[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99438.1

[Show Plain Result]


## Summary of Sequence Search
    1::112
    1::112     1e-61 100%  112 aa  Y628_LACS1 RecName: Full=UPF0122 protein LSL_0628;
    1::112     1e-38  64%  113 aa  Y1156_LACRD RecName: Full=UPF0122 protein Lreu_1156;
    1::112     1e-38  64%  113 aa  Y1089_LACRJ RecName: Full=UPF0122 protein LAR_1089;
    1::97      9e-36  69%  112 aa  Y1701_ENTFA RecName: Full=UPF0122 protein EF_1701;
    1::111     2e-35  61%  115 aa  Y1634_LACPL RecName: Full=UPF0122 protein lp_1634;
    1::112     1e-34  60%  113 aa  Y949_LACBA RecName: Full=UPF0122 protein LVIS_0949;
    1::107     7e-34  61%  113 aa  Y1817_LACCB RecName: Full=UPF0122 protein LCABL_18170;
    1::107     7e-34  61%  113 aa  Y1603_LACC3 RecName: Full=UPF0122 protein LSEI_1603;
    1::112     1e-33  57%  113 aa  Y845_PEDPA RecName: Full=UPF0122 protein PEPE_0845;
    1::108     1e-33  57%  111 aa  YOFM_LACLA RecName: Full=UPF0122 protein yofM;
    1::111     1e-33  59%  113 aa  Y1235_LACF3 RecName: Full=UPF0122 protein LAF_1235;
    4::113     3e-33  62%  113 aa  Y878_STRS2 RecName: Full=UPF0122 protein SSU98_0878;
    4::113     3e-33  62%  113 aa  Y875_STRSY RecName: Full=UPF0122 protein SSU05_0875;
    1::107     6e-33  65%  110 aa  Y1180_STRE4 RecName: Full=UPF0122 protein SEQ_1180;
    4::110     6e-33  65%  113 aa  Y1013_STREM RecName: Full=UPF0122 protein Sez_1013;
    1::110     7e-33  61%  110 aa  Y939_STRZT RecName: Full=UPF0122 protein SPT_0939;
    1::108     7e-33  56%  111 aa  Y1522_LACLS RecName: Full=UPF0122 protein LACR_1522;
    1::110     7e-33  61%  110 aa  Y1429_STRPI RecName: Full=UPF0122 protein SPH_1429;
    1::110     7e-33  61%  110 aa  Y1327_STRZP RecName: Full=UPF0122 protein SPP_1327;
    1::110     7e-33  61%  110 aa  Y1251_STRPS RecName: Full=UPF0122 protein SPCG_1251;
    1::110     7e-33  61%  110 aa  Y1203_STRZJ RecName: Full=UPF0122 protein SPJ_1203;
    1::110     7e-33  61%  110 aa  Y1183_STRPJ RecName: Full=UPF0122 protein SPN23F11830;
    1::110     7e-33  61%  110 aa  Y1167_STRR6 RecName: Full=UPF0122 protein spr1167;
    1::110     7e-33  61%  110 aa  Y1143_STRP2 RecName: Full=UPF0122 protein SPD_1143;
    1::108     7e-33  56%  111 aa  Y1069_LACLM RecName: Full=UPF0122 protein llmg_1069;
    2::110     2e-32  56%  110 aa  Y1195_GEOKA RecName: Full=UPF0122 protein GK1195;
    1::107     2e-32  63%  110 aa  Y1061_STRMU RecName: Full=UPF0122 protein SMU_1061;
    1::107     3e-32  62%  110 aa  Y914_STRTD RecName: Full=UPF0122 protein STER_0914;
    1::107     3e-32  62%  110 aa  Y888_STRT2 RecName: Full=UPF0122 protein stu0888;
    1::107     3e-32  62%  110 aa  Y888_STRT1 RecName: Full=UPF0122 protein str0888;
    1::110     3e-32  60%  110 aa  Y1353_STRP7 RecName: Full=UPF0122 protein SP70585_1353;
    1::110     3e-32  60%  110 aa  Y1288_STRPN RecName: Full=UPF0122 protein SP_1288;
    1::110     4e-32  60%  110 aa  Y1182_STRP4 RecName: Full=UPF0122 protein SPG_1182;
    4::110     5e-32  60%  113 aa  Y975_STRPB RecName: Full=UPF0122 protein MGAS2096_Spy0975;
    4::110     5e-32  60%  113 aa  Y946_STRPZ RecName: Full=UPF0122 protein Spy49_0946c;
    4::110     5e-32  60%  113 aa  Y905_STRP6 RecName: Full=UPF0122 protein M6_Spy0905;
    4::110     5e-32  60%  113 aa  Y888_STRPM RecName: Full=UPF0122 protein M28_Spy0888;
    4::110     5e-32  60%  113 aa  Y882_STRPG RecName: Full=UPF0122 protein SpyM50882;
    4::110     5e-32  60%  113 aa  Y842_STRP3 RecName: Full=UPF0122 protein SpyM3_0842/SPs1042;
    4::110     5e-32  60%  113 aa  Y1201_STRP1 RecName: Full=UPF0122 protein SPy_1201/M5005_Spy0916;
    4::110     5e-32  60%  113 aa  Y1152_STRP8 RecName: Full=UPF0122 protein spyM18_1152;
    4::110     5e-32  60%  113 aa  Y1065_STRPF RecName: Full=UPF0122 protein MGAS10750_Spy1065;
