPFLTENMIVKVEFYNEKPLNIELPPTVILEINETDPVI
EFP_STRT2       QYLYQMDDTAYFMNTETYDQYEIPVVNVQEELKFILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_SALTY       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALTI       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALSV       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALPK       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALPC       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALPA       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALNS       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALHS       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALG2       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALEP       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALDC       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALAR       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SALA4       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_LAWIP       QFLYHEGSELIFMDLTNYEQLHMSEDVTNGKSEFLKDGQQCRVLLYNEKXXXXXXXXXXXXEVIETETAI
EFP_THEMA       QYLYRDGDHYYFMTLDDYEQYALSEEEIGDAKYYLVENMEVDLVFHEGTPIGIXXXXXXXXXXXXXXXSF
EFP_RHOBA       QFLYRQGQDYVFMDGTTFEQYEVPNEVAGDIWKYLKDGTECSMTLYNGAAIIVEPPQHVQLEVTECGPGT
EFP_ENT38       TYLYNDGEFYHFMNNTTFEQLSADEKAVGENAKWLLDQAECIVTLWNGQPISVTPPNFVELEIIETDPGL
EFP_DESVV       QYLYHEGDDLVLMDLTTYEQLYMHEDLTDGKAGFLKDGQQVRVLLYNGKXXXXXXXXXXXXXXXXXXXGA
EFP_DESVH       QYLYHEGDDLVLMDLTTYEQLYMHEDLTDGKAGFLKDGQQVRVLLYNGKXXXXXXXXXXXXXXXXXXXGA
EFP_YERE8       TYLYNDGEFWHFMNNETYEQLQADAKAIGDNAKWLIDQAECIVTLWNGQPISVTPPNFIELEIVDTDPGL
EFP_RUTMC       QYLYNDGNTWNFMDLDSFEQYTIDNATMNDAKGYLVEQDMCTVTLWNDNPISVIPPNHVILEVLNTDPGL
EFP_PECCP       NYLYNDGEFYHFMHPETFEQHQVEEKTVGDSAKWLQDNAECIVTLWDGRAIAVQPPNFIEAEITDTDPGL
EFP_KLEP7       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPIAVTPPNFVELEIIETDPGL
EFP_KLEP3       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPIAVTPPNFVELEIIETDPGL
EFP_ENTS8       TYLYNDGEFWHFMNNETFEQLAADAKAVGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_XYLFT       QYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGL
EFP_XYLFA       QYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGL
EFP_XYLF2       QYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGL
EFP_STRTD       QYLYQMDDTAYFMNTETYDQYEIPVVNVQEELKFILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_STRT1       QYLYQMDDTAYFMNTETYDQYEIPVVNVQEELKFILENSDVKIQFYGTEVIGXXXXXXXXXXXXXXXXSI
EFP_RICRS       QFLYFEGDDLVLMDTKHFDQINISKEMLEEKLSFLTENMIVKIEFYNDKPLNIELPPTVILEISETDPVI
EFP_RICRO       QFLYFEGDDLVLMDTKHFDQINISKEMLEEKLSFLTENMIVKIEFYNDKPLNIELPPTVILEISETDPVI
EFP_SHISS       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SHIFL       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SHIF8       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SHIDS       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SHIBS       TYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGL
EFP_SHIB3       TYLYNDGEF