[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99372.1

[Show Plain Result]


## Summary of Sequence Search
    1::260
    1::259     1e-98  66%  259 aa  UPPS_LACPL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::261     2e-90  66%  271 aa  UPPS_ENTFA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::239     2e-85  61%  239 aa  UPPS_LACJO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::252     2e-83  65%  252 aa  UPPS_LISIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::241     1e-82  57%  244 aa  UPPS_LACAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::256     3e-82  60%  258 aa  UPPS_BACAN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::252     4e-82  60%  252 aa  UPPS_LISMF RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::256     4e-82  60%  258 aa  UPPS_BACHK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::252     5e-82  60%  252 aa  UPPS_LISMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::256     5e-82  60%  258 aa  UPPS_BACC1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::256     2e-81  60%  258 aa  UPPS_BACCR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::252     1e-80  58%  257 aa  UPPS_GEOKA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   25::254     3e-80  59%  254 aa  UPPS_STAS1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     8e-80  59%  256 aa  UPPS_STAAW RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     8e-80  59%  256 aa  UPPS_STAAS RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     8e-80  59%  256 aa  UPPS_STAAR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     8e-80  59%  256 aa  UPPS_STAAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     1e-79  58%  256 aa  UPPS_STAAN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     1e-79  58%  256 aa  UPPS_STAAM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::244     5e-78  64%  260 aa  UPPS_BACSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::247     4e-77  58%  249 aa  UPPS_STRT2 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::247     4e-77  58%  249 aa  UPPS_STRT1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   21::249     4e-77  59%  249 aa  UPPS_MICLU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::256     7e-77  55%  256 aa  UPPS_STAHJ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::255     3e-76  55%  257 aa  UPPS_BACSK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::254     9e-76  55%  256 aa  UPPS_BACHD RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::248     1e-75  58%  250 aa  UPPS_STRA5 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::248     4e-75  58%  250 aa  UPPS_STRA3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     5e-75  55%  256 aa  UPPS_STAES RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::256     5e-75  55%  256 aa  UPPS_STAEQ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::250     3e-73  57%  252 aa  UPPS_STRR6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::250     3e-73  57%  252 aa  UPPS_STRPN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::249     4e-73  57%  249 aa  UPPS_STRP8 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::249     4e-73  57%  249 aa  UPPS_STRP6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::249     4e-73  57%  249 aa  UPPS_STRP1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::253     4e-73  53%  253 aa  UPPS_CLOPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::249     6e-73  57%  249 aa  UPPS_STRP3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::250     7e-73  55%  252 aa  UPPS_OCEIH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::247     6e-72  55%  249 aa  UPPS_STRMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::245     5e-69  53%  247 aa  UPPS_THETN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::253     6e-67  51%  255 aa  UPPS_CLOTE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::244     1e-66  49%  244 aa  UPPS_LACLA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::249     1e-65  48%  249 aa  UPPS1_ANASP RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   15::249     3e-65  48%  249 aa  UPPS_ANAVT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::257     6e-64  53%  257 aa  UPPS_CLOAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::259     9e-63  48%  260 aa  UPPS_HELMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::240     9e-61  52%  248 aa  UPPS_NEIG1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::237     9e-61  50%  246 aa  UPPS_GEOSL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::253     1e-60  48%  272 aa  UPPS_PROMP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::242     1e-60  49%  244 aa  UPPS_BACTN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::249     2e-60  47%  249 aa  UPPS_SYNY3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::260     6e-60  45%  265 aa  UPPS_CHLTE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::240     1e-59  51%  248 aa  UPPS_NEIMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::240     2e-59  51%  248 aa  UPPS_NEIMB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::241     2e-59  47%  247 aa  UPPS_AGRT5 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::241     6e-59  50%  251 aa  UPPS_CHRVO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::247     8e-59  44%  257 aa  UPPS_VIBF1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   11::245     1e-58  44%  251 aa  UPPS_VIBPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::243     1e-58  46%  254 aa  UPPS_PHOLL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::249     1e-58  46%  249 aa  UPPS_GLOVI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::245     2e-58  45%  250 aa  UPPS_VIBCH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::251     7e-58  46%  251 aa  UPPS_THEEB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::251     7e-58  46%  251 aa  UPPS_BUCAI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   18::253     3e-57  45%  258 aa  UPPS2_ANASP RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   12::239     3e-57  46%  242 aa  UPPS_HAEDU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   27::254     4e-57  48%  266 aa  UPPS_PROMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::247     1e-56  44%  254 aa  UPPS_PHOPR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::225     2e-56  49%  227 aa  UPPS_TREDE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::230     2e-56  50%  254 aa  UPPS_BRUME RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::230     2e-56  50%  254 aa  UPPS_BRUAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::230     3e-56  50%  254 aa  UPPS_BRUSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::245     4e-56  44%  251 aa  UPPS_VIBVY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::245     4e-56  44%  251 aa  UPPS_VIBVU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     6e-56  46%  253 aa  UPPS_SHIFL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     6e-56  46%  253 aa  UPPS_ECOLI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     6e-56  46%  253 aa  UPPS_ECOL6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     6e-56  46%  253 aa  UPPS_ECO57 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::240     5e-55  46%  247 aa  UPPS_RHIME RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::255     5e-55  47%  265 aa  UPPS_PROMM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     7e-55  46%  252 aa  UPPS_SALTY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     7e-55  46%  252 aa  UPPS_SALPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     2e-54  46%  252 aa  UPPS_SALTI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::255     2e-54  46%  260 aa  UPPS_SYNPX RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::236     3e-54  43%  239 aa  UPPS_HAEIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::230     8e-54  49%  233 aa  UPPS_THEMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::263     1e-53  42%  275 aa  UPPS_SHEON RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::244     1e-53  44%  251 aa  UPPS_PSEPK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::244     2e-53  44%  251 aa  UPPS_PSESM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::234     2e-53  44%  237 aa  UPPS_COXBU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::243     2e-53  45%  260 aa  UPPS_WIGBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::243     5e-53  45%  253 aa  UPPS_ERWCT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   53::300     5e-53  40%  302 aa  DDPS5_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 5;  
   28::264     7e-53  46%  264 aa  UPPS_PYRFU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::242     9e-53  43%  252 aa  UPPS_YERPS RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::242     9e-53  43%  252 aa  UPPS_YERPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::241     9e-53  42%  258 aa  UPPS_RALSO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::243     1e-52  44%  254 aa  UPPS_BORPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::243     1e-52  44%  254 aa  UPPS_BORPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::243     1e-52  44%  254 aa  UPPS_BORBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   43::280     3e-52  44%  280 aa  UPPS_METJA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::231     6e-52  45%  231 aa  UPPS_AQUPY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::264     7e-52  45%  264 aa  UPPS_PYRAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::246     7e-52  47%  263 aa  UPPS_NITEU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::228     7e-52  47%  230 aa  UPPS_FUSNN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::254     1e-51  44%  255 aa  UPPS_METTH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::246     2e-51  43%  254 aa  UPPS_PORGI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::242     2e-50  43%  251 aa  UPPS_PSEAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::234     3e-50  44%  237 aa  UPPS_HELHP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   61::294     5e-50  43%  296 aa  UPSS_MYCBO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::205     5e-50  49%  222 aa  UPPS_ZYMMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   61::294     5e-50  43%  296 aa  UPPS_MYCTU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::238     5e-50  41%  238 aa  UPPS_LEGPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::239     1e-49  41%  255 aa  UPPS_XYLFA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::261     3e-49  44%  285 aa  UPPS2_STRAW RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