    4::110     5e-32  60%  113 aa  Y1030_STRPD RecName: Full=UPF0122 protein MGAS10270_Spy1030;
    4::110     5e-32  60%  113 aa  Y1018_STRPC RecName: Full=UPF0122 protein MGAS9429_Spy1018;
    1::107     8e-32  61%  110 aa  Y1122_STRGC RecName: Full=UPF0122 protein SGO_1122;
    1::107     2e-31  62%  110 aa  Y983_STRA5 RecName: Full=UPF0122 protein SAG0983;
    1::107     2e-31  62%  110 aa  Y1018_STRA3 RecName: Full=UPF0122 protein gbs1018;
    1::94      2e-30  61%  113 aa  Y713_LACSS RecName: Full=UPF0122 protein LSA0713;
    1::110     2e-29  54%  110 aa  Y1580_BACA2 RecName: Full=UPF0122 protein RBAM_015800;
    2::109     8e-29  56%  109 aa  Y2485_BACHD RecName: Full=UPF0122 protein BH2485;
    3::110     1e-28  50%  110 aa  Y1916_LISIN RecName: Full=UPF0122 protein lin1916;
    2::105     7e-28  55%  105 aa  Y1530_OCEIH RecName: Full=UPF0122 protein OB1530;
    1::107     9e-28  55%  107 aa  Y2321_BACLD RecName: Full=UPF0122 protein BLi01817/BL02321;
    3::110     2e-27  48%  110 aa  Y1829_LISMF RecName: Full=UPF0122 protein LMOf2365_1829;
    3::110     2e-27  48%  110 aa  Y1821_LISW6 RecName: Full=UPF0122 protein lwe1821;
    3::110     2e-27  48%  110 aa  Y1818_LISMC RecName: Full=UPF0122 protein Lm4b_01818;
    3::110     3e-27  48%  110 aa  Y1802_LISMO RecName: Full=UPF0122 protein lmo1802;
    2::110     8e-27  51%  110 aa  Y1086_GEOSW RecName: Full=UPF0122 protein GWCH70_1086;
    1::77      4e-26  62%  106 aa  Y1902_EXIS2 RecName: Full=UPF0122 protein Exig_1902;
    8::110     5e-26  54%  110 aa  Y802_STAEQ RecName: Full=UPF0122 protein SERP0802;
    8::110     1e-25  53%  110 aa  Y1678_STAHJ RecName: Full=UPF0122 protein SH1678;
    8::110     1e-25  53%  110 aa  Y911_STAES RecName: Full=UPF0122 protein SE_0911;
    8::110     2e-25  52%  110 aa  Y1533_STAS1 RecName: Full=UPF0122 protein SSP1533;
    8::110     4e-25  51%  110 aa  Y1212_STAAR RecName: Full=UPF0122 protein SAR1212;
    8::110     1e-24  50%  110 aa  Y1320_STAA2 RecName: Full=UPF0122 protein SaurJH1_1320;
    8::110     1e-24  50%  110 aa  Y1295_STAA9 RecName: Full=UPF0122 protein SaurJH9_1295;
    8::110     1e-24  50%  110 aa  Y1252_STAAC RecName: Full=UPF0122 protein SACOL1252;
    8::110     1e-24  50%  110 aa  Y1236_STAAM RecName: Full=UPF0122 protein SAV1236;
    8::110     1e-24  50%  110 aa  Y1226_STAA1 RecName: Full=UPF0122 protein SAHV_1226;
    8::110     1e-24  50%  110 aa  Y1206_STAA8 RecName: Full=UPF0122 protein SAOUHSC_01206;
    8::110     1e-24  50%  110 aa  Y1170_STAAS RecName: Full=UPF0122 protein SAS1170;
    8::110     1e-24  50%  110 aa  Y1146_STAAE RecName: Full=UPF0122 protein NWMN_1146;
    8::110     1e-24  50%  110 aa  Y1129_STAA3 RecName: Full=UPF0122 protein SAUSA300_1129;
    8::110     1e-24  50%  110 aa  Y1119_STAAW RecName: Full=UPF0122 protein MW1119;
    8::110     1e-24  50%  110 aa  Y1100_STAAB RecName: Full=UPF0122 protein SAB1100;
    8::110     1e-24  50%  110 aa  Y1079_STAAN RecName: Full=UPF0122 protein SA1079;
    8::110     2e-24  57%  110 aa  Y859_STACT RecName: Full=UPF0122 protein Sca_0859;
    2::110     2e-22  45%  110 aa  Y647_BACAC RecName: Full=UPF0122 protein BAMEG_0647;
    2::110     2e-22  45%  110 aa  Y4008_BACAA RecName: Full=UPF0122 protein BAA_4008;
    2::110     2e-22  45%  110 aa  Y3984_BACAN RecName: Full=UPF0122 protein
    2::110     2e-22  45%  110 aa  Y3946_BACC3 RecName: Full=UPF0122 protein BCA_3946;
    2::110     2e-22  45%  110 aa  Y3945_BACC4 RecName: Full=UPF0122 protein BCB4264_A3945;
    2::110     2e-22  45%  110 aa  Y3894_BACC7 RecName: Full=UPF0122 protein BCAH187_A3894;
    2::110     2e-22  45%  110 aa  Y3888_BACC1 RecName: Full=UPF0122 protein BCE_3888;
    2::110     2e-22  45%  110 aa  Y3860_BACC0 RecName: Full=UPF0122 protein BCAH820_3860;
