[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99526.1

[Show Plain Result]


## Summary of Sequence Search
    1::75
    1::75      2e-41 100%   75 aa  Y716_LACS1 RecName: Full=UPF0346 protein LSL_0716;
    2::73      2e-25  62%   73 aa  Y775_LACRD RecName: Full=UPF0346 protein Lreu_0775;
    2::73      2e-25  62%   73 aa  Y745_LACRJ RecName: Full=UPF0346 protein LAR_0745;
    3::68      4e-25  70%   73 aa  Y1865_LACPL RecName: Full=UPF0346 protein lp_1865;
    2::70      6e-25  65%   74 aa  Y996_LACSS RecName: Full=UPF0346 protein LSA0996;
    1::75      6e-25  63%   75 aa  Y1103_LACJO RecName: Full=UPF0346 protein LJ_1103;
    1::74      2e-24  62%   76 aa  Y976_LACAC RecName: Full=UPF0346 protein LBA0976;
    1::74      2e-24  64%   76 aa  Y1069_LACH4 RecName: Full=UPF0346 protein lhv_1069;
    1::75      2e-24  63%   75 aa  Y911_LACGA RecName: Full=UPF0346 protein LGAS_0911;
    1::74      8e-23  62%   76 aa  Y1277_LACDA RecName: Full=UPF0346 protein Ldb1277;
    1::74      8e-23  62%   76 aa  Y1194_LACDB RecName: Full=UPF0346 protein LBUL_1194;
    3::69      9e-22  63%   80 aa  Y1614_LACCB RecName: Full=UPF0346 protein LCABL_16140;
    3::69      9e-22  63%   80 aa  Y1394_LACC3 RecName: Full=UPF0346 protein LSEI_1394;
    2::70      9e-22  57%   74 aa  Y1063_PEDPA RecName: Full=UPF0346 protein PEPE_1063;
    3::68      6e-21  59%   73 aa  Y790_LACBA RecName: Full=UPF0346 protein LVIS_0790;
    6::71      1e-20  62%   75 aa  Y763_LEUMM RecName: Full=UPF0346 protein LEUM_0763;
    2::69      4e-19  49%   76 aa  Y1017_OENOB RecName: Full=UPF0346 protein OEOE_1017;
    3::68      4e-18  56%   77 aa  Y699_LISMH RecName: Full=UPF0346 protein LMHCC_0699;
    2::67      4e-18  53%   73 aa  Y2292_BACLD RecName: Full=UPF0346 protein BLi02292/BL01432;
    3::68      4e-18  56%   77 aa  Y1971_LISIN RecName: Full=UPF0346 protein lin1971;
    3::68      4e-18  56%   77 aa  Y1885_LISMF RecName: Full=UPF0346 protein LMOf2365_1885;
    3::68      4e-18  56%   77 aa  Y1876_LISW6 RecName: Full=UPF0346 protein lwe1876;
    3::68      4e-18  56%   77 aa  Y1873_LISMC RecName: Full=UPF0346 protein Lm4b_01873;
    3::68      4e-18  56%   77 aa  Y1857_LISMO RecName: Full=UPF0346 protein lmo1857;
    2::68      8e-18  54%   74 aa  Y1950_BACA2 RecName: Full=UPF0346 protein RBAM_019500;
    2::68      2e-17  55%   74 aa  Y1890_BACP2 RecName: Full=UPF0346 protein BPUM_1890;
    2::68      2e-17  51%   74 aa  YOZE_BACSU RecName: Full=UPF0346 protein yozE;
    3::68      1e-16  50%   72 aa  Y1571_GEOKA RecName: Full=UPF0346 protein GK1571;
    3::68      7e-16  50%   72 aa  Y1419_GEOTN RecName: Full=UPF0346 protein GTNG_1419;
    2::69      1e-15  53%   72 aa  Y1680_ENTFA RecName: Full=UPF0346 protein EF_1680;
    2::69      2e-13  44%   71 aa  Y1617_STRSV RecName: Full=UPF0346 protein SSA_1617;
    2::70      3e-13  43%   71 aa  Y954_STRZP RecName: Full=UPF0346 protein SPP_0954;