    5::238     3e-49  41%  238 aa  UPPS_LEGPL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::249     3e-49  41%  249 aa  UPPS2_TROW8 RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   16::249     3e-49  41%  249 aa  UPPS1_TROWT RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   12::239     4e-49  40%  255 aa  UPPS_XYLFT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::264     6e-49  44%  264 aa  UPPS_PYRHO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::238     6e-49  41%  238 aa  UPPS_LEGPH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     6e-49  42%  257 aa  UPPS_FRATT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   21::253     6e-49  43%  253 aa  UPPS_CHLTR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   11::240     1e-48  43%  244 aa  UPPS_RHOBA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::240     1e-48  43%  240 aa  UPPS_PASMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   61::294     1e-48  42%  296 aa  UPPS_MYCLE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   57::295     1e-48  41%  296 aa  UPPS_MYCPF RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   31::260     1e-48  44%  277 aa  UPPS1_STRCO RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    5::231     4e-48  41%  231 aa  UPPS_AQUAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::213     8e-48  45%  244 aa  UPPS_RHILO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   64::299     8e-48  39%  302 aa  DDPS3_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 3;  
   14::241     1e-47  43%  257 aa  UPPS_XANAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::226     1e-47  43%  228 aa  UPPS_WOLSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::244     1e-47  42%  249 aa  UPPS_BUCAP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   46::286     1e-47  37%  289 aa  DDPS4_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 4;  
   24::247     2e-47  42%  259 aa  UPPS_CAUCR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   61::300     5e-47  38%  303 aa  DDPS1_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 1;  
   15::242     7e-47  42%  258 aa  UPPS_XANOR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   35::271     7e-47  41%  271 aa  UPPS_METKA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::254     9e-47  39%  255 aa  UPPS_PICTO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::264     2e-46  43%  264 aa  UPPS_PYRKO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::250     2e-46  41%  250 aa  UPPS_CHLPN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::233     3e-46  43%  234 aa  UPPS_HELPJ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::250     3e-46  41%  250 aa  UPPS_CHLCV RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::233     5e-46  43%  234 aa  UPPS_HELPY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::253     5e-46  42%  253 aa  UPPS_CHLMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::238     8e-46  38%  241 aa  UPPS_LEPIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::238     8e-46  38%  241 aa  UPPS_LEPIC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::258     1e-45  40%  258 aa  UPPS_THEAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   77::292     1e-45  41%  310 aa  DDPS2_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 2;  
    9::241     2e-45  39%  249 aa  UPPS_ACIAD RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::250     2e-45  41%  250 aa  UPPS_CHLAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::258     9e-45  39%  258 aa  UPPS_THEVO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::249     3e-44  38%  251 aa  UPPS_BUCBP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::263     3e-43  37%  263 aa  UPPS_THET8 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::263     3e-43  37%  263 aa  UPPS_THET2 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::234     6e-43  41%  235 aa  UPPS_RICFE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::242     8e-43  40%  258 aa  UPPS_XANCP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::225     2e-42  41%  226 aa  UPPS_RICTY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::225     2e-42  40%  226 aa  UPPS_RICPR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::245     2e-42  40%  245 aa  UPPS2_CORDI RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
    5::234     3e-42  41%  235 aa  UPPS_RICCN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::225     7e-42  41%  226 aa  UPPS_RICSI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::225     2e-41  39%  226 aa  UPPS_RICBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::245     3e-41  40%  251 aa  UPPS_ARCFU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   18::229     3e-41  39%  252 aa  UPPS2_BRAJA RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
    3::228     6e-41  39%  228 aa  UPPS_TREPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::233     2e-40  40%  246 aa  UPPS1_BRAJA RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    9::260     3e-40  40%  298 aa  UPPS_METMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::246     6e-40  35%  250 aa  UPPS_BLOFL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::260     1e-39  39%  298 aa  UPPS_METAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::256     1e-39  37%  257 aa  UPPS1_STRAW RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   34::264     2e-39  39%  264 aa  UPPS_BIFLO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   35::265     3e-39  37%  265 aa  UPPS1_CORDI RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    8::241     4e-39  38%  243 aa  UPPS2_CORGL RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   25::261     1e-38  36%  304 aa  UPPS_HALMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::225     1e-38  38%  225 aa  UPPS1_CORGL RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   29::274     2e-38  38%  274 aa  UPPS_DEIRA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::256     6e-38  37%  256 aa  UPPS1_COREF RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   18::258     6e-38  39%  333 aa  DHDDS_MOUSE RecName: Full=Dehydrodolichyl diphosphate synthase;    
    9::238     2e-37  40%  238 aa  UPPS_PYRAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   18::248     2e-37  39%  333 aa  DHDDS_HUMAN RecName: Full=Dehydrodolichyl diphosphate synthase;    
    6::222     3e-37  34%  222 aa  UPPS_CAMJR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::222     3e-37  34%  222 aa  UPPS_CAMJE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::261     2e-36  38%  262 aa  UPPS_SULAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::261     6e-36  36%  262 aa  UPPS_SULTO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::258     2e-35  37%  259 aa  UPPS_STRFR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   31::262     2e-35  35%  262 aa  ZFPP_MYCBO RecName: Full=Short-chain Z-isoprenyl diphosphate
   24::261     3e-35  35%  262 aa  UPPS_SULSO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::230     4e-35  33%  230 aa  UPPS_BORBU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   30::257     6e-35  39%  258 aa  UPPS1_TROW8 RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   31::262     1e-34  35%  262 aa  ZFPP_MYCTU RecName: Full=Short-chain Z-isoprenyl diphosphate
   30::257     1e-34  39%  258 aa  UPPS2_TROWT RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   27::246     3e-34  36%  264 aa  YE54_SCHPO RecName: Full=Uncharacterized protein C4D7.04c;
   17::250     5e-34  37%  302 aa  UPPS_HALSA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::241     2e-32  35%  243 aa  UPPS2_COREF RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   31::262     4e-32  34%  262 aa  ZFPP_MYCLE RecName: Full=Short-chain Z-isoprenyl diphosphate
   27::258     6e-32  35%  258 aa  UPPS2_STRCO RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   39::293     1e-29  35%  295 aa  DDPS6_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 6;  
  323::546     1e-28  34%  564 aa  CRUP_STRCO RecName: Full=Bifunctional protein crtB/uppS;Includes:
   66::279     1e-27  35%  343 aa  SRT1_YEAST RecName: Full=Putative dehydrodolichyl diphosphate
   35::270     1e-27  35%  272 aa  DDPS8_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 8;  
   31::239     5e-26  33%  286 aa  RER2_YEAST RecName: Full=Dehydrodolichyl diphosphate synthetase;   
   34::258     1e-25  33%  271 aa  DDPS7_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 7;  
    4::219     4e-16  31%  219 aa  UPPS_AERPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   74::254     6e-16  31%  270 aa  RER2_ENCCU RecName: Full=Dehydrodolichyl diphosphate synthetase;   
  147::274     2e-05  27%  274 aa  NGBR_DANRE RecName: Full=Nogo-B receptor;       
  190::345     3e-04  23%  375 aa  UPPS_YEAST RecName: Full=Probable undecaprenyl pyrophosphate
  203::345     7e-04  36%  444 aa  YNJ5_CAEEL RecName: Full=Uncharacterized protein R10E11.5;
    1::260

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPRIAGHKQGMETVKNITKVASNLGVKV
UPPS_LACPL      MFAFFNKNDPADNTDVQLDPERIPAHVAIIMDGNGRWAKARHLPRVAGHKEGMNTVKKITIAASDLGVKV
UPPS_ENTFA      MLRFFPQKNKYVEEASQYKEGQIPQHIAIIMDGNGRWAQNRRLPRIAGHKEGMDTVKKITKHASHLGVKV
UPPS_LACJO      ------------------------NHLAIIMDGNGRWAKKRHLPRFVGHRHGMDNIRNIALAANKLGIKV
UPPS_LISIN      ----------------------IPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDV
UPPS_LACAC      ----------MSKKDNEL------NHLAIIMDGNGRWAKKRHKPRFVGHREGMDNVERITLAANQLGIKV
UPPS_BACAN      ------KDTSFDHLVEEVKKGYIPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKV
UPPS_LISMF      ----FKKLFRQDENNSELAEDLIPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDV
UPPS_BACHK      ------KDTSFDHLVEEVKKGYIPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKV
UPPS_LISMO      ----FKKLFRQDENNSELAEDLIPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDV
UPPS_BACC1      ------KDTSFDHLVEEVKKGYIPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKV
UPPS_BACCR      ------KDTSFDHLVEEVKKGYIPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKV
UPPS_GEOKA      ----FNKMRKTKEKKEEVLRHPMPNHVAIIMDGNGRWAKKRALPRAAGHYEGMQVVRKITRFANELGIQI
UPPS_STAS1      ----------------------IPEHVAIIMDGNGRWAKQRKLPRIKGHYQGMQTVKKITKVASDIGIKY
UPPS_STAAW      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKY
UPPS_STAAS      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKY
UPPS_STAAR      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKY
UPPS_STAAC      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKY
UPPS_STAAN      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKY
UPPS_STAAM      ----------------------IPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKY
UPPS_BACSU      -------------KEDILKGE-IPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKV
UPPS_STRT2      ----FRKKSHQEVLDN------IPNHIGIIMDGNGRWAKKRLQPRVMGHKAGMDALQKVTIEASQLGVKV
UPPS_STRT1      ----FRKKSHQEVLDN------IPNHIGIIMDGNGRWAKKRLQPRVMGHKAGMDALQKVTIEASQLGVKV
UPPS_MICLU      -----------------------PKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVKKITRYASDLGVKY
UPPS_STAHJ      -------------KRNKTKLHNLPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKTVTREASDLGIKY
UPPS_BACSK      MLERFSKTDTEDEEPTSIDPQNIPRHVAIIMDGNGRWAKEKGLPRIAGHREGMKTVNKIVRAANTLNIEI
UPPS_BACHD      MLEKFSKRSNHTTPSHSLDESAIPKHVAIIMDGNGRWAKKKGLPRIAGHREGMKVINKIVRKAIDLKIEV
UPPS_STRA5      ------------KKQVEMPLEKIPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKV
UPPS_STRA3      ------------KKQVEMPLEKIPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKV
UPPS_STAES      ----------------------IPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITREASDIGIKY
UPPS_STAEQ      ----------------------IPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITREASDIGIKY
UPPS_STRR6      ----------------------VPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKV
UPPS_STRPN      ----------------------VPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKV
UPPS_STRP8      ----------------------IPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV
UPPS_STRP6      ----------------------IPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV
UPPS_STRP1      ----------------------IPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV
UPPS_CLOPE      MLDFFSKKGNEDSEEIVLIEDKMPKHIAIIMDGNGRWAKKRGLPRTMGHRAGVKTIKTIVKECDKLGVKY
UPPS_STRP3      ----------------------IPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKV
UPPS_OCEIH      ----------------------IPSHIAIIMDGNGRWAQKRGLPRIAGHREGVSTVNRIVKTAVNANVKV
UPPS_STRMU      -------------KKQDIKLSKIPAHIGIIMDGNGRWAKKRMKPRVFGHKAGMDALQDVTIAASELGVKI
UPPS_THETN      ---FFNEEKLI----KKLDKTRLPQHVGIIMDGNGRWAQKRGMPRVYGHKAGVNAVREVIRSCRELGIKY
UPPS_CLOTE      ---FKNKSGQSHKVKDKFQLDLIPKHIAIIMDGNGRWAKERKLPRSLGHKAGVETIRDIVKECNNIGVRY
UPPS_LACLA      --------------KNKEQEELLPEHIGIIMDGNGRWAKQKGKPRIFGHKAGMDSLKDVAVHGARRGIKV
UPPS1_ANASP     -----------------LKRELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWGIQA
UPPS_ANAVT      -----------------LKRELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWGIQA
UPPS_CLOAB      ----------------------IPKHIAIIMDGNGRWAKKRNLPRTMGHKAGGEALKRIVRECSDIGVKY
UPPS_HELMO      ---FGQTKTSADEQAEQIDPHRIPKHIAIIMDGNGRWAKRRGLPRVAGHRAGVESLRRVLEVCEDYNIAY
UPPS_NEIG1      -----------------LEHTAIPRHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQY
UPPS_GEOSL      ----------------------LPRHLAIIMDGNGRWAQERMLTRIIGHQKGVETVRIIVEECSRLGIGY
UPPS_PROMP      -------------------KERIPEHIAIIMDGNGRWATKKGLPRSFGHNKGVSVLKEIIKASKNIDCKV
UPPS_BACTN      ----------------KIDKNRIPQHIAIIMDGNGRWAKQRGKERTYGHQAGAETVHKIIEDAARLGVKY
UPPS_SYNY3      -----------------LDQQRLPQHVAVIMDGNGRWAKQRGMPRIMGHQRGVDSLKNLLRCCDDWGIAA
UPPS_CHLTE      MPQWFTSKSDPEDTRETLKSSVLPRHIGIIMDGNGRWAKIKGKSRIAGHVAGVESVRDVVEASSQLGIEN
UPPS_NEIMA      -----------------LEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQY
UPPS_NEIMB      -----------------LEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQY
UPPS_AGRT5      -------------------RSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISY
UPPS_CHRVO      -----------------------PRHIAIIMDGNGRWAKKRFLPRVAGHKRGLDAVREVVKACKEMGVGY
UPPS_VIBF1      -----------------LSLDVLPKHIAVIMDGNGRWAKAQGKPRVFGHKAGVDAVRKTISAASKLGINA
UPPS_VIBPA      ----------------------LPKHIAIIMDGNGRWAKSKGKPRVFGHKKGVNAVRKTVAAASKLGIKA
UPPS_PHOLL      -----------DHHQNDLS-SLLPKHVAIIMDGNGRWAKKRGKLRAFGHRAGIKAVRSAVSFSAKHNIES
UPPS_GLOVI      ----------------------LPRHVAAIMDGNGRWASKRNLPRVMGHQAGVSALKELLRCCKDWGIGA
UPPS_VIBCH      -----------------LSQDVLPKHIAVIMDGNGRWAKAQGKPRVFGHKNGVAAVRKTISTSARLGIKA
UPPS_THEEB      -----------------LDRDRLPRHVAVIMDGNGRWAKQRNLPRIMGHQRGVDTLKDLLRCCKDWGIEA
UPPS_BUCAI      ---------------NKKNHECNPCHVAIIMDGNGRWATRQGKIRIMGHKEGFRAVKEAIKFSIANNLKI
UPPS2_ANASP     -----------------LDPQKIPQHIAVIMDGNGRWATSRGLPRIAGHRQGARTLKELLRCCKDWGIKA
UPPS_HAEDU      ----------------------MPQHVAIIMDGNGRWAKKQGKLRVFGHQNGVNAVRAAVHFAAKYGIKV
UPPS_PROMA      ----------------------LPEHIAIIMDGNGRWANAKKLPRAMGHSAGVDALKQTLRLCNDWGIGV
UPPS_PHOPR      ----------------ELSAECLPKHVAVIMDGNGRWAKAKGKARVFGHKAGVEAVRKSVTTANRLGVKV
UPPS_TREDE      -------------------------HIAIVMDGNGRWAKKRGLPRSMGHKEGLNTVKRITKAVSDLGIPY
UPPS_BRUME      -----------------------PRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGY
UPPS_BRUAB      -----------------------PRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGY
UPPS_BRUSU      -----------------------PRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGY
UPPS_VIBVY      -------------QNSQLFTESLPKHIAIIMDGNGRWAKSKGQPRVFGHKKGVSAVRKTIAAASKLNIQA
UPPS_VIBVU      -------------QNSQLFTESLPKHIAIIMDGNGRWAKSKGQPRVFGHKKGVSAVRKTIAAASKLNIQA
UPPS_SHIFL      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
UPPS_ECOLI      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
UPPS_ECOL6      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
UPPS_ECO57      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
UPPS_RHIME      ----------------------VPAHVAIIMDGNGRWANARGLPRTMGHRKGVEAVRGAVRTAAEIGIRY
UPPS_PROMM      ----------------------LPNHVAVIMDGNGRWAKARGLPRMVGHRAGVEALKRTLRLCSDWGIGA
UPPS_SALTY      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDA
UPPS_SALPA      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDA
UPPS_SALTI      -------------------------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDA
UPPS_SYNPX      ----------------ELDGDRLPVHVAVIMDGNGRWAEARGLPRMMGHRAGVEALKSTLRLCSDWGIAA
UPPS_HAEIN      ----------------ELDQTNIPKHVAIIMDGNGRWAKQKNKMRIFGHTNGVTAVRKAVAYARQIGVEV
UPPS_THEMA      ----------------------IPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAEVLHNTVKWSLELGIKY
UPPS_SHEON      ---------SLPEVLPELVKQSLPKHVAIIMDGNGRWAQTQGKPRVMGHXXXXXXXXXXXXXXXQLGIQS
UPPS_PSEPK      ------------EKTKPAAPSSVPRHVAIIMDGNNRWAKKRLLPGVAGHKAGVDAVRAVIEVCAKSGVEV
UPPS_PSESM      ----------------------VPRHVAIIMDGNNRWARKRLLPGVAGHKAGVDAVRAVIEVCAEAKVEV
UPPS_COXBU      ---------------------MIPRHVAIVMDGNGRWANRRGLPRVAGHRAGAKVVRRIVEYAAEKPLEV
UPPS_WIGBR      ----------------KIKHINKPRHIAIIMDGNGRWAKNRGKLRIFGHKAGVESAKKAIKFAINNHLNA
UPPS_ERWCT      -----------------------PRHVAIIMDGNGRWAKSRGKMRIFGHQAGVKAVRRSVSFAVNHGLDA
DDPS5_ARATH     -----NEKRGTMGEKQKRGRNIMPKHVAVILDGNRRWAEKRGLGTSEGHEAGARRLMENAKDCFAMGTNT
UPPS_PYRFU      ----------------KVKAGVIPKHVAIIMDGNRRWARKREKPPWYGHFFGSKKLEEIVEWCHELGIRI
UPPS_YERPS      -----------------------PRHVAIIMDGNGRWAKNKGKLRVFGHKAGVKSVRRAVSFAAKHNLDA
UPPS_YERPE      -----------------------PRHVAIIMDGNGRWAKNKGKLRVFGHKAGVKSVRRAVSFAAKHNLDA
UPPS_RALSO      -----------------------PHHVAIIMDGNGRWATERHLPRMAGHSRGLDAVRAAVQAADHRGVRY
UPPS_BORPE      ----------------------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRY
UPPS_BORPA      ----------------------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRY
UPPS_BORBR      ----------------------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRY
UPPS_METJA      -----------------IDKDNLPKHVAIIMDGNRRAAEIYGKDRYYGHYLGAEKVREVLRWARDLGINV
UPPS_AQUPY      ----------------------IPEHVAIIMDGNGRWARKRGLPRIAGHYKGAEVAEDIVEFAIELGIKH
UPPS_PYRAB      ----------------KVKAGVLPKHVAIIMDGNRRWAKKREKPPWYGHLFGSKKLEEILEWCHELGIRI
UPPS_NITEU      ----------------------IPKHIAIIMDGNGRWARKRFLPRIAGHTQGVEAVRGTIKACIERGVSH
UPPS_FUSNN      ----------------------IPKHIAIIMDGNGRWAKKRGLARSFGHMEGAKTLRKALEYLTEIGVKY
UPPS_METTH      -----------------LRRDRMPRHVAIIMDGNRRYSKLQSMNPIEGHKKGIETLEKVLDWCVDLGIEI
UPPS_PORGI      ---------------------IVPRHIALVMDGNGRWAKIRGKERCEGHXXXXXXXXXXXXXXXXCGVEY
UPPS_PSEAE      ----------------------VPRHVAIIMDGNNRWAKKRLLPGVAGHKAGVDAVRAVIEVCAEAGVEV
UPPS_HELHP      -----------------------PQHIAVIMDGNGRWAKKQGKKRTQGHKEGAKIVRDITQWCAEKGIPY
UPSS_MYCBO      ----------------RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKW
UPPS_ZYMMO      ------------------------------MDGNGRWASARHLPRIAGHKKGADAVKTTVRAAAEMGIEV
UPPS_MYCTU      ----------------RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKW
UPPS_LEGPA      ----------------------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISC
UPPS_XYLFA      ----------------------LPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAAMRTVDFCLEKGIKM
UPPS2_STRAW     ----------------KLPGELIPNHVACVMDGNGRWAKERGLPRTEGHKVGEGVVMDVLKGCIELGVKN
UPPS_LEGPL      ----------------------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISC
UPPS2_TROW8     -----------------IPRKSLPRHVAVVMDGNGRWANQRNLPRIEGHKAGESALIDVVAGAVQVGVPY
UPPS1_TROWT     -----------------IPRKSLPRHVAVVMDGNGRWANQRNLPRIEGHKAGESALIDVVAGAVQVGVPY
UPPS_XYLFT      ----------------------LPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAAMRTVDFCLEKGIKM
UPPS_PYRHO      ----------------KVKSGVLPKHVAIIMDGNRRWARKHEKPPWYGHLFGSKKLEEILEWCHELGIRI
UPPS_LEGPH      ----------------------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISC
UPPS_FRATT      -------------------KENILRHLAIIMDGNGRWAKSRLKPRIFGHRNSVSSVDATIEYCVENNIEM
UPPS_CHLTR      ----------------------LPRHIAIIMDGNRRWQRKHEQRAISGHRQGADSIPQIVDTALHLGVEA
UPPS_RHOBA      ----------------------LPRHVAIIMDGNGRWAQARDLPRIEGHXXXXXXXXXXXEMASELKLDA
UPPS_PASMU      ----------------------IPQHVAIIMDGNGRWAQQKGKMRIFGHKNGVKAVREAVSYARKVGIKV
UPPS_MYCLE      ----------------RLSAAQLPTHVAIVMDGNGRWANQRGLHRTEGHKMGEAVVIDVACGAIELGIKW
UPPS_MYCPF      ------------EAAPQIPADQVPQHVAVVMDGNGRWATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKH
UPPS1_STRCO     --------------------DLVPEHVAIVMDGNGRWAKERGLPRTEGHKVGAEQVMDVLQGAIEMGVGN
UPPS_AQUAE      ----------------------LPEHVAIIMDGNGRWARQRGLPRVAGHYRGAEVAEDIIEYCIELGIKH
UPPS_RHILO      -----------------------PAHVAIIMDGNGRWAKARGMPRLAGHRAGVEALRKTVRAAPDLGISF
DDPS3_ARATH     ----------------ELQRELMPRHVAVIMDGNRRWAKRAGLLTSQGHEAGAKRLIEFSELCFKLGIHT
UPPS_XANAC      ----------------------VPRHIAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLEKGVSA
UPPS_WOLSU      -------------------------HLAIIMDGNGRWAQERGKQRVRGHEKGAETIREITMFCSKSDISF
UPPS_BUCAP      -------KSSLKNKKRIQKENL--RHIAIIMDGNGRWAEKRGKIRTLGHKEGFKTARKIIKYAVENNIKI
DDPS4_ARATH     -----------EETPKELQRELMPRHVAVIMDGNRRWAKQTGLLTSQGYEAGAKRLLEFADLCFKLGINT
UPPS_CAUCR      -------------------------HVAIIMDGNGRWAKQRGMPRVLGHRAGVNALKRTVEGAQSQNVGV
DDPS1_ARATH     -------------REDGLQRELMPRHVAFILDGNRRWAKRAGLTTSQGHEAGAKRLIDIAELCFELGVHT
UPPS_XANOR      ----------------------VPRHIAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLEKGVSA
UPPS_METKA      ----------------KVKEGRVPEHVGIIMDGNRRFARELGLEPWEGHRYGADKLEDVLEWCLDLGVKA
UPPS_PICTO      ----------------EIKKHPVPGHLGIITDGNRRYARSIGISENEGHVKGKEKLEEVLNWSMEVGIHM
UPPS_PYRKO      ----------------KVKSGNIPKHVAIIMDGNRRWARKLEKPPWYGHLFGSKKLEEILEWCRELNIRT
UPPS_CHLPN      ---------NAESKFPSLQR--LPNHVAIIMDGNRRWYKKHREEHTSGHYYGAKVLPNILNAVLDLGIKV
UPPS_HELPJ      -------------------------HLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
UPPS_CHLCV      ------------EDQVNVSLQSLPRHVAIIMDGNRRWHQQHQLKQTSGHYYGAKALPSIIESAFSLGIEV
UPPS_HELPY      -------------------------HLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
UPPS_CHLMU      -------------QENFLREPPLPKHIAIIMDGNRRWQKKHEQNAISGHRRGADSIPQIVDTAALLGVEA
UPPS_LEPIN      ----------------------LPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKN
UPPS_LEPIC      ----------------------LPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKN
UPPS_THEAC      ----------------EVKKYPRPRHIGIITDGNRRYARNVGISENXXXXXXXXXXXXXXDWCMELDIRI
DDPS2_ARATH     ----------------------MPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVELCGKWGIQV
UPPS_ACIAD      ----------------------LPKHVAIIMDGNNRFAKKNQMQKGDGHREGKNSLDPIVEHCCTRGVQA
UPPS_CHLAB      -----------------LSMQSLPKHVAIIMDGNRRWYRQHQIKSSSGHYYGAKVLPNIIESAFSLGIEV
UPPS_THEVO      -----------DVLMEEVKKYPRPRHVGIITDGNRRYARIVGIPENEGHVKGKNKVEEVLDWCMELDIKI
UPPS_BUCBP      -------KNNMLFKNVLNFKKNIPSHVAIIMDGNGKWARKRGKSRFFGHFSGFYAARRAISFALFHKLKI
UPPS_THET8      ------------EKRREVKRGPMPRHLGLILDGNRRYARALGLSPTKGHEFGVQKAYEVLEWCLEMGIKT