    2::110     2e-22  45%  110 aa  Y3844_BACCR RecName: Full=UPF0122 protein BC_3844;
    2::110     2e-22  45%  110 aa  Y3631_BACCQ RecName: Full=UPF0122 protein BCQ_3631;
    2::110     2e-22  45%  110 aa  Y3605_BACCZ RecName: Full=UPF0122 protein BCE33L3605;
    2::110     2e-22  45%  110 aa  Y3587_BACHK RecName: Full=UPF0122 protein BT9727_3587;
    2::110     2e-22  45%  110 aa  Y3477_BACAH RecName: Full=UPF0122 protein BALH_3477;
    2::110     2e-22  45%  110 aa  Y1298_BACC2 RecName: Full=UPF0122 protein BCG9842_B1298;
    1::60      3e-22  73%  110 aa  YLXM_BACSU RecName: Full=UPF0122 protein ylxM;
    2::110     3e-22  45%  110 aa  Y3669_BACWK RecName: Full=UPF0122 protein BcerKBAB4_3669;
    1::107     3e-22  49%  107 aa  Y2891_EXISA RecName: Full=UPF0122 protein EAT1b_2891;
    2::109     6e-22  48%  109 aa  Y2295_BACSK RecName: Full=UPF0122 protein ABC2295;
    1::60      1e-21  72%  110 aa  Y1495_BACP2 RecName: Full=UPF0122 protein BPUM_1495;
    2::96      3e-19  46%  110 aa  Y1766_ANOFW RecName: Full=UPF0122 protein Aflv_1766;
    1::109     3e-18  44%  109 aa  Y1244_CLOBB RecName: Full=UPF0122 protein CLL_A1244;
    1::89      4e-18  44%  117 aa  Y2057_DESRM RecName: Full=UPF0122 protein Dred_2057;
    1::109     9e-18  43%  109 aa  Y1174_CLOB8 RecName: Full=UPF0122 protein Cbei_1174;
    1::109     1e-17  43%  109 aa  Y1195_CLOBA RecName: Full=UPF0122 protein CLH_1195;
    1::95      8e-16  46%  110 aa  Y2506_CLOBL RecName: Full=UPF0122 protein CLI_2506;
    2::110     1e-15  36%  110 aa  Y2498_BACCN RecName: Full=UPF0122 protein Bcer98_2498;
    1::95      1e-15  46%  110 aa  Y2743_CLOBJ RecName: Full=UPF0122 protein CLM_2743;
    1::95      1e-15  46%  110 aa  Y2675_CLOB6 RecName: Full=UPF0122 protein CLJ_B2675;
    1::95      1e-15  46%  110 aa  Y2450_CLOBH RecName: Full=UPF0122 protein CBO2450/CLC_2298;
    1::95      1e-15  46%  110 aa  Y2314_CLOB1 RecName: Full=UPF0122 protein CLB_2314;
    1::95      1e-15  46%  110 aa  Y2190_CLOBK RecName: Full=UPF0122 protein CLD_2190;
    1::96      1e-15  44%  112 aa  Y1714_CLOPE RecName: Full=UPF0122 protein CPE1714;
    1::96      1e-15  44%  112 aa  Y1686_CLOPS RecName: Full=UPF0122 protein CPR_1686;
   11::83      2e-15  49%  117 aa  Y1714_THEPX RecName: Full=UPF0122 protein Teth514_1714;
   11::83      2e-15  49%  117 aa  Y1278_THEP3 RecName: Full=UPF0122 protein Teth39_1278;
    1::95      3e-15  45%  110 aa  Y1827_CLOBM RecName: Full=UPF0122 protein CLK_1827;
    1::85      4e-15  44%  117 aa  Y771_CLOTH RecName: Full=UPF0122 protein Cthe_0771;
    7::103     4e-15  40%  107 aa  Y485_MYCPE RecName: Full=UPF0122 protein MYPE4850;
    1::96      5e-15  43%  112 aa  Y1968_CLOP1 RecName: Full=UPF0122 protein CPF_1968;
    1::68      7e-15  53%  107 aa  Y1464_SYMTH RecName: Full=UPF0122 protein STH1464;
   11::71      2e-14  56%  117 aa  Y1463_THETN RecName: Full=UPF0122 protein TTE1463;
    1::70      4e-14  50%  111 aa  Y1400_CLOK5 RecName: Full=UPF0122 protein CKL_1400;
    1::70      4e-14  50%  111 aa  Y1296_CLOK1 RecName: Full=UPF0122 protein CKR_1296;
   18::108     6e-14  40%  113 aa  P13_MYCMY RecName: Full=Probable UPF0122 protein;AltName: Full=p13;
    1::72      1e-13  47%  115 aa  Y2214_CLONN RecName: Full=UPF0122 protein NT01CX_2214;
    1::94      2e-13  39%  103 aa  Y1394_FUSNN RecName: Full=UPF0122 protein FN1394;
    1::75      2e-11  41%  116 aa  Y1753_CLOAB RecName: Full=UPF0122 protein CA_C1753;
   10::106     1e-10  36%  114 aa  Y1504_EUBR3 RecName: Full=UPF0122 protein EUBREC_1504;
   18::68      5e-10  49%  113 aa  Y480_MYCCT RecName: Full=UPF0122 protein MCAP_0480;
    1::56      1e-09  46%  117 aa  Y1247_CLOTE RecName: Full=UPF0122 protein CTC_01247;
   12::74      2e-09  44%   99 aa  Y158_UREU1 RecName: Full=UPF0122 protein UUR10_0158;