UPPS_THET2      ----------------EVKRGPMPRHLGLILDGNRRYARALGLSPTKGHEFGVQKAYEVLEWCLEMGIKT
UPPS_RICFE      -----------------LKYKIMTNHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFINLNIPY
UPPS_XANCP      ----------------------VPRHLAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLDKGVSA
UPPS_RICTY      -------------------------HLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFINLNIPY
UPPS_RICPR      -------------------------HLAIIMDGNARWADRHNLTKSEGHKAGADKIRELLPEFINLNIPY
UPPS2_CORDI     ----------------QIPQEFLPRHIALVMDGNGRWATNRGLKRTEGHKRGEAVLLDMVDACIAMGIPY
UPPS_RICCN      -----------------LKYKIMTNHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFLNLNIPY
UPPS_RICSI      -------------------------HLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFLNLNIPY
UPPS_RICBR      -------------------------HLAIIMDGNARWAATHNLPKSEGHRAGADKVHELLPEFINLKIPY
UPPS_ARCFU      ---------------NKLLRSVIPHHIAIIMDGNRRFARKKGLEPHEGHFFGSKKAEEVLEWCWDLGVKM
UPPS2_BRAJA     -----------------------PAHVAIIMDGNGRWAAARGLPRAEGHRRGVEALRRVVRASHELGIRY
UPPS_TREPA      -------------------------HVAIIMDGNGRWAEXXXXXXXXXXXXXLQTAREIVAALCAIRVPF
UPPS1_BRAJA     -------------------------HVGIIMDGNGRWATRRGLSRLRGHEAGVETIRRIVEAAPKQGIGT
UPPS_METMA      ---FYRKYEQILEK--EILSSEIPEHIAVIMDGNRRYAGQLGKARIFGHAMGAEVTEQVIEWCYEIGVKQ
UPPS_BLOFL      -----------DQNIQPLSSAILPRHIAIIMDGNGRWARGRGKLRIVGHXXXXXXXXXXXXXXXHCRFNA
UPPS_METAC      ---FYQEYEQLLEK--EILSSEIPDHIAVIMDGNRRYAGQRGRTRSFGHAMGAEVTEQVIEWCYEIGVKE
UPPS1_STRAW     -----------------LDHDQVPKHIGVIMDGNRRWAKAAGSTTAQGHRAGADKIEEFLGWCSETDVGV
UPPS_BIFLO      ----------------------VPRHIGVIMDGNGRWAKQRGMVRTNGHQAAEPVVFDTIAGAIEAGVRY
UPPS1_CORDI     -----------------------PEHVAIMCDGNRRWAREAGFADVTGHRVGAKKIGEMVRWCAHTDVEL
UPPS2_CORGL     ----------------EIPAQFLPKHIALVMDGNGRWATERGMKRTEGHKRGEAVLLDVVDACIELGVPY
UPPS_HALMA      -----------------------PDHVAVIMDGNRRYAEKQGTKKQEGHKEGAQTTEALLNWCDELGIRE
UPPS1_CORGL     -------------------------------DGNRRWAREAGFTDVSGHRVGAKKIGEMVRWCDDVDVNL
UPPS_DEIRA      ----------------KLAREVLPRHLGLILDGNRRFARAAGLQREMGHSFGADKAHEVLQWCLELGIPS
UPPS1_COREF     -----------------------PGHVAIMCDGNRRWAREAGFVDLSGHRVGAKKIGELVRWCXXXXXXX
DHDDS_MOUSE     ---------------NIIKAGPVPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILE
UPPS_PYRAE      ----------------------IPTHIAVIPDGNRRYAKKTGIDFYHAYKKGVEKVRNLTWALEFRDIKN
DHDDS_HUMAN     ---------------NIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILE
UPPS_CAMJR      -------------------------HLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISN
UPPS_CAMJE      -------------------------HLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISN
UPPS_SULAC      ---------------SQIKDGPFPFHVGIIPDGNRRWARNNRLPLDQGYYTGYVKLRDVLTWILEIGIST
UPPS_SULTO      ---------------NEIKNGPFPQHVGIIPDGNRRWARANNLSINDAYYSGYRKLKQVLLWLLEMGIKN
UPPS_STRFR      ----------------------LPKHIGLIMDGNRRWARQMGMANPSGHRYGAEHVESVLSWCETAGIKH
ZFPP_MYCBO      ----------------------LPRHIAVLCDGNRRWARSAGYDDVSGYRMGAAKIAEMLRWCHEAGIEL
UPPS_SULSO      ---------------NQIRNGPLPDHVGIIPDGNRRWARDNNLSLNDAYFYGYKKLKEVLIWLLELGIKN
UPPS_BORBU      ----------------------LPSHVGIIMDGNRRWALGKRLSSLEGYKEGLKRAKEIVKYSLRVGIKC
UPPS1_TROW8     ----------------------LPGHVALIVDGNRRWARKEKRDRISGHRAGAGKAVDFLHWCDELDINI
ZFPP_MYCTU      ----------------------LPRHIAVLCDGNRRWARSAGYDDVSGYRMGAAKIAEMLRWCHEAGIEL
UPPS2_TROWT     ----------------------LPGHVALIVDGNRRWARKEKRDRISGHRAGAGKAVDFLHWCDELDINI
YE54_SCHPO      ---------------NTIKRGKVPQHIAFVMDGNRRWARQRRMETIEGHSSGFEALKSLLKVCLKLGVKE
UPPS_HALSA      -----------------LTREIAPAHVAVIQDGNRRYAREHGDDPTDGYQSGARTTERVLEWCSDLGVEE
UPPS2_COREF     --------------------EFLPRHIALVMDGNGRWATEKGMKRTEGHRRGEXXXXXXXXXXXXXXXPY
ZFPP_MYCLE      ----------------------LPRHIAVLCDGNRRWARDAGYDDVSGYRMGAAKIAEMLRWCQEAGIEM
UPPS2_STRCO     -----------------------PQHIGIMLDGNRRWAKMSGIPR-EGYRAGGAKVLDFLRWCDSAQIEH
DDPS6_ARATH     ----------------------IPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCYELGIKY
CRUP_STRCO      -------------------------HIAVIADGNRRWAEARGLLADQGHRAGIRAVLRLVNAAQRTGIRH
SRT1_YEAST      ----------------------VPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKC
DDPS8_ARATH     ----------------------IPTNISFIMDGNRRFAKKRNLEGLAGHRAGFISVKYILQYCKEIGVPY
RER2_YEAST      ----------------------VPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDT
DDPS7_ARATH     ----------------------IPTNISFIMDGNRRFAKKHNLIGLAGHRAGFISVKYILQYCKEIGVPY
UPPS_AERPE      -----------------------PRAIGIIPDGNRRWASLRGENLYIAYYTGYRNVKRILTYIRDFAIRS
RER2_ENCCU      -------------------------NIAFICDGNRRYARKLGLEDSFIKDKGLQKIYEFIEFGCFYGIKE
NGBR_DANRE      ----------------------------------------------------------------------
UPPS_YEAST      ------------------------------------------------------------------GIKH
YNJ5_CAEEL      --------------------------------------KFAHAPEIAGNSQKAVRIQSETQEEAPVAVKN


                         .         .         *         .         .         .         .:140
query           LTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNC
UPPS_LACPL      LTLYAFSTENWKRPTDEVNYLMQLPVSFFDTFVPDLIKNNVRVQVMGYVDHLPEATQKAVQNAIADTKDC
UPPS_ENTFA      LTLYAFSTENWKRPTDEVNFLMQLPVDFFDTFVPELIKENVKVNVMGYQEFLPSHTQDAVKRAIEQTKDN
UPPS_LACJO      LTLYAFSTENWARPTDEVNYLMRLPIDFFDKFMPELMENNVRVNIMGFVDELPEKTYLVTQKAMAETANN
UPPS_LISIN      LTLYAFSTENWKRPTDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPEHTMRAVEKAIADTAHC
UPPS_LACAC      LTLYAFSTENWARPKEEVAYLMNLPVRFFDKYMPTLMENNVKVNIMGYLDELPEKTYKIVQRAMSETVNN
UPPS_BACAN      LTLYAFSTENWKRPKKEVDYLMQLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKEN
UPPS_LISMF      LTLYAFSTENWKRPTDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPNHTMRAVEKAIADTAHC
UPPS_BACHK      LTLYAFSTENWKRPKKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKEN
UPPS_LISMO      LTLYAFSTENWKRPTDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPDHTMRAVEKAIADTAHC
UPPS_BACC1      LTLYAFSTENWKRPKKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKEN
UPPS_BACCR      LTLYAFSTENWKRPKKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQKDRLPTHTRRAMEKAMEDTKEN
UPPS_GEOKA      LSLYAFSTENWKRPKSEVDYLMKLPEQFLTTFLPELVAENVKVQVIGHTEALPDHTRRAVEKAVKETSGN
UPPS_STAS1      LTLYAFSTENWTRPENEVNYIMNLPVNFLKTFLPELIENNVKVETIGFMEYLPSSTLKAIAKAKEDTKDN
UPPS_STAAW      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_STAAS      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_STAAR      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_STAAC      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_STAAN      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_STAAM      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANN
UPPS_BACSU      LTLYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQN
UPPS_STRT2      LTVYAFSTENWSRPQDEVKFIMNLPVEFFNKYVPELDKNNVRILTIGDNSRLPKETLDALEKAVEQTKHN
UPPS_STRT1      LTVYAFSTENWSRPQDEVKFIMNLPVEFFNKYVPELDKNNVRILTIGDNSRLPKETLDALEKAVEQTKHN
UPPS_MICLU      LTLYAFSTENWSRPKDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHN
UPPS_STAHJ      LTLYAFSTENWSRPENEVNYIMNLPVNFLKTFLPELIEKNVQIETIGFLDAVPKSTIEAIEHAKEKTKNN
UPPS_BACSK      LTLYAFSTENWKRPKAEVEFLLKLPERYLKSELPTLIEENVQVRLMGSKDGLPSYTLHAVDEAIEKTKHN
UPPS_BACHD      LSLYAFSTENWKRPRTEVDYLLKLPERFLKLELPNLMEENVQVRIMGGLDTLPEHTAKAVTKAMEETKDN
UPPS_STRA5      LTVYAFSTENWSRPDDEVKFIMNLPVKFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHN
UPPS_STRA3      LTVYAFSTENWSRPDDEVKFIMNLPVEFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHN
UPPS_STAES      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKIETIGFYEGLPQSTIDAIDFAKAKTQHN
UPPS_STAEQ      LTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKIETIGFYEGLPQSTIDAIDFAKAKTQHN
UPPS_STRR6      ITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNN
UPPS_STRPN      ITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNN
UPPS_STRP8      LTVYAFSTENWSRPQDEVSFIMNLPVAFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRN
UPPS_STRP6      LTVYAFSTENWSRPQDEVSFIMNLPVAFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRN
UPPS_STRP1      LTVYAFSTENWSRPQDEVSFIMNLPVTFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRN
UPPS_CLOPE      LTLYAFSTENWKRPEDEVNALMKLVVEFIKNEIDELHQNGVRVQTIGDLSRFPEEPKKAILWAMEKTKDN
UPPS_STRP3      LTVYAFSTENWSRPQDEVSFIMNLPVTFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRN
UPPS_OCEIH      LTLYTFSTENWKRPKSEVDFILKLPKEFLHVYLPGLIENNVRVQTIGDFNAVPKHTQDAIEYAMEKTKDN
UPPS_STRMU      LTVYAFSTENWARPQEEVKFIMNLPVEFFDKYVPKLHKNNVRILVIGDKEELPAATLDALERARELTKHN
UPPS_THETN      LTLYAFSTENWKRPKEEVDFLMDLLVEYLSKEVDELNKNNVVVKFIGDISRLPEKCQIEIEKAQKLTEKN
UPPS_CLOTE      LTLYAFSTENWKRPKEEINALMELLVNYLRKEVAELHQNNVVVNTIGDVSKLPKACEDELMKAYNKTKNN
UPPS_LACLA      MTVYAFSTENWTRPVDEVKFIMSLPIDFYSKYVPVLKEENIQIRMIGEREGLPKATLDSIDRAAQETSEN
UPPS1_ANASP     LTAYAFSTENWKRPQEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLTALPRSLQAEISRSMEETKNN
UPPS_ANAVT      LTAYAFSTENWKRPQEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLAALPRSLQAEISRSMEATKNN
UPPS_CLOAB      LTVYGFSTENWIRPKEEVNAIMRLIVEFLKREFNELNKNNVIINPIGNILGLPEACITALNDAKNKTKNN
UPPS_HELMO      LTVYAFSTENWKRPADEVNALFDLLVEYLHRELNTLHSKGVRIRAIGKIEDLPGGPRRELEKAIAKTANN
UPPS_NEIG1      LTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILQGIEEAEALTANN
UPPS_GEOSL      LTLFAFSAENWLRPKTEVKALMALLKKYIASEAARMDANNIRFNVIGNRDELPPDVNKAVQGAIDRTSGN
UPPS_PROMP      LTVYAFSTENWIRPSNEVDFLINLFEKVLKKEISEIHQESIKIKFIGDLSPLPNSLKLLIKSSEALTNNN
UPPS_BACTN      LTLYTFSTENWNRPQEEVAALMNLLVDSIEE--ETLMKNNIRFRIIGDIKKLPAEVQEGLSRCIEHTANN
UPPS_SYNY3      LTAYAFSTENWGRPLEEVEFLMTLFERVLRRELKEMMAENVRIRFVGNLTSLPRSLQDEIARSMEDTKNN
UPPS_CHLTE      LTLFTFSIENWKRPKPEISALMKLLIKVLRKEAVKLLENDIRLEVIGDMEMIPDDVRKTLDETIELTRKN
UPPS_NEIMA      LTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILKGIEEAEALTANN
UPPS_NEIMB      LTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILQGIEEAEALTANN
UPPS_AGRT5      LTLFAFSSENWRRPESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGN
UPPS_CHRVO      LTLFAFSTENWRRPQEEVSFLMDLFLRALEHEVAKLHNNNIRLKVLGSRERFSAELSERIDRAEAKTAGN
UPPS_VIBF1      ITLFAFSSENWRRPEEEVSVLMELFITVLSREVKRLHKNNIQLRIIGETSQFSSRLQKKIVEAETLTSEN
UPPS_VIBPA      MTLFAFSSENWRRPEEEVGLLMELFITVLSSEVKKLHKNNLQLRVIGDTSRFSERLQKKIVEAENLTASN
UPPS_PHOLL      LTLYAFSSENWNRPEQEVSSLMELFIFALDSEIKSLHKHNIRLSVIGDIGRFSERLQDRIHRSVKLTANN
UPPS_GLOVI      LTVYAFSTENWKRPQYEVEFLMALFEKVLNHELSEMVDEGVRIRFVGALAHLPGALQSAIEGAMAATEAN
UPPS_VIBCH      VTLFAFSSENWRRPEEEVGVLMELFMTVLSTEIKKLHKNNLRLRVIGDKSRFSERLQTKIAQAEQLTASN
UPPS_THEEB      LTAYAFSTENWGRPLPEVEFLMTLFEQVLRRELGEMVAEGVQIHFVGDLTCLPKSLQAEIERAVAATANN
UPPS_BUCAI      LTLYAFSSENWNRPLFEIKALMELFLFALDTEIKNLKKHNIRFKVIGDITCFDKKLQNSIHYAEQITFDN
UPPS2_ANASP     LTAYAFSTENWQRPIEEVDXXXXXXXXXXXXXXSQMHREGVRISFIGDLTALPKSLQTEMERSMTETLNN
UPPS_HAEDU      LTLYAFSSENWNRPATEVSALMSLFIQALNTEVSKLHKHNIRLNILGDKTRFSDSLQKRIIESETLTAHN
UPPS_PROMA      LTVYAFSTENWSRPKEEVNFLMTLFERVXXXXXXXXXXXXVQISFLGDLDQLPTRLQDLINEATELTSGN
UPPS_PHOPR      LTLFAFSSENWRRPEDEVSLLMELFMTVLTREVKRLHKNNIQLRIIGDKSGFSERLQRKIATSEALTANN
UPPS_TREDE      ITLYIFSTENWKRTEAEVGFLMGLIKQHLKAELKFYADNNIRIEHIGNLSGLPQDIQDEINSVRDKTSAY
UPPS_BRUME      LTLFAFSSENWTRPSGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAANIRALLNEAESLTHRN
UPPS_BRUAB      LTLFAFSSENWTRPSGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAANIRALLNEAESLTHRN
UPPS_BRUSU      LTLFAFSSENWTRPSGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAADIRALLNEAESLTHRN
UPPS_VIBVY      ITLFAFSSENWRRPEEEVGLLMELFITVLSSEVKKLHKNNLRLRIIGDTSRFSERLQKKIVEAQELTASN
UPPS_VIBVU      ITLFAFSSENWRRPEEEVGLLMELFITVLSSEVKKLHKNNLRLRIIGDTSRFSERLQKKIVEAQELTASN
UPPS_SHIFL      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
UPPS_ECOLI      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
UPPS_ECOL6      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
UPPS_ECO57      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
UPPS_RHIME      LTLFAFSSENWNRPENEVSDLMGLLKAFIRRDLADLHRENVRIRVIGDRSNLSGDILPLLIEAEETTIAN
UPPS_PROMM      LTAYAFSTENWSRPGDEVNFLMTLFERVLQRELESLEREKVRIRFLGDLEGLPSGLQELISEATELTVRN
UPPS_SALTY      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHN
UPPS_SALPA      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHN
UPPS_SALTI      LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHN
UPPS_SYNPX      LTAYAFSTENWSRPGDEVNFLMTLFERVLQKELRTLEEEQVRIRFLGDLDALPLKLQELIGDATERTAAN
UPPS_HAEIN      LTLYAFSSENWSRPEQEISALMSLFMQALDREVKKLHKNNICLKIIGDVSRFSETLQEKIKKAENLTEKN
UPPS_THEMA      LTAFSFSTENWKRPKEEVEFLMDLFVQMIDXXXXXXXXXXXXXXXXXXKEGLPEKVLKKWQEVEEKTKEF
UPPS_SHEON      LTLFAFSSENWRRPDKEVSLLMELFFTVLQREIKLLDKNQVKLNIIGDISRFSARLQKQIRAAEEKTAGN
UPPS_PSEPK      LTLFAFSSENWQRPAEEVGALMELFFSALRREAKRLDENNISLRIIGDRSRFHPELQAAMREAEAVTAGN
UPPS_PSESM      LTLFAFSSENWQRPAEEVGALMELFFTALRRETKRLNENDISLRIIGDRSRFHPELQAAMREAEVRTSGN
UPPS_COXBU      LTLFAFSIENRARPQSEVNFLMSLFLDSLKKNTEELHKNNVQLRVIGDHREFDKKMLAQIQTSQDLTKHN
UPPS_WIGBR      LTLYAFSSENWKRPIQEVSDLMELFSSVLNNAIDSFKKNNIRLKIIGDISKFNLKLQKYIKKSEKITYKN
UPPS_ERWCT      LTLYAFSSENWNRPAQEVSALMELFVRALDSEVKSLHKHNVRLRVIGDIGRFSPRLQERIRRSEVLTEKN
DDPS5_ARATH     ISLFAFSTENWERPEDEVKCLMALFEKYLASDMPYLRSDKIKISVIGNRTKLPESLLGLIEEVEEATKSY
UPPS_PYRFU      LTVYAFSTENFKRSKEEVDRLMKLFEEKFRELVTDVHEYGIRVNVMGRKELLPKNVRXXXXXXXRVTRKY
UPPS_YERPS      LTLYAFSSENWNRPDQEVTALMELFVRALDSEVKSLHKHNVRLSIIGDISRFSGRLQERIRRSEKLTANN
UPPS_YERPE      LTLYAFSSENWNRPDQEVTALMELFVRALDSEVKSLHKHNVRLSIIGDISRFSGRLQERIRRSEKLTANN
UPPS_RALSO      LTLFAFSSENWRRPAEEISFLMKLFMTALRREVSKLNDSGIRLRVVGDLSAFSPRIQLMIREAEAKTATN
UPPS_BORPE      LTLFAFSSENWRRPADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHN
UPPS_BORPA      LTLFAFSSENWRRPADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHN
UPPS_BORBR      LTLFAFSSENWRRPADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHN
UPPS_METJA      VTLYAFSTENFRRPKEEVDKLMELFEKKFYEIAEEIHRYEVRVRAIGRINLLPKNVQKAIKYAEERTKNY
UPPS_AQUPY      LTLFAFSTENWNRPKGEVEALFELLRRYLQTKKDKLYKLGIRVRFIGRRDRINKELVKLMQEIEEESKKF
UPPS_PYRAB      LTVYAFSTENFKRSKEEVERLMQLFEQKFRELVTDVHEYGVRVNVIGRKELLPKSVRDXXXXXXRATRKY
UPPS_NITEU      LTIFAFSSENWRRPAEEVKLLMQLFLAALEREVTGLHENGVRFRVIGDISKFDPKIVDFVQQGEALTAGN
UPPS_FUSNN      LTVYAFSTENWNRPQDEVSTLMKLFLKYIKNERKNMMKNKIRFFVSGRKNNVPXXXXXXXXXXXXXXXNN
UPPS_METTH      VTAYAFSTENFKRPEKEVKGLMKLFRENFEAIASKIHKNRVRVRAVGKLELLPEDVRRAIEIAEKSTEQY
UPPS_PORGI      LTAYTFSTENWNRPEEEVRALMGLFVTAIMNEMLDLMTNNIRLLAIGDFSRLPEDVRESLEKGIRETAGN
UPPS_PSEAE      LTLFAFSSENWQRPADEVSALMELFLVALRREVRKLDENGIRLRIIGDRTRFHPXXXXXXXXXXXXXXGN
UPPS_HELHP      LTLYAFSTENWKRPKIEVDFLMKLLEKYLHDEKPVYMKNHIRFRVIGDISVFNTRLKNAILELEHATQNH
UPSS_MYCBO      LSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSN
UPPS_ZYMMO      LTLYAFSSENWRRPASEVADLMGLLRLCLRQEMHNIKERGICLKVIGDYTRLDQDLVALLNQAIEITANN
UPPS_MYCTU      LSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSN
UPPS_LEGPA      LSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQVLQKQMYDAEALTRXX
UPPS_XYLFA      LTLFAFSSENWNRPADEVNFLMEMSIKLFGRGIEELHRRGVQVRFIGERKRFDIALVEHMTKAEHLTANN
UPPS2_STRAW     LSLYAFSTENWKRSPEEVRFLMNFNRDVIRRRRDEMDALGIRIRWVGRMPKLWKSVVQELQIAQEQTKDN
UPPS_LEGPL      LSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQVLQKQMSDAEALTKXX
UPPS2_TROW8     LSLYVFSTENWLRAPDEVRFLLRFTRDVIARRRELFAHWGVRVRWSGVPNRLGKVLVKELRDTEEITKKN
UPPS1_TROWT     LSLYVFSTENWLRAPDEVRFLLRFTRDVIARRRELFAHWGVRVRWSGVPNRLGKVLVKELRDTEEITKKN
UPPS_XYLFT      LTLFAFSSENWNRPADEVNFLMEMSIKLFGRGIEELHRRGVQVRFIGERKRFDIALVEHMTKAEHLTASN
UPPS_PYRHO      LTVYAFSTENFKRSKEEVDRLMKLFEEKFRELVTDVHEYGVRVNVIGRKELLPKSVRDAVEEAERATRKY
UPPS_LEGPH      LSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQILQKQMCDAEALTKXX
UPPS_FRATT      LTLFAFGRDNWLRPAQEVSDLMDLFYKTLKDKTPKLHDNNIVVTVVGDRSRLSNKLIGMIEYSESLTKSN
UPPS_CHLTR      LTLFAFSTENFSRSKSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHY
UPPS_RHOBA      LTLYCLSSENWKRPQAELDFLMHLLQQYLVEERRTIRDQNMRLRFIGRRDRLSDEVLKEIAKTQAVSENN
UPPS_PASMU      LTLYAFSSENWNRPKKEVNALMALFMQALDLEVXXXXXXXXXXXXXGDVTGFSASLQNKIHQAEKXXXXX
UPPS_MYCLE      LSLYAFSTENWKRSVEEVRFLMGFNRDVVRRRRENLKEMGVRIRWVGSRPRLWRSVINELAIAEHMTAGN
UPPS_MYCPF      LTVYAFSTENWKRSTEEVRFLMGFXXXXXXXXXXXLNDMGVRMRWVGSRPRMWSSVIKEFDIAEQMTVDN
UPPS1_STRCO     ISLYAFSTENWKRSPEEVRFLMNFNRDFIRKSRDTLDELGVRVRWAGRMPRLWKSVAKELQVAQEQTKDN
UPPS_AQUAE      LTLFAFSTENWNRPKEEVKALFELMENYIRSKREKLYSLGVRVRLIGRRDRLSRGLVNLMEELESDSKDF
UPPS_RHILO      LTVYAFSSENWSRPKAEVSDLMGLLKLFIRRDLAELHQSGVRVRIIGDRAGLQADIRGLLEEAESLTARN
DDPS3_ARATH     VSAFAFSTENWGRHKIEVKCLMSLIQHYLKSKIQYFQREETRVSVIGNLTKIPESLLRTVQEIEEATRSY
UPPS_XANAC      LTLFAFSSENWGRPQDEVDALMKLFLHALDREVEELQRRGVQVRFIGDRSRFAAPLRDRMAGAERSTAAN
UPPS_WOLSU      LTLYAFSTENWKRPKTEVDFLMRLLSDYLKKEAEVYLKNNIRFKAIGDLSRFSSRLLDEIETLTQKSASC
UPPS_BUCAP      LTLYVFSRENWRRPKLEITALMKLFFFALKSEIKNLNKYNIRLKIIGDTSPFNENLKNYIHKVEKQTFNN
DDPS4_ARATH     VSAFAFSTENWGRHKIEVKCLMYLFQRYLKSKIQFFQSKEIRVSVIGNLAKIPESLLRTVHELEEATKSY
UPPS_CAUCR      LTVFGFSTENWSRPPQEVSELMGLLKAYVESDLERLAKAXXXXXXXXXXTGLSPDIAEVIERAERRTAQN
DDPS1_ARATH     VSAFAFSTENWGRDKIEIDNLMSLIQHYRNSNIKFFHRSEVRVSVIGNKTKIPESLLKEIHEIEEATKGY
UPPS_XANOR      LTLFAFSSENWGRPQDEVDALMKLFLHALDREVGELQRRGVQVRFIGDRSRFAAPLRDRMAGAERSTAAN
UPPS_METKA      VTVYALSTENLNRPKEELKRLFDLMEERFKALAESIHRRKVAVRAVGRLHLLPTRVRRAIKKAERATKEY
UPPS_PICTO      VTVYAFSTENFKRKSDEVNFLFNLINDAFIDLLNDVYKNGIRVKVIGDISKLPDYLKETIKRVEGETNKF
UPPS_PYRKO      LTVYAFSTENFKRSKEEVEALMNLFEEKFKELVQDVHRYGIRVNVLGRKDMLPENVXXXXXXXXXXXXXY
UPPS_CHLPN      LTLYTFSTENFGRPKEEIQEIFNIFYTQLDKQLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASF
UPPS_HELPJ      LTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILRLENDTRYF
UPPS_CHLCV      LTLFAFSTENFLRSTEEVEELFSLFHSQLDEQFPYLIENKIRLRCIGNLSALPLQLQQKISEISLKTHQN
UPPS_HELPY      LTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLNNNIRFRAIGDLEGFSKELRDTILQLENDTRHF
UPPS_CHLMU      LTLFAFSTENFSRSKTEVAELFSLFNSQLHSKLSFLHDREIRLRCIGDLSKLPQELQNNIAKAVSATTHY
UPPS_LEPIN      ISLYAFSTENWKRPVTEIRSIFSLLIEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKN
UPPS_LEPIC      ISLYAFSTENWKRPVTEIRSIFSLLIEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKN
UPPS_THEAC      VTFYAFSTENFRRSPEEVDFLFHLIDNAFKSLLKDVYKNRINVKVIGNLSILPAYLRQTIHIVEETTKNF
DDPS2_ARATH     LTVFAFSTDNWIRPRIEIDFLFSLFERSLKTEFQNLAKNNVRISIIGDSSKLPKSLLRVINEVEEVTKNN
UPPS_ACIAD      LTVFAFSSENWNRPAFEVDLLMKLLEEAIHEQLPRMRKFNIALRFIGDRSKLSEHLTDLMTHAENETAHF
UPPS_CHLAB      LTLFAFSTENFLRSAEEVAELFSLFHAQLDEQLPYLIENKIRLRCIGNLLALPPDLQQQIAKVASETQRH
UPPS_THEVO      VTFYAFSTENFKRSPEEVDFLFHLINDAFISLLKDVYKNKINVKVIGNVSMLPEYLRXXXXXXXXXXXNF
UPPS_BUCBP      LTLYAFSSDNWNRSPREIKVLMELFFYALSNETNNLNKYNIRLKVIGNKEKFNTVLKNKIRVVEKETLKN
UPPS_THET8      VTVWVFSTDNFKRPPEEVETLMNLFLREAERMAEDILEHQVRVRFIGRREGFSPEVVRAIERLERRTEGH
UPPS_THET2      VTVWVFSTDNFKRPPEEVETLMNLFLREAERMAEDILEHQVRVRFIGRREGFSPEVVRAIERLERRTEGH
UPPS_RICFE      ITLYTFSSENWQRSSTEVDFLIKLLSIYFKNELNSLHKNGVKIKVIGRLNLLSSSLQKQINNAIELTKNN
UPPS_XANCP      LTLFAFSSENWGRPQDEVDALMKLFLHALDRGVEELQRRGVQVRFIGDRSRFTAPLRDRMAGAERITAAN
UPPS_RICTY      ITLYTFSSENWQRSSSEVNFLIKLLSLYLKNELDSLHENGVKIKVIGRLNLLRSSLQKQINNAIELTQNN
UPPS_RICPR      ITLYTFSFENWQRSSSEVDFLIKLLSIYLKNELDSLHENGVKIKVIGRLNLLRSSLQKQINNAIELTKNN
UPPS2_CORDI     LSAYAFSTENWRRSTDEVRFLMGFNRDVLRRQRDALNAKXXXXXXXXXXXXXXXSVIRELEAAEELTKDN
UPPS_RICCN      ITLYTFSSENWQRSSTEVDFLIKLLSIYLKTELNNLHKNGVKIKVIGRLTLLSSSLQKQINNAIELTKNN
UPPS_RICSI      ITLYTFSSENWQRSSTEVDFLIKLLSIYLKTELNNLHKNGVKIKVIGRLTLLSSSLQKQINNAIELTKNN
UPPS_RICBR      ITLYTFSSENWQRSNTEISFLMRLLNIYLKKELDNLHKNGIKIKVIGRLNLLSDSLQKQINNAIELTKDN
UPPS_ARCFU      LTLYAFSTENFRRSEKEKKNIFQLLESELRRLLKDTYERELRVKVVGKRELLPENLRETIKEVEERTKKH
UPPS2_BRAJA     LTIFSFSSENWSRPASEIGDLFGLLRRFIRNDLASLHRDGVKVRIIGERDGLESDICALLNEAEELTRDN
UPPS_TREPA      VTLYVFSTENWKRSAHEVHFLMNLIRWYLKKEMSFYVEHAIRVVHLGCAQTLPPDVRSQIEYVVERTRSH
UPPS1_BRAJA     LTLYAFSTDNWRRPKAEVAALMTLLRFYLANEVQSLVKNGVRLTVIGRRDRLPDGIXXXXXXXXXXXXHG
UPPS_METMA      LTLYAFSTENFQRSEEEVGGLFNLNEKFLKLHTDKTYEKEMQVRVIGDRTKLPAYLNESIDRIEKATEHH
UPPS_BLOFL      LTLYAFSSENWTRSNTEISSLMQLFIYALNSEXXXXXXXXXXXRIIGDVNRFTQELQDCIYRSEQLTSXX
UPPS_METAC      LTLYAFSTENFQRSEEEVDGLFNLILKLYND--KRTYEKETQIRVIGDRTKLPAFLNKSIEKIEKATETH
UPPS1_STRAW     VTLWLLSTDNFDRPQEELGPLLGIIEGVVRTLAAD---GRWRVHHVGTPDILPSQMQNALKEAEETTAHV
UPPS_BIFLO      LSLYTFSTENWKRSPQEVRFLMGFSREIIHRRVEQMDEWGVRVRWSGRRPKLWKSVIDELEAAEERTKNN
UPPS1_CORDI     VTVYLLSTENLGRASDELQMLFDI----IGDVVDELAETNCRLRLVGHLDLLPDDVSRRLTQAQDSTNDN
UPPS2_CORGL     LSAYAFSTENWRRSTDEVRFLMGFNRDVLRRQRDDLHEKXXXXXXXXXXXXXXXSVIRELETAEELTKDN
UPPS_HALMA      VTLYTFSTENFDRDPEEREHIFDLVEQKLRTFADRVHEAGVCIRAIGETEMLPERVRDAIDYAEGRTAQY
UPPS1_CORGL     VTVYLLSMENLGRSSEELQLLFDIIADVADELARP--ETNCRVRLVGHLDLLPDPVACRLRKAEEATVNN
UPPS_DEIRA      ATIWVLSTDNGSREPAELAHILSLLEREARQLAPRIHANRVRVRAIGQHDNFPPQVLAALNNLEESTAGY
UPPS1_COREF     XXXXXXSTENLGRDEAELQLLYDI----IGDVVAELSETNCRVRLVGHLDLLPKEFAERLRGTVCETVDH
DHDDS_MOUSE     VTVYAFSIENFKRSKSEVDGLLDLARQKFSCLMEELQKHGVCIRVXXXXXXXXXXXQEKIAHAIQATKNY
UPPS_PYRAE      VTFFALSTENLQRSKIELEILFRIEDELRRTLEDPLIDNKVRVRFIGDRSLLPGKVVKYIDELESVTKNY
DHDDS_HUMAN     VTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEELQKHGVCIRVXXXXXXXXXXXXXXIAQAVQATKNY
UPPS_CAMJR      LSLFAFSTENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHC
UPPS_CAMJE      LSLFAFSTENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHC
UPPS_SULAC      VTVFALSAENCKRTQQELSMIF----KYLKIGLDELLTSDVRVKAIGMLDKLPEDLKKLVVDLESTTEKY
UPPS_SULTO      ITVFALSTENC---DKRSNLELNTIFNYIKAGLEELLKYEVKVRAIGLIYKLPLDLLEVLNQLSKKTENF
UPPS_STRFR      VTVFVCSTENLRRGDTEVSFLMQVIEQVVAVHLARP-DARWQVRIAGTLDXCADSTAHALKEAVEATRRC
ZFPP_MYCBO      ATVYLLSTENLQRDPDELAALIEI----ITDVVEEICANHWSVRTVGDLGLIGEEPARRLRGAVESTPEV
UPPS_SULSO      ITVFVLSTENC---DKRKQNELSIITTYIKRGIQDLLEDEVKVSAIGKLDKLPKDLIDYLNRVVEKTSNY
UPPS_BORBU      LSFYVFSTENWRRDDCEIENLMFLIANYLRAEFDFYEKNGIKIIVSGDVESLSGEVXXXXXXXXXXXXXX
UPPS1_TROW8     VTLYLLSNDNLKNRNRQE--LNDLVQVICNLIAQ--VSKRWKVNHVGSCENLPELLGNSLEGVKSSTKTN
ZFPP_MYCTU      ATVYLLSTENLQRDPDELAALIEI----ITDVVEEICANHWSVRTVGDLGLIGEEPARRLRGAVESTPEV
UPPS2_TROWT     VTLYLLSNDNLKNRNRQE--LNDL-VQVICDLIAQ-VSKRWKVNHVGSCENLPELLGNSLEGVKSSTKTN
YE54_SCHPO      VSAFTFSIENFKRSKYEVDMLMEIAKNSLTTAHGDLVDQGIRIRIVGDLSRLQPDVLETALKAVEITKHN
UPPS_HALSA      LTLYAFSTENFERPPDQQQHLFDLLESKLREFADRVHADRVRIRAIGDTGRLPQRVRDAITYAESRTAGY
UPPS2_COREF     LSAYAFSTENWRRSTEEVRFLMGFNRDVLRRQRDGLHEKXXXXXXXXXXXXXXXSVIRELEAAEELTKDN
ZFPP_MYCLE      TTVYLLSTENLQRDPDELAALIEI----ITDVVEEICANRWSVRTVGDLELLGEEPACRLRGAVESTPGV
UPPS2_STRCO     VTLFMLSDDNLARPEEQLNPLIDI--------IAEVVENPWPVEAVGALDLLPAESASRLKTATAATQGR
DDPS6_ARATH     VTIYAFSIDNFRRKPEEVESVMDLMLEKIKSLLEKVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAKN
CRUP_STRCO      VTVYMFSTENWYRSQGEVAALFGAFADWFARGAQTVHELGVRVRWSGRRDRXXXXXXXXXXXXXXMTANN
SRT1_YEAST      VSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDG
DDPS8_ARATH     VTLYAFGMDNFKRGPEEVKCVMDLMLEKVELTIDQAVSNGVRIIFAGDLNSLNERFRAATKKLMELTEEN
RER2_YEAST      ATVFAFSIENFKRSSREVESLMTLARERIRQITERACKYGVRIKIIGXXXXXXXXXXEDVRVAVETTKNN
DDPS7_ARATH     VTLHAFGMDNFKRGPEEVKCVMDLMLEKVELAIDQAVSNGVRIIFAGDLDSLNEHFRAATKKLMELTEEN
UPPS_AERPE      VYLYVLSRDNCKRSRAELSILYRIMRRSIERDIAEIEKGGASLVIVGDINHLPDNIRESLAP--------
RER2_ENCCU      ISFFCFALSNFKRSPEEVNKLMGLVKQKIER--PKEIGIRPKFRVYGRLDLLEEDVRKRLMDIEEESKNN
NGBR_DANRE      ------------------------------------------------VEILKNGTNKQEH----QVLSC
UPPS_YEAST      LMLYDYDGILQRNPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYLDGIETETDVGNEIEANQEKDK
YNJ5_CAEEL      L------SANKMNDQIEVSQLMN---EITPESVPESLDNQKNANVVG--DLL-AKVQKVADDTIDKSK--


                         +         .         .         .         .         *         .:210
query           TGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERI
UPPS_LACPL      DGMVLNFALNYGSRAEIVTGVQKIAQQVQDGQLAVGDIDDATIDAALMTAPLAPYNDPDLLIRTSGEERI
UPPS_ENTFA      TGMVLNFALNYGARAELLTAMKQIAAEVSEKAYTADEITEETIADHLMTGFLTELRDPELLIRTSGEERI
UPPS_LACJO      TGMVLNFAFNYGSRREITAGVQEIARKVKVGEIDIDDISEKMVSDHLLTHSLAPYEDPDLLIRTSGEERL
UPPS_LISIN      TGLTLNFALNYGGRSEIITAAEAMKELVSEGKTS-EDLTEELLNDHLMSHGL---GDPDLLIRTSGELRL
UPPS_LACAC      TGLILNFAFNYGSRREITSAVKELGGMIESGSLKSEEITESMISDHLMTGNFGKYRDPDLLIRTSGEQRI
UPPS_BACAN      TGLILNFALNYGSRDEIVSAVQHMMKDSEEGKVRVEDVSEEMLSSYLMTSSLP---DPELLIRTSGELRI
UPPS_LISMF      TGLTLNFALNYGGRSEIITXXXXXXXXXXXXGKSADDLTEEKLNDHLMSSGL---GDPDLLIRTSGELRL
UPPS_BACHK      TGLILNFALNYGSRDEIVSAVQHMMKDSEEGKVRVEDVSEEMLSSYLMTSSLP---DPELLIRTSGELRI
UPPS_LISMO      TGLTLNFALNYGGRSEIITXXXXXXXXXXXXGKSADDLTEEKLNDHLMSSGL---GDPDLLIRTSGELRL
UPPS_BACC1      TGLILNFALNYGSRDEIVSAVQHMMKDREEGKVRVEDVSEEMLSSYLMTSSLP---DPELLIRTSGELRI
UPPS_BACCR      TGLILNFALNYGSRDEIVSAVQHMMKDNEEGKIRSEEVSEEMLSSYLMTSSLP---DPELLIRTSGELRI
UPPS_GEOKA      TGLVLNFALNYGSRAEIAAAVKQIAKDVERGMLAPEDITEPLISSYLMTSGLA---DPDLLIRTSGEIRL
UPPS_STAS1      TGLKLIFAINYGGRAEILNSVKTIYDELTAKGLTSDDITEQMIDDHLMT---HAYPDPDLLIRTSGEQRI
UPPS_STAAW      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_STAAS      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_STAAR      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_STAAC      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_STAAN      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_STAAM      TGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMT---KDYPDPELLIRTSGEQRI
UPPS_BACSU      DGMILNFALNYGGRTEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESL---QDPELLIRTSGEIRL
UPPS_STRT2      SGLILNFALNYGGRAEIVSAVQAIAKEVEIGRLRPEAIDEDLIAKHLMTDKLPLYRDPDLIIRTSGELRL
UPPS_STRT1      SGLILNFALNYGGRAEIVSAVQAIAKEVEIGRLRPEAIDEDLIAKHLMTDKLPLYRDPDLIIRTSGELRL
UPPS_MICLU      TGLTLVFALNYGGRKEIISAVQLIAERYKSGEISLDEISETHFNEYLFTANMP---DPELLIRTSGEERL
UPPS_STAHJ      TGLKLIFAINYGGRAEIVQSMKSIYDELQRNGQDSKDIDESMINKHLMTHS---YPDPELLIRTSGEQRI
UPPS_BACSK      TGLILNFALNYGSRFELTSAMQQIAKKVQQGELMPEHITEETISAHLMSNHL---RDPDLLIRTSGELRL
UPPS_BACHD      TGLILNFALNYGSRYEMVEAMKQVAKEVETGTLSSDAITEDVISRHLMTADL---RDPDLLIRTSGEIRL
UPPS_STRA5      SGLVLNFALNYGGRSEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPLYRDPDLIIRTSGELRL
UPPS_STRA3      SGLVLNFALNYGGRSEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPLYRDPDLIIRTSGELRL
UPPS_STAES      TGLTLVFAINYGGRAEIIQSMKAIYNELQLNGQGSEVIDEALIKRHLMTHS---YPDPDLLIRTSGEQRI
UPPS_STAEQ      TGLTLVFAINYGGRAEIIQSMKAIYNELQLNGQGSEVIDEALIKRHLMTHS---YPDPDLLIRTSGEQRI
UPPS_STRR6      TGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHLKDLRDPDLIIRTSGELRL
UPPS_STRPN      TGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHLKDLRDPDLIIRTSGELRL
UPPS_STRP8      TGLILNFALNYGGRAEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPLYRDPDLIIRTSGELRL
UPPS_STRP6      TGLILNFALNYGGRAEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPLYRDPDLIIRTSGELRL
UPPS_STRP1      TGLILNFALNYGGRAEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPLYRDPDLIIRTSGELRL
UPPS_CLOPE      TGVVLSLALNYGGRNEIVRGIKSVIEDVKAGKISIDDINEDMFNDYLYTKGMP---DPDLIIRPSGEQRL
UPPS_STRP3      TGLILNFALNYGGRAEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPLYRDPDLIIRTSGELRL
UPPS_OCEIH      DGLVLNFALNYGSRYEIIHAVKQIVQKTKASELDVEQLDESYFEKHLFTNGL---SDPDLLIRTGGEYRL
UPPS_STRMU      SGLILNFALNYGGRAEIVDAVKLIAQDVLDARFNPGDITEGLIADYLMTSNLPLYRDPDLIIRTSGELRL
UPPS_THETN      TGLVVNIALNYGGRDEIVKATQNICKKVLNRELSPEDITEDTITQHLYT---ASQPDPDLIIRTSGEKRL
UPPS_CLOTE      TGLVLNLALNYGGRDEIIRAIKLMYKDIEKKGLDIENVNEDLLKNYLYTKGMP---DPDLIIRPSGEQRI
UPPS_LACLA      DGMILNFAMNYGGRRDIILAIQELA----KSGQDLSLLTEEELSKHLQTAVLSELRDPDLIIRTSGEQRM
UPPS1_ANASP     RGIRFSVATNYGGRQEILQACRAIAQKVQQGLLQPDEINEEVFERHLYT---AGISDPDLLIRTSGEMRL
UPPS_ANAVT      RGIRFSVATNYGGRQEILQACRAIAQKVQQGLLQPDEIDEEVFERHLYTAGIA---DPDLLIRTSGEMRL
UPPS_CLOAB      TGLMLNLALNYGGRDEILNAVKNIFASYEENKIEIFNLSDEEFSSYLYTGCIP---DPDIIIRPSGEKRL
UPPS_HELMO      TRLVLNVALNYGGRFEIVEAVKSIARLAAEGKVNPDQIDEKYMSQYLYT---ADVPDPDLLIRPSGELRL
UPPS_NEIG1      TGLTLSIAADYGGRWDILQAANKIAEGVSE-------ITEDTLAKHLMLGD-AP--EPDLFIRTGGETRI
UPPS_GEOSL      TGMILTLALSYGARQEIMTAATRIASDIASGVLKADDLSETAFASYLFTSGLP---DPDFLIRTSGEMRI
UPPS_PROMP      KKFTLNICVNYGGRQEIVKAAKEIAIKSSSGKIKPSDIDEQLFNSELLTGSM----DPELLIRTSGEKRI
UPPS_BACTN      TGTCLVLALSYSSRWEMTEAVRQIATLAKTGEISPEQITDEYITAHLTTNFMP---DPDLLIRTGGEIRL
UPPS_SYNY3      TGIRFTVATNYGGRQEIVHVCQAIAREVQSGKLDPETIDEGVVEKYLYTEGL---SHPDLLIRTSGELRI
UPPS_CHLTE      RGMAMTIALSYSGKWDITQACRHIALQVKQGLLDPETIDENLFASYLSTASMP---DPDLLIRTSGEYRI
UPPS_NEIMA      TGLTLSIAADYGGRWDILQAANKIAEGVSE-------ITEDTLAKYLMLGD-AP--EPDLFIRTGGETRI
UPPS_NEIMB      TGLTLSIAADYGGRWDILQAANKIAEGVSE-------ITEDTLAKHLMLGD-AP--EPDLFIRTGGETRI
UPPS_AGRT5      TKLTLVIAFNYGSRDEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMP---DPDLIIRTSGEERL
UPPS_CHRVO      DGLVLTIAADYGGRWDIVHAVNRL---IAEGRSE---ITEEMVTDRL---GMAWAPEPDLFIRTGGEQRI
UPPS_VIBF1      TGLVLNVAANYGGKWDITQAVRRLAYQVERGNLQADDIDEDLIASKLTMSDLP---EVDLMIRTSGECRI
UPPS_VIBPA      TGMVINIAANYGGKWDITEAAKALALKARNGEIRVEDINEQLITEHL---TMADLPEVDLLIRTSGECRI
UPPS_PHOLL      TGLQLNIAANYGGRWDIVQSVQKIAQQIKDNSLEQQDITEELVN-NYM--NLSQQPQVDLVIRTGGEHRI
UPPS_GLOVI      TAVEFTVATNYGGRQEIVNACRELAEQVRSGRLLPEQIDEKLFAQHLYTREL---SDPDLLIRTSGEQRL
UPPS_VIBCH      TGMVVNIAANYGGQWDILQATQALAEKVTQGELQPSDIDEDVFKQHL---TMADLPDVDLLIRTSGECRI
UPPS_THEEB      QKIKFVVATNYGGRREIIHACRSIAAQVKAGLLDPADIDEVLFERHLYTGGLP---DPDLLIRTSGELRI
UPPS_BUCAI      TGLILNIAANYGGRWDIIESVKKIINRVQRGILDVNKIHENTISQYLSTSELLPV---DLVIRTGGEKRI
UPPS2_ANASP     QAIHFTVAVNYGSRNEITRACRQVAELVQQGKLSADAVNEGIVEQHLYTTDTQP---PDLLIRTSGEMRL
UPPS_HAEDU      TRLTLNIAANYGSHWDITEATKKLAEKVKLGKISVTDITPEKVQRALVTAEQPPV---DLLIRTSGEQRI
UPPS_PROMA      NGIRFNVCTNYGGRRELVLAAQKLAQRVLQGDLDPSFIDEHTFAGELLT---SSYADPDLLIRTSGEMRI
UPPS_PHOPR      TGLVLNIAANYGGQWDILQATKKLAVQIAEQGLTASDITEDMLSAGMSTADLP---DVDLMIRTSGECRI
UPPS_TREDE      TGTAIVLGINYGAHDEILRAIKKL------NSDELASINEESFSLKLDTGKIPPV---DLLIRTGGEKRL
UPPS_BRUME      TGLNLVIAFNYGSRDEIVRAVRSLARDVAAGLLDPSSISAELVSANLDT---AGIPDPDLIIRTSGEMRL
UPPS_BRUAB      TGLNLVIAFNYGSRDEIVRAVRSLARDVAAGLLDPSSISAELVSANLDT---AGIPDPDLIIRTSGEMRL
UPPS_BRUSU      TGLNLVIAFNYGSRDEIVRAVRSLARDVAAGLLDPSSISAELVSANLDT---AGIPDPDLIIRTSGEMRL
UPPS_VIBVY      TGMVINVAANYGGKWDITXXXXXXXXXXXLGDLSAEDITEDDIAKHLTMSDLP---EVDLLIRTSGECRI
UPPS_VIBVU      TGMVINVAANYGGKWDITXXXXXXXXXXXLGDLSAEDITEDDIAKHLTMSDLP---EVDLLIRTSGECRI
UPPS_SHIFL      TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPV---DLVIRTGGEHRI
UPPS_ECOLI      TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPV---DLVIRTGGEHRI
UPPS_ECOL6      TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPV---DLVIRTGGEHRI
UPPS_ECO57      TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPV---DLVIRTGGEHRI
UPPS_RHIME      TGITVVIAFNYGARDELARAMRRLAGEVAAGRLRPEEITAERISSTIDT---AGIPDPDLIIRTSGEERL
UPPS_PROMM      NGIHFNVCTNYGGRRELVXXXXXXXXXXXXGDLDPTLIDENSFEAELLT---AGEVDPDLLIRTSGERRI
UPPS_SALTY      TGLTLNIAANYGGRWDIVQGVRQLAEQVQAGVLRPDQIDEERLGQQICMHELAPV---DLVIRTGGEHRI
UPPS_SALPA      TGLTLNIAANYGGRWDIVQGVRQLAEQVQAGVLRPDQIDEERLGQQICMHELAPV---DLVIRTGGEHRI
UPPS_SALTI      TGLTLNIAANYGGRWDIVQGVRQLAELVQAGVLRPDQIDEERLGQQICMHELAPV---DLVIRTGGEHRI
UPPS_SYNPX      DGIHFNVCTNYGGXXXXXXXXXXXXXXXXNGDLMPEDIDENSLAAELFT---AGEQDPDLLIRTSGEHRI
UPPS_HAEIN      TALTLNIAANYGGCWDIIQAAKQIAEKVKKEEMSVSDINNSTFQHHLATQNAPPV---DLLIRTSGEQRI
UPPS_THEMA      DRMTLIIAFNYGGRREILDAVEFILKDVSHGK-KIE-LTEETFRQYLY---LPDVPDPDLIIRTSGEMRL
UPPS_SHEON      SGLILNVAANYGGRWDILQAAQKLAEKVETGEMTSSQFTEEALSEHLC---MQNQSEVDLIIRTGGDYRI
UPPS_PSEPK      NRFILQIAANYGGQWDIAQAAQRLAREVQAGHLRPEDITPGLLQTCLATGDLPL---PDLCIRTGGEHRI
UPPS_PSESM      SRFVLQIAANYGGQWDIAQAAQRLAREVQAGHLQPEDITPQLLQTCLATGDLPL---PDLCIRTGGEHRI
UPPS_COXBU      TGLKLIIALNYSGRWDILQAVQRMAEKIKNQELTSELMSAELFQNYLC---LSDLPEPDLLIRTSGEQRL
UPPS_WIGBR      NGLNLNIAANYGGRWDIIQGVKKIAKQVKKGIIYPDQINESNFCRFICMNELVPV---DLVIRTGGEHRI
UPPS_ERWCT      QGLTLNIAANYGGRWDIIQGVRQLAEQVQEGILRPDSINEASLCQYICLNDLAPV---DLVIRTGGEHRI
DDPS5_ARATH     EGKNLIIAIDYSGRYDILQACKSLANKVKDGLIQVEDINEKAMEKELLT-KCSEFPNPDLLIRTSGEQRI
UPPS_PYRFU      NNYFLNIALAYGGRSEIVDAIKDIVNDVLEGRLKLEDINEEIVRKYLYVPNMP---DPDIVIRTGGEVRI
UPPS_YERPS      DGLKLNIAANYGGRWDIIQGVRHLAEQVQKGELQPTDISEESLNSYIC---LHEQSQVDLVIRTGGEHRI
UPPS_YERPE      DGLKLNIAANYGGRWDIIQGVRHLAEQVQKGELQPTDISEESLNSYIC---LHEQSQVDLVIRTGGEHRI
UPPS_RALSO      PGLTVTIAANYGGRWDILQAMRALVA--DQPDIAPEAITEEALSPYM---ALAYASEPDLFIRTGGEQRI
UPPS_BORPE      DRLHLTVAANYGGRWDILQATRAMLRADPGLAQDPDRIDEARLAEHL---SMAWAPEPDLFIRTGGEQRI
UPPS_BORPA      DRLHLTVAANYGGRWDILQATRAMLRADPGLAQDPDRIDEARLAEHL---SMAWAPEPDLFIRTGGEQRI
UPPS_BORBR      DRLHLTVAANYGGRWDILQATRAMLRADPGLAQDPDRIDEARLAEHL---SMAWAPEPDLFIRTGGEQRI
UPPS_METJA      NKFFVNIAIAYGGQQEIIDAVKKIAEKVKRGEIEPEDIDKELIDKHLYTANL-PFPNPDLIIRTSGEERI
UPPS_AQUPY      KNLFLNLAVDYGGRDDILRAVKKAV------KLQREEITE---EXXXXXXXXXXXXXXXXXIRTAGEKRI
UPPS_PYRAB      NNYVLNVAIAYGGRSEIVDAVKDIVRDVMDGKLRVEDIDEELLKKYLYVPNMP---DPDIVIRTGGEVRI
UPPS_NITEU      SRLNFTVAANYGGRWDIMQAVRKM---ITENPDSAVTFDEPDIARHL---ALADAPEPDLFIRTGGECRI
UPPS_FUSNN      DKITLNIAFNYGSRAEIVDAVNRIIKDGKEN------ITEEDFSKYLYN----DFPDPDLVIRTSGEMRI
UPPS_METTH      SDRLVNIAIGYDGRQEIVDATRKIAEDVKAGLIDPEDIDEDMINRNLYTAGL---EDPHLIIRTSGEERL
UPPS_PORGI      TGLTLVLALSYSSRWEMTDVIRRLARKVRDGSVEPEDINVDLVSDHLSTAGIP---DPDLFIRTGGEKRI
UPPS_PSEAE      TRFLLQVAANYGGQWDIVQAAQRLAREVQGGHLAADDISAELLQGCLVTGDQPL---PDLCIRTGGEHRI
UPPS_HELHP      TKLTQILALNYGSRDEIARTFIKLAHTLTPHTLASLSSQDSMINANLDTATLP---DVDMLIRTGGEKRI
UPSS_MYCBO      DVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIP---DVDLFLRTSGEQRS
UPPS_ZYMMO      TRLTLVFALNYGAQDELVHVTKRIAEKAKEGQLDPENIDVGTIESLLYTHDLPPL---DLVIRTSGEKRL
UPPS_MYCTU      DVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIP---DVDLFLRTSGEQRS
UPPS_LEGPA      XXXXXXXXXXYGGKWDIVTAAKKLIHSVLDGKLACDEINEAVFAQFLDTSGMP---EPDLFIRTSGELRI
UPPS_XYLFA      QRLILSLAVSYGGRQDITMAARALAQDVAAGRLKPEQIDEDLLGQHMALADLPP---PDMFIRTSGVIRI
UPPS2_STRAW     DAMTLYFCVNYGGRXXXXXXXXXXXXXXXXGRLDPAKVSEKTIQKYLYYPDMP---DVDLFLRPSGEQRT
UPPS_LEGPL      XXXXXXXXXXYGGKWDIVTAARKLIRTVLDGKLAYDEINEAVF-AQFLDTKGMP--EPDLFIRTSGELRI
UPPS2_TROW8     TAMNLNVCLNYGSRQEIVNAIKSIVSDVNSGLISAKSVNEKIISRRMY---MPDFPDVDLFLRSSGENRM