   12::74      3e-09  43%   99 aa  Y148_UREP2 RecName: Full=UPF0122 protein UPA3_0148;
   12::74      3e-09  43%   99 aa  Y142_UREPA RecName: Full=UPF0122 protein UU142;
   15::71      4e-07  35%  102 aa  Y424_MYCPN RecName: Full=UPF0122 protein MPN_424;
    1::112

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
Y628_LACS1      MAIEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESKL
Y1156_LACRD     MEIEKNYRINSLFEFYQPLLTKKQNDYLELYYGDDYSLGEIAENFHVSRQAVYDNIKRTESILEDYEAKL
Y1089_LACRJ     MEIEKNYRINSLFEFYQPLLTKKQNDYLELYYGDDYSLGEIAENFHVSRQAVYDNIKRTESILEDYEAKL
Y1701_ENTFA     MEMEKTNRMNALFEFYSTLLTEKQMNYMELYYADDFSLGEIAEEYEVSRQAVYDNIKRTEKILEEYEKKL
Y1634_LACPL     MEIEKNYRINSLFEFYEPLLTNKQKAYIQLYYADDYSLGEIAAEFSVSRQAVYDNIKRTEKILEGYEAKL
Y949_LACBA      MEIEKNYRINSLFAFYQPLLTAKQNNYMQLYYGDDYSLGEIAEEFNVSRQAVYDNLRRTEKILEDYEEKL
Y1817_LACCB     MEIEKNYRMNSLFEFYGPLLTDKQHAYLALYYGDDYSLGEIATEFNVSRQAVYDNIRRTEASLEEYEKKL
Y1603_LACC3     MEIEKNYRMNSLFEFYGPLLTDKQHAYLALYYGDDYSLGEIATEFNVSRQAVYDNIRRTEASLEEYEKKL
Y845_PEDPA      MEIEKNNRINSLLEFYEQLLTPKQKEYITLYYADDYSLGEISEEFQVSRQAVYDNIKRTVNILEKYEQQL
YOFM_LACLA      MEIEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLESYEEKL
Y1235_LACF3     MELEKNERINALFAFYQPLLTAKQNDYLQLYYADDYSLGEIATEFSVSRQAVYDNIKRTEKILEGYEQKL
Y878_STRS2      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFQVSRQAVYDNIKRTEKLLEDYEMKL
Y875_STRSY      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFQVSRQAVYDNIKRTEKLLEDYEMKL
Y1180_STRE4     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKL
Y1013_STREM     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEAYEMKL
Y939_STRZT      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1522_LACLS     MEIEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLESYEEKL
Y1429_STRPI     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1327_STRZP     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1251_STRPS     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1203_STRZJ     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1183_STRPJ     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1167_STRR6     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1143_STRP2     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1069_LACLM     MEIEKTNRMNTLFEFYATLLTDKQMNYIELYYADDYSLAEIAEEFNISRQAVYDNIKRTEKVLESYEEKL
Y1195_GEOKA     --LEKTMRMNYLYDFYQALLTPKQRNYMALYYLDDYSLGEIAEQYEVSRQAVYDNIRRTEAMLEQYEEKL
Y1061_STRMU     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFDVSRQAVYDNIKRTEKILEDYEMKL
Y914_STRTD      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y888_STRT2      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y888_STRT1      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1353_STRP7     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1288_STRPN     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y1182_STRP4     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y975_STRPB      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y946_STRPZ      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y905_STRP6      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y888_STRPM      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y882_STRPG      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y842_STRP3      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1201_STRP1     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1152_STRP8     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1065_STRPF     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1030_STRPD     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1018_STRPC     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKILETYEMKL
Y1122_STRGC     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKL
Y983_STRA5      MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEESGVSRQAVYDNIKRTEKILEAYEMKL