UPPS1_TROWT     TAMNLNVCLNYGSRQEIVNAIKSIVSDVNSGLISAKSVNEKIISRRMY---MPDFPDVDLFLRSSGENRM
UPPS_XYLFT      QRLILSLAVSYGGRQDITMAARALAQDVAAGRLKPEQIDEDLLGQHMALADLPP---PDMFIRTSGVIRI
UPPS_PYRHO      NNYILNVALAYGGRSEIVDAVKDIARDVISGKXXXXXXXXXXXXXXXXVPNMP---DPDIVIRTGGEVRI
UPPS_LEGPH      XXXXXXXXXXYGGKWDIVTAARKLIRTVLDGKLAYDEINEAVFAQFLDTNGMP---EPDLFIRTSGELRI
UPPS_FRATT      TGLKLRLAVDYAGRWDIVEATRAIAREVDIGKLSVDEIDQNSFAKYLVGGNM----PVDLLIRTSGEVRL
UPPS_CHLTR      SRMELIFAINYGSKDELVRAFKELHQDLASKKISVNDISEELISSYLDTSGLP---DPDLLIRTGGEMRV
UPPS_RHOBA      TGTELVLAVDYGGRDELTRMTRQLAQQVRDGERSIDEITESLVDESLDTAGLP---DVDLMIRTGGDIRI
UPPS_PASMU      XXXXXXXXXXYGGCWDIVQATKSLAQQVKEGKLAVDEINAQVLQQALVT-KEQP--QVDLLIRTSGEQRI
UPPS_MYCLE      DVITINYCVNYGGRTEIAEATREIARLAAAGRLNPERITESTITRHLQRPDIP---DVDLFVRTSGEQRS
UPPS_MYCPF      DVITINYCVNYGGRTEIVEAARELAQEAVDGKIKPNRISEAQFAKHLHRSDIP---DVDLFIRTSGEQRA
UPPS1_STRCO     DRLTLYFCMNYGGXXXXXXXXXXXXXXXXXGKLDPAKVNEKTLAKYLYYPDMP---DVDLFLRPSGEQRT
UPPS_AQUAE      KNLFLNVAIDYGGRDDILRAVKKI-MEVQPSKLDEETFSQ--------FXXXXXXXXXXXXIRTAGEKRI
UPPS_RHILO      ESLTLVIAFNYGGRDEIVRTARKLASAAARGEIDAESITADSFAGGLDTQGIP---DPELVIRTSGELRL
DDPS3_ARATH     KKKHLILAIDYSGRLDILRACKSIVKKSEKGLIREEDVDEALIERELLT-NCTEFPSPDLLIRTSGEQRI
UPPS_XANAC      SRLVLSIAASYGGRQDIASAARALAEDVAAGRLQPEQIDEALLSSRV---ALADLPAPDLFIRTGGDTRI
UPPS_WOLSU      SGLTQVLALNYGSKDEIIRATQKMIEEVSEENL-----------SRFLDTAFAP--DVDMLVRTGGDYRL
UPPS_BUCAP      TGLILNIAANYSGRWDXXXXXXXXXXXXXXXXXXXXXXXERNFSQYLSTSELLPV---DLVIRTGGEKRI
DDPS4_ARATH     KKKHLILAIDYSGRFDILGACKNIVKKSEQGLIREEDVDETLFERELQT-RCTEFPSPDLLIRTSGEQRI
UPPS_CAUCR      SEFVLQVAFNYGGQADITDAARAFAERVERGEAKASDLNEKTFEQFLSTASAPP---PDLIVRTSGERRI
DDPS1_ARATH     KNKHLIMAVDYSGKFDIMHACKSLVKKSEKGLIREEDVDEALIERELLTN-CSDFPSPDLMIRTSGEQRI
UPPS_XANOR      ARLVLSIAASYGGRQDIATAARALAEDVAAGRLQPEQIDEALLSSRV---ALADLPAPDLFIRTGGDTRI
UPPS_METKA      KDRFLNVAVAYGGRQEIIDAVREIAHDVKVGRLDPDEIDEGTFRKYVYVGDLP---DPELIIRTSGEERL
UPPS_PICTO      KNFRFNLAIGYGGRQEIIDAIKKIGQDILNGKIKVDNINEEMFRSYLYDKTLP---DPDLILRTSGEERI
UPPS_PYRKO      SNYNLNIALAYGGRSEIADAVREIVRDVLEGKIKPEDIDEEAIKRYLYYPNMP---DPDIVIRTGGEVRI
UPPS_CHLPN      SRLELVLAVNYGGKDELVRAFKKLHVDILNKKIXXXXXXXXXXXXXXXTSGL---TDPDLLIRTGGEMRV
UPPS_HELPJ      KDFTQVLALNYGSKNELSRAFKSLLENPPNHINNIESL-ENEISHRLDTHDLP---EVDLLLRTGGEMRL
UPPS_CHLCV      SHRDLVLAINYGGKDELVRAFKKLHQDLVEQKISSDSISEELIRLYLDTSEMP---DPDLLIRTGGEMRV
UPPS_HELPY      KDFTQVLALNYGSKNELSRAFKSLLESPPSHINLLESL-ENEISNRLDTHDLP---EVDLLLRTGGEMRL
UPPS_CHLMU      SHMELIFAINYGSKNELVRAFKELHQDLTNKKXXXXXXXXXXXXXYLDTSGLP---DPDLLIRTGGEMRV
UPPS_LEPIN      KNLTVNFCLNYGSRDELLRAAQELFLERKRSKVAXXXXXXXXXXXXXXYTSILP--PVDLLIRTAGEQRL
UPPS_LEPIC      KNLTVNFCLNYGSRDELLRAAQELFLERKRSKVAXXXXXXXXXXXXXXYTSILP--PVDLLIRTAGEQRL
UPPS_THEAC      NNYQLNLAIGYGGREEILDAIKRITRDAMDGKLNIDELDEEKFRMYLYDGRIP---DPDLILRTSGEERI
DDPS2_ARATH     TRLQLIVAVGYSGKYDVLQACRGIARRVKDGXXXXXXXXXXXXXXXXXT-NCTEFPYPDLLIRTSGELRV
UPPS_ACIAD      TSMTLTIAISYGGMWDITDAAKQIAKDVSDGIVDIEQIDTHLFGRYVSLNQLPPV---DLLIRTGGDYRL
UPPS_CHLAB      GMRELVLAINYGGKDELVRAFKKLHHDLVNKKISLDSVSEELIRLYLDTSEIP---DPDLLIRTGGEMRV
UPPS_THEVO      SNYHMNLAIGYGGREEILXXXXXXXXXXXXXXXNVDEIDESKFRNYLYDGNLP---DPDLILRTSGEERI
UPPS_BUCBP      TGLLLNIAANYSGRWEILEXXXXXXXXXXCKNLSLNAITESTVSDFLLINEKIPV---DLVIRTGGECRL
UPPS_THET8      RGMFLNIAMGYGGREEIVDAVKRLLLEAEARGLSPKEVAEGLTPEDIARHLYAGLPDPDFIIRTSGEIRL
UPPS_THET2      RGMFLNIALGYGGREEIVDAVKRLLLEAEARGLSPKEVAEGLTPEDIARHLYAGLPDPDFIIRTSGEIRL
UPPS_RICFE      NKITLCIAFSYGSRQEIVDACTKI---IASGKKEISEIGHALYDPEM--------PDVDLLIRPGGVYRI
UPPS_XANCP      TRLVLSIAASYGGRQDIXXXXXXXXXXXXXXXXQPEQIDEALLASRV---ALADLPAPDLFIRTGGDTRI
UPPS_RICTY      NKIKLCIAFSYGSRQEIVDACTKIIAQVSENDIQ-----HALYDPEM--------PDVDLLIRSGGVYRI
UPPS_RICPR      NKIKLCIAFSYGSRQEIVDACTKIIAHGKKQVSEYD-IQHALYDPEM--------PDVDLLIRSGGVYRI
UPPS2_CORDI     TTMTLAMCVNYGGRAEIVDAAREIARRSAVGTLRPEEITEDSFTQFLDEPDMP---DVDLFLRPSGEKRT
UPPS_RICCN      NKITLCIAFSYGSRQEIVDACTKI----------ITSGKKAVSDSDIQHALYDPMPDVDLLIRPGGVYRI
UPPS_RICSI      NKITLCIAFSYGSRQEIVDACTKI----------ITSGKKAVSDSDIQHALYDPMPDVDLLIRPGGVYRI
UPPS_RICBR      NKLTLCIAFSYGSRQEITDACTKI---IASGKTEI-------LESDIQNALYDPMPDVDLLIRPGGVFRI
UPPS_ARCFU      RRHYLNVAVAYGGRQEIIDAVRAILRKVRKGEVRPEEIDEKMLEEHLYGE--GRYSKVDLIIRTGGEQRL
UPPS2_BRAJA     SRLTLVVAFNYGSRQEIAKAAQKLAREVAEGRRDPATIDAETLGAHL---DAXXXXXXXXXXRTSGEQRL
UPPS_TREPA      RGTTVALAINYGGKDEILRAVKKVLCSTSCPDGEL--LTEEAFGACLDAPQLP---SVDFLIRTGGQQRM
UPPS1_BRAJA     STLHLRIAVDY--------SXXXXXXXXXXXXXXLTSLTREAF-SQLVTGE-AGLRDVDLIIRTSGEKRL
UPPS_METMA      RKFSLNVAIAYGGRQDIMQAVRDIATCVSSGKLSLEDVNESLISKHLYPAPGVPVPNVDLIIRTGGDERI
UPPS_BLOFL      XXXXXXXXXXXXXRWDIVQGVKKIIAQIQKGVLKPNQINENILCKYVCMNELSPV---DLVIRTGGEHRI
UPPS_METAC      RKFNLNVAIAYGGRQDIMQAVRDIAACVSSGKLSLEDVDENLISKHLYPAPGVSVPNVDLIVRTGGDERV
UPPS1_STRAW     DGILVNVAIGYGGRQEIADAVRSMLLDAHEKGTSIPDLADAVIGKHLYTGAQP---DPDLVIRTSGEQRL
UPPS_BIFLO      KVIDVVFCINYGGXXXXXXXXXXXXXXVRDGKISGDRVTEKMIADHLYNPDIP---DCDLVIRTSGEQRT
UPPS1_CORDI     TGVFVNVAVGYGGRQEIVDAVRELIDXXXXXXXXXXXXXXKIVDSISKHLYTSGQPDPDLVIRTSGEQRL
UPPS2_CORGL     TTMTLAMCVNYGGXXXXXXXXXXXXXXXXXGKLRPEQITEKTF-PNFLDEPDMP--DVDLFLRPSGEKRT
UPPS_HALMA      DQLNLNIALAYGGRAELLGAARDVAAAVENETLDPTDVSAETIEERLYEG---PTRDVDLIVRTGGDERT
UPPS1_CORGL     TGIAVNMAVGYGGRQEIVDAVQKLLTIGKDEGLSVDELIESVVDAISTHLYTSGQPDPDLVIRTSGEQRL
UPPS_DEIRA      EGMRLNIAVGYGGREEIVDAVQSYAAQGATLEQAAENLTPDAIGAHLYA---ADQPDPDFIIRTSGEIRL
UPPS1_COREF     TGVAVNIAVGYGGRQEIVDAVRDLLTSARDEGKTLDEVIESV-DAQAISTHLSGQPDPDLVIRTSGEQRL
DHDDS_MOUSE     NKCFLNVCFAYTSRHEIANAVREMAWGVEQGLLEPSDVSESLLDKCLYSNH-SPH--PDILIRTSGEVRL
UPPS_PYRAE      SNYHLTIALGYGGRAEIVRCIKRVLS----GEVRLETFSEEELFQCLDTRGI-PNPEPDVVVRTGGEKRL
DHDDS_HUMAN     NKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNR-SPH--PDILIRTSGEVRL
UPPS_CAMJR      DALCVNLAISYGARDEIIRAAKRV---IXXXXXXXXXXXTQNLDLPL---------DVDLMLRVGNAKRL
UPPS_CAMJE      DALCVNLAISYGARDEIIRAAKRV---IXXXXXXXXXXXTQNLDLPL---------DVDLMLRVGNAKRL
UPPS_SULAC      NKKKLILAICYGGRQEILDAIRKIMNDYKLGIIDSKSIDESTFRKYLYDQELS---DIDLLIRSSGEIRI
UPPS_SULTO      NKRKLTLAICYGGRQEIIDATKKIIADYEKGKIKLDDINENIFRQYLYDKEL---EDIDLVIRSSGEIRI
UPPS_STRFR      TGSQVTLAIGYGGRQEVIDAVRELLHEQAAAGTTLEDLAASLITRHLYT---AGQPDPDLVIRTSGEQRM
ZFPP_MYCBO      ASFHVNVAVGYGGRREIVDAVRALLSKELANGATAEELVDAVISENLYT---SGQPDPDLVIRTSGEQRL
UPPS_SULSO      DKRKLTLAICYGGRQEILDAVVRLLDDYRNGKIVKSEINEETFRKYFYDSEL---QDIDLVIRTSGEVRI
UPPS_BORBU      XXXXXXXXXXYGGRNEILRAVKKFVS----SDFDLESLNENIFSS---FXXXXXXXXXXXXIRTGGNIRI
UPPS1_TROW8     RSMTVNLAIGYSGRAEITEAVRKIVNTYPIGDLP-EKITEEVISANLYTGGLS---DPDLIIRTSGEQRL
ZFPP_MYCTU      ASFHVNVAVGYGGRREIVDAVRALLSKELANGATAEELVDAVISENLYT---SGQPDPDLVIRTSGEQRL
UPPS2_TROWT     RSMTVNLAIGYSGRAEITEAVRKIVNTYPIGDLP-EKITEEVISANLYTGGLS---DPDLIIRTSGEQRL
YE54_SCHPO      TKATLNVCFPYTSRHEIATSVQSIVKMAEDGTITPEDIDEDIFEKN---XXXXXXXXXXXXXRTSGVERL
UPPS_HALSA      DGFTLNVALAYGGRDELLTXXXXXXXXXXXXXXXXXXIDAQAIESRLHT---SPVRDVDLIIRTGGDERT
UPPS2_COREF     TNMTLAMCVNYGXXXXXXXXXXXXXXXXXXXXLRPEQINEKTFPDFLDEPDMP---DVDLFLRPSGEKRT
ZFPP_MYCLE      APFHVNVAVGYGGRREIVGAVRALLGKELANGXXXXXXXXXXIARNLYT---SGQPDPDLVIRTSGEQRL
UPPS2_STRCO     KGGTVDVAVGYGGRREIVDAVRSALTEHSSQGGDIDEFIETFTMEHISKHLYSKTSESDLIIRTSGEQRL
DDPS6_ARATH     SRVVLLICIAYNSTDEIVQAVKKSCINKSDN-IEASNYKHEDSDSDIMQMSVAP--NPDILIRSSGETRL
CRUP_STRCO      DKLTLTICLDYGGXXXXXXXXXXXXXXXVAGTIRPEQIGMAEVARHLYVPEMP---DVDLLVRTC-EQRI
SRT1_YEAST      DDFTLFICFPYTSRNDMLHTIRDSVEDHLENKINIRKFTNKMYMG-------FHSNKCELLIRTSGHRRL
DDPS8_ARATH     RDLIVVVCVAYSTSVEIVHAVRDSCVRKSKSALELSDIEE------CMYTSVVPV--PDLVVRTGGGDRL
RER2_YEAST      KRATLNICFPYTGREEILHAMKETIVQHKKG----AAIDESTLESHLYTAGVPPL---DLLIRTSGVSRL
DDPS7_ARATH     RDLIVVVCVAYSTSLEIVHAVRKSCVRKCTNGXXXXXXXXXXXXXCMYT-SIVPV--PDLVIRTGGGDRL
UPPS_AERPE      ----YHFDM-YLKKGSLPDGRRVVAGLCYDPFWEIEHYTPKTLPSRLL-------DEIDLVIRTGGEKRL
RER2_ENCCU      TSIIVNIFFAYSAEDEITRGIQF-------------------------------NSHVDILIRTSNTKRL
NGBR_DANRE      QSMVKVLSPD-DGRLSIVQAAQQLCRAVEQKEKTSKDINVSVLDSLLKESKNIP--DPDLVLKFGTVQST
UPPS_YEAST      IAIEISLLSNRDGRETIVDLTKTMAELCAVNELSVSDITMDLVDSEL---KQLVGPEPDLLLYFGPSLDL
YNJ5_CAEEL      TTVAADVAKMSGAKAEIDQTVKNIKSNVNEVKKDVEKIAEKVDD--------------------------


                         .         .         .         +         .         .         .:280
query           SNFLLWQLAYSEFVFTDTLWPDYSEEDLLANIYTFQTRDRRFGRLKEEKK
UPPS_LACPL      SNFLMWQIAYSELVFTDVKWPDFTAATLQACIADFQSRDRRFGGLSDHK-
UPPS_ENTFA      SNFLLWQIAYSELFFTKALWPDFSGDTLETAIASFQNRNRRFGGLKE---
UPPS_LACJO      SNFLLWQMAYTEFSFSDKLWPDFDKTDLEELVKDYQGRNRRFGKV-----
UPPS_LISIN      SNFMLWQLAYSEFYFTETHWPDFSKEDFLQAIIEYQNRSRRFGGL-----
UPPS_LACAC      SNFLLWQLAYSELAFSEKNWPDFDKDDLKEFVDEYKHRNRRFGKVDE---
UPPS_BACAN      SNFMLWQIAYSEFWFTDVYWPDFTEEHLLNAITDFQHRGRRFG-------
UPPS_LISMF      SNFMLWQLAYSEFYFTDTHWPDFSKEDFLQAIIEYQNRSRRFGGL-----
UPPS_BACHK      SNFMLWQIAYSEFWFTDVYWPDFTEEHLLNAITDFQHRGRRFG-------
UPPS_LISMO      SNFMLWQLAYSEFYFTDTHWPDFSKEDFLQAIIEYQNRSRRFGGL-----
UPPS_BACC1      SNFMLWQIAYSEFWFTDVYWPDFTEEHLLNAITDFQHRGRRFG-------
UPPS_BACCR      SNFMLWQIAYSEFWFTDVYWPDFKEEHLLNAITDFQHRGRRFG-------
UPPS_GEOKA      SNFMLWQLAYTELWFTDVLWPDFTEQHFLEAIAAYQRRDRRFG-------
UPPS_STAS1      SNFLIWQVSYSEFIFNEKLWPDFDKEELINCIKIYQSRQRRFGGL-----
UPPS_STAAW      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_STAAS      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_STAAR      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_STAAC      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_STAAN      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_STAAM      SNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE--
UPPS_BACSU      SNFMLWQVAYSEFVFTDVLWPDFKEDHFL---------------------
UPPS_STRT2      SNFLPWQSAYSEFYFTDVFWPDFDQQGLHQAISDYNKRHRRFG-------
UPPS_STRT1      SNFLPWQSAYSEFYFTDVFWPDFDQQGLHQAISDYNKRHRRFG-------
UPPS_MICLU      SNFLIWQCSYSEFVFIDEFWPDFNEESLAQCISIYQNRHRRFGGL-----
UPPS_STAHJ      SNFLIWQSSYSEFIFNEKLWPDFDGEEFKNCLKIYQSRQRRFGGLSKE--
UPPS_BACSK      SNFMLWQIAYSEFLFMDVYWPNFTEHHFYKAVLTYQNRGRRYG-------
UPPS_BACHD      SNFMLWQLAYSEFWFTDVLWPDFTEHHLTEAIAVYQKRARRYG-------
UPPS_STRA5      SNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRHRRFG-------
UPPS_STRA3      SNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRHRRFG-------
UPPS_STAES      SNFLIWQASYSEFIFNEKLWPDFDEKELRECLKIYQSRQRRFGGLSEE--
UPPS_STAEQ      SNFLIWQASYSEFIFNEKLWPDFDEKELRECLKIYQSRQRRFGGLSEE--
UPPS_STRR6      SNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRHRRFG-------
UPPS_STRPN      SNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRHRRFG-------
UPPS_STRP8      SNFLPWQSAYSEFYFTPVLWPDFKKAELLKAIADYNRRQRRFGKV-----
UPPS_STRP6      SNFLPWQSAYSEFYFTPVLWPDFKKAELLKAIADYNRRQRRFGKV-----
UPPS_STRP1      SNFLPWQSAYSEFYFTPVLWPDFKKAELLKAIADYNRRQRRFGKV-----
UPPS_CLOPE      SNFLLWQCAYSEFWYSQINWPDFNGEDLRKAIFDYQNRDRRFGGIK----
UPPS_STRP3      SNFLPWQSAYSEFYFTPVLWPDFKKAELLKAIADYNHRQRRFGKV-----
UPPS_OCEIH      SNFMLWQLAYTEFWFTEKLWPEFDEDTFHQALMEYQQRKRRYG-------
UPPS_STRMU      SNFLPWQAAYSELYFTDTLWPDFDKKALYLAIEEFNHRHRRFG-------
UPPS_THETN      SNFLLWQSAYSELWFTEVLWPDFKKRHLIEALLYYQTRKRRFG-------
UPPS_CLOTE      SNFLLWQCAYSEFWYSNIKWPDFKKHHLHKAIKDYQNRNRRFG-------
UPPS_LACLA      SNFLTWQSAYSELYFAQTAWPDFDDKELDKAISAFQKRDRRYGGVK----
UPPS1_ANASP     SNFLLWQMAYGEIYITDTLWPDFDRTEFHRALCAYQQRERRFGKV-----
UPPS_ANAVT      SNFLLWQMAYGEIYITDTLWPDFDRTEFHRALCAYQQRERRFGKV-----
UPPS_CLOAB      SNFLLWQCAYSEFWYSNINWPDFSIEDLHTAIKDYQNRDRRFGGVK----