Y1018_STRA3     MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEESGVSRQAVYDNIKRTEKILEAYEMKL
Y713_LACSS      MELAQNARMNSLFEFYGALLTAKQHSYLSLYYGDDFSLGEIAEEYQVSRQAVYDNIRRTEKILEGYEAKL
Y1580_BACA2     MSLEKTTRMNYLFDFYQSLLTSKQKSYMSLYYLDDFSLGEIAEEYDVSRQAVYDNIKRTEAMLEQYEEKL
Y2485_BACHD     --LDKTLRMNYLFDFYQSLLTEKQRKYMSLYYLDDFSLGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y1916_LISIN     ---EKTNRMNLLFDFYQELLTTKQKSYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKL
Y1530_OCEIH     --LDKTTRINYLFDFYQELLTPKQRNYMEMYYLEDYSLGEISELFQVSRQAVYDNIKRTEAMLESYEEKL
Y2321_BACLD     MTLEKTTRMNYLFDFYQTLLTSKQKSYMSLYYLDDFSLGEIAEEYHVSRQAVYDNIKRTEAMLEQYEEKL
Y1829_LISMF     ---EKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKL
Y1821_LISW6     ---EKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKL
Y1818_LISMC     ---EKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKL
Y1802_LISMO     ---EKTNRMNLLFDFYQELLTTKQKAYVSFYYLDDYSLGEIAEEFEVSRQAIYDNIKRTEESLEKYEEKL
Y1086_GEOSW     --LEKTMRMNYLYDFYQALLTPKQRXXXXXXXXXXXXXGEIAQQYEVSRQAVYDNIKRTEAMLEEYEKKL
Y1902_EXIS2     MTLDKTNRMNYLIDFYQELLTPKQRNYMSLYYLDDFSLGEIADEFEVSRQAVYDNIKRTEAMLEQYEERL
Y802_STAEQ      ----KTLRMNYLFDFYQSLLTNKQKNYLELFYLQDYSLSEIADTFEVSRQAVYDNIRRTGDLVEDYESKL
Y1678_STAHJ     ----KTLRMNYLFDFYQTLLTEKQRNYMELFYLRDYSLSEIAETFDVSRQAVYDNIRRTGDLVEDYEAKL
Y911_STAES      ----KTLRMNYLFDFYQSLLTNKQKNYLEFFYLQDYSLSEIADTFEVSRQAVYDNIRRTGDLVEDYESKL
Y1533_STAS1     ----KTIRMNYLFDFYQALLTKKQRNYLELFYLQDYSLSEIANTFDVSRQAVYDNIRRTGDLVEDYEEKL
Y1212_STAAR     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1320_STAA2     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1295_STAA9     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1252_STAAC     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1236_STAAM     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1226_STAA1     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1206_STAA8     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1170_STAAS     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1146_STAAE     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1129_STAA3     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1119_STAAW     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1100_STAAB     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y1079_STAAN     ----KTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKL
Y859_STACT      ----KTLRMNYLFDFYQALLTKKQRNYLELFYLQDYSLSEIADTFDVSRQAVYDNIRRTGDLVEDYETKL
Y647_BACAC      --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y4008_BACAA     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3984_BACAN     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3946_BACC3     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEDKL
Y3945_BACC4     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3894_BACC7     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3888_BACC1     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3860_BACC0     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3844_BACCR     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3631_BACCQ     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3605_BACCZ     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3587_BACHK     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
Y3477_BACAH     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEDKL
Y1298_BACC2     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEEKL
YLXM_BACSU      MSLEKTTRMNYLFDFYQSLLTSKQKSYMSLYYLDDFSLGEIAEEYEVSRQAVYDNIKRTE----------
Y3669_BACWK     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTEAMLEEYEDKL
Y2891_EXISA     MTLEKTNRMNYLIDFYQALLTPKQRNYMXXXXXXXXXXGEIAEEFEVSRQAVYDNIKRTETMLEQYEEKL
Y2295_BACSK     --LDKTLRMNYLFDFYHSLLTEKQRNYMXXXXXXXXXXGEIADEYDVSRQAVYDNIRRTEAMLEEYEQKL
Y1495_BACP2     MTLEKTTRMNYLFDFYQSLLTAKQKSYMSLYYLDDFSLGEIADEYEVSRQAVYDNIKRTE----------
Y1766_ANOFW     --LEKTTRMNYLYDFYQSLLTPKQRNYMXXXXXXXXXXGEIAEEYEVSRQAVYDNIKRTEAMLEDYEXXX
Y1244_CLOBB     --MEDRVEISMLMDFYSSLLTEKQRSVMALYYDDDLSLAEIAELNKTSRQAIHDLIKRCDKQLLSYESKL
Y2057_DESRM     --MKEFHKINLLNDYYGSLLTERQQNFIELYYGEDLSLGEIAEQYNVTRQAVHDTLKRAEQTLTNYEEKL
Y1174_CLOB8     --MEDRVEISLLMDFYGPLLTEKQSEIMQWYYNDDLSLAEIAELNQTSRQAIHDLIKRCYKQLLSYESKL
Y1195_CLOBA     --MEDRVEISMLMDLYSSLLTEKQRSVMALYYDDDLSLAEIAELNKTSRQAIHDLIKRCDKQLLSYESKL
Y2506_CLOBL     --MEEIVEVSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKL
Y2498_BACCN     --LEKTTRMNYLFDFYQSLLTQKQRSYMXXXXXXXXXXGEIAEEFDVSRQAVYDNIKRTXXXXXXXXXXX
Y2743_CLOBJ     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKL
Y2675_CLOB6     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALIQYEEKL
Y2450_CLOBH     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKL
Y2314_CLOB1     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKL
Y2190_CLOBK     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKL
Y1714_CLOPE     --MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKL
Y1686_CLOPS     --MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCSKQLHSYDEKL
Y1714_THEPX     -----------LYDFYGALLTDKQREIFEMYYLNDYSLGEISELLDISRQGVYDTLKRAESSLEFFEEKL
Y1278_THEP3     -----------LYDFYGALLTDKQREIFEMYYLNDYSLGEISELLDISRQGVYDTLKRAESSLEFFEEKL
Y1827_CLOBM     --MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALIQYEERL
Y771_CLOTH      --MDKVYEAALLLDFYGQLLTKRQFEILDLYLNNDYSLGEIAEHLNISRQGVYDNIKRGRAMLDRMEEKL
Y485_MYCPE      ------SQISLLIDFYGNLLTDKQLQNLIDYYFNDLSLSEIAANNNVSRTAIHDSIKKSKNELEQFENKL
Y1968_CLOP1     --MENRFEISMLIDYYGTLLTEKQFNVMTLYYNEDLSLAEIAEINKTSRQAIYDLIKRCCKQLHSYDEKL
Y1464_SYMTH     --MKDVQRIALLFDFYGPLLTERQQELIRAYYLEDHSLAEIADADGVSRQAVHELIRRSEAALQEYEQRL
Y1463_THETN     -----------LYDFYGALLTDKQREIFEMYYLNDYSLGEISEILDISRQGVYDALKRAEDSLEFYEEKL
Y1400_CLOK5     --MEERIRLSILLDIYGELLTEKQRNVLDLYYNQDLSLAEIAEHTSTSRQAVYDIIKRCHMLLVHYEDKL
Y1296_CLOK1     --MEERIRLSILLDIYGELLTEKQRNVLDLYYNQDLSLAEIAEHTSTSRQAVYDIIKRCHMLLVHYEDKL
P13_MYCMY       ------------FKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLETKL
Y2214_CLONN     --MEDRIKISILMDYYRELLTEKQKYVMELYFNQDLSLAEISELTNTSRQAIYDIIKRCNKLLVDYEKKL
Y1394_FUSNN     MILDEFVEIANLLEIYSSLLSEKQKEYLEDHFENDLSLSEIAKNNNVSRQAIYDNIKRGVALLYDYEDKL
Y1753_CLOAB     --MEERIYLSMLLSTYGSLLTEKQVNVMRLYYDDDLSMPEIAELNNTTRQAIHDLIKRCHKMLLNYENKL
Y1504_EUBR3     -----------LYDFYGELLNEHQRQVYEDFVFNDLSLGEIASEEGISRQGVADLIKRCNKKLLDYEAKL
Y480_MYCCT      ------------FKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLL-------
Y1247_CLOTE     --MEEKIEMSMLLDFYGILLTDKQKSIMNLYCNEDFSLAEISEHTKTSRQAVHDIIKR------------
Y158_UREU1      ----------ALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEVSKSAISDCLNKVCDQLLKYEQAL
Y148_UREP2      ----------ALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEISKSAISDCLNKVCDQLLKYEQAL
Y142_UREPA      ----------ALYDIYQGLLTTKQCEYFNLHYFKDLSFSEIAELKEISKSAISDCLNKVCDQLLKYEQAL
Y424_MYCPN      -----------LFDIYGELLTKRQACYFNEYINLDLSMQEIADKYQVKKSSIHQHIKTCNLIFNRFEA--


                         .         .         *         .         .         .         .:140
query           HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE
Y628_LACS1      HLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLEE
Y1156_LACRD     HLYAEFQVRNQQADRIQRYVRENYPDDATLNHLVNHLESLEE
Y1089_LACRJ     HLYAEFQVRNQQADRIQRYVRENYPDDATLNHLVNHLESLEE
Y1701_ENTFA     HLYSNYVVRKEFLEQLQQYVQETYPKD---------------
Y1634_LACPL     HLYHDFVERNHEVDAISDYIKQNYHGDTQLIKMIQQLVNLE-
Y949_LACBA      HLYQEFTARNRQADEIQAYVATTYPHDSRLNRLVAGLENLEE
Y1817_LACCB     HLFANYQAQNEAVDTLVSYARTHYPDDKALSTLLERV-----
Y1603_LACC3     HLFANYQAQNEAVDTLVSYARTHYPDDKALSTLLERV-----
Y845_PEDPA      HLLSNFEVRNAKFDQIRAYINQKYPEDTELKHFLDDLEKSEE