UPPS_HELMO      SNFLLWQSAYTEIWVTPTLWPDFGRKEMVQAIVDYQGRDRRFGGVK----
UPPS_NEIG1      SNFLLWQMAYAELYFTDILWPDFDETALDAAVASFQKRERRFGRTSEQ--
UPPS_GEOSL      SNFLLWQLAYTEFYFSSVNWPEFTPEELYRALSDYQARERRFGR------
UPPS_PROMP      SNFLLWQLAYSEIYVTDVLWPDFTESEFLKAIIDYQSRNRRFGGIE----
UPPS_BACTN      SNYLLWQCAYSELYFCDTFWPDFDKEEFCKAIYEYQQRERRFGKTSEQ--
UPPS_SYNY3      SNFLLWQMAYAEIYVTSTLWPDFDRQAFHLALRDYQQRHRRFGKV-----
UPPS_CHLTE      SNFMLWQNAYSEIIFSNTLWPDFRRNELYEAIREFQKRERRFGKTSEQLK
UPPS_NEIMA      SNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQ--
UPPS_NEIMB      SNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQ--
UPPS_AGRT5      SNFLLWQAAYSEFLFVPEYWPDFDRQRFFSAIEQYATRDRRFGALAEQ--
UPPS_CHRVO      SNFLLWQLAYSELYFTDLLWPDFDRAALQEAIHSYWQRERRFGRTSEQ--
UPPS_VIBF1      SNFMLWQMAYAEFYFTDQYWPDFNEQSLADAVAWFVSRERRFGCTGEQ--
UPPS_VIBPA      SNFMLWQMAYAEMYFTPEFWPEFDEDSLVEAVTWFINRERRFGCTGEQVK
UPPS_PHOLL      SNFLLWQIAYAEFYFTDILWPDFDENVFEGAINAFAKRERRFG-------
UPPS_GLOVI      SNYLLWQMAYTEIYVADVLWPDFDRAAFHAALQSYQGRQRRFGKV-----
UPPS_VIBCH      SNFMLWQLAYAEMYFTPVFWPEFDENCLIEAVTWFVNRERRFGCTGEQVK
UPPS_THEEB      SNFFLWQVAYAEIYVTKTLWPDFDRSAFHEALRDYQQRQRRFGRV-----
UPPS_BUCAI      SNFLLWQIAYSELYFTDVLWPDFNCHIFQHAIDSFVSRERRFGGFKKNKK
UPPS2_ANASP     SNFLLWQMAYTEMYFTDILWPDFDREAFHQALLSYQKRDRRFGQVK----
UPPS_HAEDU      SNFLLWQIAYAELFFSDVLWPDFDETSFSEAIYAYQQRERRFG-------
UPPS_PROMA      SNFLLWQLAYAEIHVTDTLWPDFDSISLTKALIDYQSRRRRFG-------
UPPS_PHOPR      SNFMLWQAAYAELYFTEQHWPDFDEESFANAIAWYINRERRFGCTGEQ--
UPPS_TREDE      SNFLLWQSAYAELYFTDTLWPDWTVENLYEAIEDYKKRNRRYG-------
UPPS_BRUME      SNFLLWQAAYSEFLFLPCHWPDFRPADLDAAYETFRQRERRFG-------
UPPS_BRUAB      SNFLLWQAAYSEFLFLPCHWPDFRPADLDAAYETFRQRERRFG-------
UPPS_BRUSU      SNFLLWQAAYSEFLFLPCHWPDFRPTDLDAAYETFRQRERRFG-------
UPPS_VIBVY      SNFMLWQMAYAEMYFTPVFWPDFGEESLIEAITWFVNRERRFGCTGEQIK
UPPS_VIBVU      SNFMLWQMAYAEMYFTPVFWPDFGEESLIEAITWFVNRERRFGCTGEQIK
UPPS_SHIFL      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFG-------
UPPS_ECOLI      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFG-------
UPPS_ECOL6      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFG-------
UPPS_ECO57      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFG-------
UPPS_RHIME      SNFLLWQGAYSELLFIPDLWPDFTRETFFAAIEQYACRERRFGGLTQ---
UPPS_PROMM      SNFLLWQLAYAEIHVTDVCWPDFDEVALTKALFDYQSRCRRFGGL-----
UPPS_SALTY      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALHAFANRERRFG-------
UPPS_SALPA      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALHAFANRERRFG-------
UPPS_SALTI      SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALHAFANRERRFG-------
UPPS_SYNPX      SNFLLWQLAYAEIHVTDVFWPDFNAEALKRALLDFQSRSRRFGGL-----
UPPS_HAEIN      SNFLLWQIAYAELYFSDVLWPDFNQLEFNRAIASYQQRHRRFG-------
UPPS_THEMA      SNFLLWQSAYSELYFFKKLWPDFTKRDFLRAIESYSKRERRFGGL-----
UPPS_SHEON      SNFVLWQAAYAELVFLDTLWPDFDEQAFHEAIATFANRQRRFG-------
UPPS_PSEPK      SNFLLWQLAYAELYFSDLYWPDFKHEAMRNALADFASRQRRFGKTSEQ--
UPPS_PSESM      SNFLLWQLAYAELYFSDLFWPDFKHDAMRAALADFASRQRRFGKTSEQ--
UPPS_COXBU      SNFMLWQFAYTEIYFTPALWPDFNEETFDQALAFYRTRQRRFGLTPEQ--
UPPS_WIGBR      SNFLLWQIAYSELFFTDVLWPDFDHVIFSNAINSFAKRERRFGKINSK--
UPPS_ERWCT      SNFLLWQIAYAELYFTDVLWPDFDEQVFEGALNAFAQRERRFG-------
DDPS5_ARATH     SNFFLWQSAYTELYFPTVLWPDFGEAEYLEALTWYQQRQRRFGR------
UPPS_PYRFU      SNFLLYQIAYSELFFVDVYFPEFRKIDFLRIIREFQKRERRFGR------
UPPS_YERPS      SNFLLWQIAYAELYFTDVLWPDFDENVFEGALNAFAQRERRFG-------
UPPS_YERPE      SNFLLWQIAYAELYFTDVLWPDFDENVFEGALNAFAQRERRFG-------
UPPS_RALSO      SNFMLWQLAYSELYFTERYWPDFDAAEMDRAFAWYRNRERRFGR------
UPPS_BORPE      SNFLVWQLAYAEFYFTEQFWPDFGADELDAAFEWYRTRERRFGR------
UPPS_BORPA      SNFLVWQLAYAEFYFTEQFWPDFGADELDAAFEWYRTRERRFGR------
UPPS_BORBR      SNFLVWQLAYAEFYFTEQFWPDFGADELDAAFEWYRTRERRFGR------
UPPS_METJA      SNFLIWQSSYSELYFCDIYWPLFRRVDFLRAVRDYXXXXXXFGK------
UPPS_AQUPY      SNFLLWNLAYTELYFSETLWPDFSREEFLKALEDFSRRKRKFGRVLDE--
UPPS_PYRAB      SNFLLYQIAYSELFFVDVYFPEFRKIDFLRIIREFQKRERRFGR------
UPPS_NITEU      SNFLLWQLAYTELYFTDTLWPDFDASALDEAIASYRKRERRFGRTSEQ--
UPPS_FUSNN      SNFLLWQIAYSELYITDVLWPDFDEKEIDKAIESYNQRERRFGGVK----
UPPS_METTH      SGFLLWQSSYSELYFCDSLWPELRKVDFLRAIRSYQQRERRFG-------
UPPS_PORGI      SNFLMWQMAYTELFFTDTLWPDFDADCLKAAIEEYSSRERRFGKTSEQ--
UPPS_PSEAE      SNFLLWQLAYAELYFSDLFWPDFKHAAMRAALADFSKRQRRFGKTSEQ--
UPPS_HELHP      SNFMLWQASYAELFFTPTLFPSFGKNELNAMLEEFLQRQRRFG-------
UPSS_MYCBO      SNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG-------
UPPS_ZYMMO      SNFLLWQAAYAELLFIDTLWPDFGSETL----------------------
UPPS_MYCTU      SNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFG-------
UPPS_LEGPA      SNFFLWQLAYTELYFTDVHWPDFNEHEFELALTSFARRARRFGQISQSE-
UPPS_XYLFA      SNFLLWQIAYTELWFTDVMWPEFNSTVLQQALDDYASRERRFG-------
UPPS2_STRAW     SNYLLWQSSYAEMVFQDVLWPDFDRRDLWRACVEYASRDRRFG-------
UPPS_LEGPL      SNFFLWQLAYTELYFTDVHWPDFNEHEFELALISFSKRARRFGQISQSE-
UPPS2_TROW8     SNFMLWQSAYAELIFMSKLWPDFRRDDFWAALRAYSGRSRRFGR------
UPPS1_TROWT     SNFMLWQSAYAELIFMSKLWPDFRRDDFWAALRAYSGRSRRFGR------
UPPS_XYLFT      SNFLLWQIAYTELWFTDVMWPEFNSTVLQQALDDYASRERRFG-------
UPPS_PYRHO      SNFLLYQIAYSELFFVDVYFPEFRKIDFLRIIREFQKRERRFGR------
UPPS_LEGPH      SNFFLWQLAYTELYFTDVHWPDFNEHEFELALISFAKRARRFGQISQSE-
UPPS_FRATT      SDFMLWQLAYAEMYFTDIMWPDFSKQELTRAVEYFYSRQRRFGKSGEQ--
UPPS_CHLTR      SNFLLWQIAYTELYVTDVLWPDFTANDLLEAIKTYQQRSRRGGK------
UPPS_RHOBA      SNYLLWQISYAELYFTPKCWPEFERDDFQAALDEFAGRQRRFGGL-----
UPPS_PASMU      SNFLLWQIAYAELYFSDVLWPDFNEKEFNEAIIAYQQRHRRFGGAEE---
UPPS_MYCLE      SNFMLWQAAYTEYIFQDKLWPDYDRRDLWAACEEYASRNRRFG-------
UPPS_MYCPF      SNFLLWQAAYAEYVFQDKLWPDYDRRDLWAACEEYVQRNRRFGR------
UPPS1_STRCO     SNYLLWQSAYAEMVFQDVLWPDFDRRDLWRACLEFASRDRRFG-------
UPPS_AQUAE      SNFLLWNLAYTELYFTDTLWPDFTREEFMKALEDYSRRKRKFGRVLDE--
UPPS_RHILO      SNFLLWQAAYSELVFLPCYWPDFSRE------------------------
DDPS3_ARATH     SNFFLWQLAYTELFFSPVLWPDFDKDKLLEALVSYQRRERRFG-------
UPPS_XANAC      SNFLLWQLAYTELWFTETLWPEFDAGVLQQALDDYAGRERRFG-------
UPPS_WOLSU      SNYLLWQSSYAELFFTPTLWPDFTAGELAIQIEEFKRRKRRFG-------
UPPS_BUCAP      SNFLLWQIAYSELYFTDILWPDFNWRDFQHAIDYFFTRERRFG-------
DDPS4_ARATH     SNFFLWQLAYTEFFFSPVLWPDFDKQKFIEALVSYQRRDRRFG-------
UPPS_CAUCR      SNFLLWDCAYAELVFQDVLWPDYGPEALAAAIAEYRGRDRRY--------
DDPS1_ARATH     SNFFLWQLAYSELFFSPVFWPDFDKDKLLEALASYQRRERRFG-------
UPPS_XANOR      SNFLLWQLAYTELWFTETLWPEFDAGVMQQALDDYAGRERRFG-------
UPPS_METKA      SNFLLWYSAYSELYFVDVYWPEFRKIDLLRAIREFQKRERRFGR------
UPPS_PICTO      SNFLLWQSAYSELYFADVNWPELRKIDFLRAIYSYQNRKRRFG-------
UPPS_PYRKO      SNFLLYQIAYSELFFVDVYFPEFRKIDFLRIIREFQKRQRRFGR------
UPPS_CHLPN      SNFLLWQIAYTELYITDTLWPDFTPQDLFEAINVYQQRSRRGGK------
UPPS_HELPJ      SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELK----
UPPS_CHLCV      SNFLLWQIAYTELYVTDILWPDFKPNHFLDAIKAYQHRSRRGGR------
UPPS_HELPY      SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELK----
UPPS_CHLMU      SNFLLWQIAYTELYVTDVLWPDFTAHDLLEAIKTYQQRSRRGGK------
UPPS_LEPIN      SNFLLWQSAYAELYFTDTLWPEFDKNSLVDSLKWYETRTRKFGGL-----
UPPS_LEPIC      SNFLLWQSAYAELYFTDTLWPEFDKNSLVDSLKWYETRTRKFGGL-----
UPPS_THEAC      SNFLLWQSAYSELYFSDVYWPEFSKLDFLRAIYSYQRRQRRFGR------
DDPS2_ARATH     SNFLLWQLAYTELFFAQELWPDFGRSGFI---------------------
UPPS_ACIAD      SNFLLWQAAYAELYFTETLWPEFSIDEFDHALAVFAGRERRFGKTSEQ--
UPPS_CHLAB      SNFLLWQIAYTELYVTDVLWPDFKPYHLLDAIKAYQHRSRRGGK------
UPPS_THEVO      SNFLLWQSAYSELYFSDVYWPEFSKLDFLRAIYSYQRRQRRFGR------
UPPS_BUCBP      SNFLVWQISYSELYFTNTLWPDFDRKEFKKAIDEFSNRERRFGRV-----
UPPS_THET8      SGFLLWQSAYSEFYFADVLWPEFRKIDFLRALRSYQARERRFGR------
UPPS_THET2      SGFLLWQSAYSEFYFADVLWPEFRKIDFLRALRSYQARERRFGR------
UPPS_RICFE      SNFLLWQAAYAELYFSPKYWPAFNKDDIIEAINDYSKRKRTFGK------
UPPS_XANCP      SNFLLWQLAYTELWFTETLWPEFDAGVLQQALDDYAGRERRFG-------
UPPS_RICTY      SNFLLWQAAYAELYFSQKYWPDFNKDDIHEAINDYSKRKRTFGK------
UPPS_RICPR      SNFLLWQAAYAELYFSQKYWPDFNKDDIHEAINDYSKRKRTFGK------
UPPS2_CORDI     SNFLLWQSAYAEMVYQNKLFPDYTPEDLFAAVEEYALRDRRFGGTK----
UPPS_RICCN      SNFLLWQAAYAELYFSPKYWPDFNKYDIQEAINDYSKRKRTFGK------
UPPS_RICSI      SNFLLWQAAYAELYFSPKYWPDFNKYDIQEAINDYSKRKRTFGK------
UPPS_RICBR      SNFLLWQAAYAELYFSQKYWPDFNKEDIINAIDDYSKRKRTFGK------
UPPS_ARCFU      SNFLPWQAANSVAYFCDVYWPEFRKIDLLRAIRAWQYR------------
UPPS2_BRAJA     SNFLMWQAAYSELVFVPIHWPDFDKAAL----------------------
UPPS_TREPA      SNFLLWQSAYAEFYFTDILWPDFRVEDMLRALDEYRLRTRTFGGLE----
UPPS1_BRAJA     SDFLLWEGAYAELHFTERMWPEFDAGDLAEALAAFHGRERRFGGLQ----
UPPS_METMA      SNFLPWQANGSECAFCAPFWPEFRKIDLLRSVRVYQAR-------KEEKK
UPPS_BLOFL      SNFLLWQIAYAELFFTDVLWPDFNDIVFRRALHSFMKRDRRFGK------
UPPS_METAC      SNFLPWQANGSECAFCAPFWPEFRKIDLLRSIRVYQAR-------KDEKK
UPPS1_STRAW     SGFMLWQTAHSEYYFCEVFWPAFRKVDFLRALRDYAARHRRYG-------
UPPS_BIFLO      SNFLPWEAAYAELDFVPELFPDCGRDVLWRSIDHYIHRDRRFGGVK----
UPPS1_CORDI     SGFLLWQAAYSEIWFTDTYWPAFRRVDFLRALREYSKRSRRFGK------
UPPS2_CORGL     SNFLLWQSAYAEMVYQDKLFPDFTQQDLYDAVLEYAKRDRRFG-------
UPPS_HALMA      SNFLPWHANGNEAAFCTPYWPEFRKVDFLRAIRTYQNREDSWRTTRAER-
UPPS1_CORGL     SGFMLWQSAYSEIWFTDTYWPAFRRIDFLRAIRDYSQRSRRFGK------
UPPS_DEIRA      SGFMLWQSVYSEYYFCDVYWPGFRRVDFLRALRDFQGRDRRFGK------
UPPS1_COREF     SGFMLWQSAYSEIWFTDTYWPAFRRIDFLRALRDYSQRSRRFGK------
DHDDS_MOUSE     SDFLLWQTSHSCLVFQPVLWPEYTFWNLCEAILQFQ---RNHGALQKAR-
UPPS_PYRAE      SNFLLYQTAYSELIFLEKLWPEVEREDLVYIIEEYSRRQRRFGR------
DHDDS_HUMAN     SDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQ--------------
UPPS_CAMJR      SNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK------
UPPS_CAMJE      SNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK------
UPPS_SULAC      SNFLLWHLAYSELFFVDVYWPDFRKIDLWRAIRSFQKRKRNFG-------
UPPS_SULTO      SNFLLWHIAYSELFFVDTYWPDFRKIDLWRAIRSYQKRKRNFG-------
UPPS_STRFR      SNFLLWQSAYSELYFCEAYWPAFREIDFLRALRSYAARQRRYG-------
ZFPP_MYCBO      SGFLLWQSAYSEMWFTEAHWPAFRHVDFLRALRDYSARHRRYGR------
UPPS_SULSO      SNFLLWHVAYSELFFCEAYWPEFRKIDLWRAIRSFQKRKRNFG-------
UPPS_BORBU      SNFFLWRIAYSELIFSNVLWPEYYDTRYSKDLECFQFRRRNFGR------
UPPS1_TROW8     SDFMPWQSTHSEFYFLEALGPDLRKVDFLRAIRDFSIRRRSFG-------
ZFPP_MYCTU      SGFLLWQSAYSEMWFTEAHWPAFRHVDFLRALRDYSARHRSYGR------
UPPS2_TROWT     SDFMPWQSTHSEFYFLEALGPDLRKVDFLRAIRDFSIRRRSFG-------
YE54_SCHPO      SDFMLWQCKNTEIKFIDFYWPDFS--------------------------
UPPS_HALSA      SNFLPWHANGSEVFFCTPYWPEFSKVDLLRAIRTYESR------------
UPPS2_COREF     SNFLLWQSAYAEMVYQDKLFPDFTPQDLFDAVEEYARRDRRFG-------
ZFPP_MYCLE      SGFLLWQSAYSEMWFTETHWPAFRRVDFLRALRDYSMRHRRYGK------
UPPS2_STRCO     SGFLLWQSAYAEVHFCETYWPDFREIDFLRALRSYSLRERRYGR------
DDPS6_ARATH     SNFLLWQTGNTQLCSPAALWPEIGLRHLLWAILNFQ---RNHSYLEKRKK
CRUP_STRCO      SNFLPWHLAYAELVFDPAPWPDFDLARLRDAVDSYAGRERRFG-------
SRT1_YEAST      SDYMLWQVHENATIFSDTLWPNFS--------------------------
DDPS8_ARATH     SNFMTWQTSRALLHRTEALWPELGLWHLVWAILKFQ---RMQDYLQKKKK
RER2_YEAST      SDFLIWQASSKRIELLDCLWPEF---------------------------
DDPS7_ARATH     SNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQ--------------
UPPS_AERPE      SSFFPLLTRYAELYFIDKLWPDFTREDLDRAVQWFSTRRRPMGR------
RER2_ENCCU      SNFMIRQVAKGTSVFAKALWPELTTAHL----------------------
NGBR_DANRE      LGFLPWHIRLTEIISMPS-HIDASYDDLYDALQRFAGCEQRLGK------
UPPS_YEAST      QGFPPWHIRLTEF-------------------------------------
YNJ5_CAEEL      --------------------------------------------------