YOFM_LACLA      HLFSNYVVRNQLLEELMK----KYSTDQYLITKLQEIQQIDE
Y1235_LACF3     HLYAEFEARNQQADRIRDYVLSHYPTDQTLRDLIDGMENLE-
Y878_STRS2      HMYSDYVVRSQIFDEILKYPEDAYLKEKAILTSIDNRE----
Y875_STRSY      HMYSDYVVRSQIFDEILKYPEDAYLKEKAILTSIDNRE----
Y1180_STRE4     HMYSDYIVRSEIFDDILKYPSDHYLRDKSILTSID-------
Y1013_STREM     HMYSDYIVRSEIFDDILKYPSDHYLRDKSILTSID-------
Y939_STRZT      HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1522_LACLS     HLFSNYVVRNQLLEELMK----KYPSDQYLISKLQEIQQIDE
Y1429_STRPI     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1327_STRZP     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1251_STRPS     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1203_STRZJ     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1183_STRPJ     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1167_STRR6     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1143_STRP2     HMYSDYIVRSQIFDQILRYPKDNFLQEQEILTSIDNRE----
Y1069_LACLM     HLFSNYVVRNQLLEELMK----KYPSDQYLISKLQEIQQIDE
Y1195_GEOKA     GLLRKYERRRQIIERLKDYISRRYGADAELAALVRELDELD-
Y1061_STRMU     HMYSDYVVRSEIFDAIMKYPNDPYLQNKSILTTID-------
Y914_STRTD      HMYSDYIVRSQIFDDIM----EKYADDSYLQEQIAILSSID-
Y888_STRT2      HMYSDYIVRSQIFDDIM----EKYADDSYLQEQIAILSSID-
Y888_STRT1      HMYSDYIVRSQIFDDIM----EKYADDSYLQEQIAILSSID-
Y1353_STRP7     HMYSDYIVRSQIFDQILRYPKDDFLQEQEILTSIDNRE----
Y1288_STRPN     HMYSDYIVRSQIFDQILRYPKDDFLQEQEILTSIDNRE----
Y1182_STRP4     HMYSDYIVRSQIFDQILRYPKDDFLQEQEILTSIDXRE----
Y975_STRPB      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y946_STRPZ      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y905_STRP6      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y888_STRPM      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y882_STRPG      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y842_STRP3      HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1201_STRP1     HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1152_STRP8     HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1065_STRPF     HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1030_STRPD     HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1018_STRPC     HMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID-
Y1122_STRGC     HMYSDYIVRSQ----ILEEIAEKYPKDSFLQEQIATLSSID-
Y983_STRA5      HMYSDYIVRSQIFDDIL----EKYTDDAFLQEKISILSSID-
Y1018_STRA3     HMYSDYIVRSQIFDDIL----EKYTDDAFLQEKISILSSID-
Y713_LACSS      HLFQNYEQQNASADALQKYIQAQY------------------
Y1580_BACA2     LLFKKFQ-ERKEMFTKLKELASGLQEEEKMTALIEALEKLD-
Y2485_BACHD     SLLAKFEKRSEILQQLKEAVDKQ-ATSEELMALLESLDTLE-
Y1916_LISIN     GMLRKYQQREKLFDQLEAQLTKKNFLDEQVKDTLEQLKNID-
Y1530_OCEIH     HLYSKFEQRVKLLEKL-----KLMTTDKHVHEHIQKLKDLD-
Y2321_BACLD     LLFKKFQERKKIFEALRKLTDG----QPEAESLIDALEKLD-
Y1829_LISMF     GMLKKYQQREKLFSQLEAQLTKKNFLDEQVKDTLEQLKNID-
Y1821_LISW6     GMLKKYQQREKLFSELEAQLTKKNFLDEQVKDTLEQLKNID-
Y1818_LISMC     GMLKKYQQREKLFSQLEAQLTKKNFLDEQVKDTLEQLKNID-
Y1802_LISMO     GMLKKYQQREKLFTQLEAQLTKKNFLDEQVKDTLEQLKNID-
Y1086_GEOSW     SLFQKFQKRKQLMNQLKDYVLQKYGEDKQLFDMIKELEELE-
Y1902_EXIS2     GLFAKYE-----------------------------------
Y802_STAEQ      RLYQRFE-KRRELYNLMKQSLNQPELLKQYITQLEELE----
Y1678_STAHJ     NLYEKFEQRRKIYDDMKQTLNDS----KKLEQYINQLEELE-
Y911_STAES      RLYQRFE-KRRELYNLMKQSLNQPELLKQYITQLEELE----
Y1533_STAS1     GLYRNF----EQRQNLYEQIKQHINDPEQIKKYIQALEDLD-
Y1212_STAAR     ELYQKFEQRREIYDEMKKHLSN----PEQIQRYIQQLEDLE-
Y1320_STAA2     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1295_STAA9     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1252_STAAC     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1236_STAAM     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1226_STAA1     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1206_STAA8     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1170_STAAS     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1146_STAAE     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1129_STAA3     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1119_STAAW     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1100_STAAB     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y1079_STAAN     ELYQKFEQRREIYDEM----KQHLSNPEQIQRYIQQLEDLE-
Y859_STACT      ELYSKFE-QRREIYNQMKASIE----DPDALKRIEELEELE-
Y647_BACAC      VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y4008_BACAA     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3984_BACAN     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3946_BACC3     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3945_BACC4     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3894_BACC7     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3888_BACC1     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3860_BACC0     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3844_BACCR     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3631_BACCQ     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3605_BACCZ     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3587_BACHK     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y3477_BACAH     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
Y1298_BACC2     VLLQKFQERQRLVAKLKQLISEEEHVNEEMKQVVEAIEKLD-
YLXM_BACSU      ------------------------------------------
Y3669_BACWK     VLLQKFQERQRLVAKLKQLLSEEEHVNEEMKQVVEAIEKLD-
Y2891_EXISA     ALFEKFEXXXXXXXXXXXXVE----LTDDVSATISALENLE-
Y2295_BACSK     RLLEKFETRRSLLAELRKAIASDQAVENSLIDRIEKLD----
Y1495_BACP2     ------------------------------------------
Y1766_ANOFW     XXXXXXXXXXXXXHRLKTHIAERYPND---------------
Y1244_CLOBB     NLLQKSMRKEKYIMNFLEELKEKYSVDKDYLMFKEKLENL--
Y2057_DESRM     GLVSKFSQESKSLVEVINLLD---------------------
Y1174_CLOB8     NLLQKSINRKKEIMNFLEHLKNKYSIDDEIIKYKEKLENL--
Y1195_CLOBA     NLLQKSMRKEKYIMNFLEELKEKYSVDKDYLMFKEKLENL--
Y2506_CLOBL     HMFINLENSKEKLLNMLKVTKEN-------------------
Y2498_BACCN     XXXHKFQARQQLVAELKQLINEEEHVNDKMKQVVEDIEKLD-
Y2743_CLOBJ     HMFINLENSKEKLLNMLKVTKEN-------------------
Y2675_CLOB6     HMFINLENSKEKLLNMLKVTKEN-------------------
Y2450_CLOBH     HMFINLENSKEKLLNMLKVTKEN-------------------
Y2314_CLOB1     HMFINLENSKEKLLNMLKVTKEN-------------------
Y2190_CLOBK     HMFINLENSKEKLLNMLKVTKEN-------------------
Y1714_CLOPE     --------------KLSKKVDKRYRIKEELMAELNKNSNLDE
Y1686_CLOPS     --------------KLSKKVDKRYRIKEELMAELNKNSNLDE
Y1714_THEPX     GLVKRHQEIMNKLD----------------------------
Y1278_THEP3     GLVKRHQEIMNKLD----------------------------
Y1827_CLOBM     HMFINLENSKEKLLNMLKVTKEN-------------------
Y771_CLOTH      GLVHKFLQQKNRALEIL-------------------------
Y485_MYCPE      KFIYRFNLRKE----IYKQIKDNNLLDQLLETEVEQL-----
Y1968_CLOP1     --------------KLSKKIDKRYRIKEELMAELNKNSNLDE
Y1464_SYMTH     ------------------------------------------
Y1463_THETN     GL----------------------------------------
Y1400_CLOK5     NL----------------------------------------
Y1296_CLOK1     NL----------------------------------------
P13_MYCMY       HLKQKQDL----LISLINKIETNQIDEKQFIKSLKEV-----
Y2214_CLONN     NLAR--------------------------------------
Y1394_FUSNN     KFYQKKNIRKELVDLKEDFTKEN-------------------
Y1753_CLOAB     KLVEKYK-----------------------------------
Y1504_EUBR3     HLVEKFMSIKSDIRRIHELTNDFKKSHNELL--MNEIEAI--
Y480_MYCCT      ------------------------------------------
Y1247_CLOTE     ------------------------------------------
Y158_UREU1      LIY---------------------------------------
Y148_UREP2      LIY---------------------------------------
Y142_UREPA      LIY---------------------------------------
Y424_MYCPN      ------------------------------------------