    2::70      3e-13  43%   71 aa  Y947_STRPN RecName: Full=UPF0346 protein SP_0947;
    2::70      3e-13  43%   71 aa  Y921_STRPS RecName: Full=UPF0346 protein SPCG_0921;
    2::70      3e-13  43%   71 aa  Y874_STRP4 RecName: Full=UPF0346 protein SPG_0874;
    2::70      3e-13  43%   71 aa  Y869_STRPJ RecName: Full=UPF0346 protein SPN23F08690;
    2::70      3e-13  43%   71 aa  Y1051_STRPI RecName: Full=UPF0346 protein SPH_1051;
    2::70      4e-13  43%   71 aa  Y986_STRP7 RecName: Full=UPF0346 protein SP70585_0986;
    2::70      4e-13  43%   71 aa  Y848_STRR6 RecName: Full=UPF0346 protein spr0848;
    2::70      4e-13  43%   71 aa  Y837_STRP2 RecName: Full=UPF0346 protein SPD_0837;
    3::69      4e-13  43%   75 aa  Y1736_OCEIH RecName: Full=UPF0346 protein OB1736;
    2::68      6e-13  42%   71 aa  YCSE_STRTR RecName: Full=UPF0346 protein in cse 5'region;
    2::68      6e-13  42%   71 aa  Y477_STRTD RecName: Full=UPF0346 protein STER_0477;
    2::68      6e-13  42%   71 aa  Y441_STRT2 RecName: Full=UPF0346 protein stu0441;
    2::68      6e-13  42%   71 aa  Y441_STRT1 RecName: Full=UPF0346 protein str0441;
    2::67      6e-13  47%   71 aa  Y2410_BACC7 RecName: Full=UPF0346 protein BCAH187_A2410;
    2::67      6e-13  47%   71 aa  Y2383_BACC3 RecName: Full=UPF0346 protein BCA_2383;
    2::67      6e-13  47%   71 aa  Y2366_BACAA RecName: Full=UPF0346 protein BAA_2366;
    2::67      6e-13  47%   71 aa  Y2336_BACC1 RecName: Full=UPF0346 protein BCE_2336;
    2::67      6e-13  47%   71 aa  Y2302_BACAN RecName: Full=UPF0346 protein
    2::67      6e-13  47%   71 aa  Y2236_BACCQ RecName: Full=UPF0346 protein BCQ_2236;
    2::67      6e-13  47%   71 aa  Y2085_BACHK RecName: Full=UPF0346 protein BT9727_2085;
    2::67      6e-13  47%   71 aa  Y2081_BACCZ RecName: Full=UPF0346 protein BCE33L2081;
    2::68      6e-13  40%   71 aa  Y1568_STRA3 RecName: Full=UPF0346 protein gbs1568;
    2::68      6e-13  40%   71 aa  Y1533_STRA1 RecName: Full=UPF0346 protein SAK_1533;
    2::68      6e-13  40%   71 aa  Y1509_STRA5 RecName: Full=UPF0346 protein SAG1509;
    2::70      1e-12  43%   71 aa  Y886_STRZJ RecName: Full=UPF0346 protein SPJ_0886;
    2::68      1e-12  43%   71 aa  Y487_STRU0 RecName: Full=UPF0346 protein SUB0487;
    2::67      1e-12  47%   71 aa  Y3040_BACC2 RecName: Full=UPF0346 protein BCG9842_B3040;
    2::68      1e-12  40%   69 aa  Y2287_LACLS RecName: Full=UPF0346 protein LACR_2287;
    2::67      1e-12  47%   71 aa  Y2283_BACC4 RecName: Full=UPF0346 protein BCB4264_A2283;
    2::68      1e-12  40%   69 aa  Y2280_LACLM RecName: Full=UPF0346 protein llmg_2280;
    2::67      1e-12  47%   71 aa  Y2253_BACCR RecName: Full=UPF0346 protein BC_2253;
    2::70      1e-12  43%   71 aa  Y1257_STRZT RecName: Full=UPF0346 protein SPT_1257;
    2::68      1e-12  40%   69 aa  YUIB_LACLA RecName: Full=UPF0346 protein yuiB;
    2::67      1e-12  47%   71 aa  Y2120_BACWK RecName: Full=UPF0346 protein BcerKBAB4_2120;
    2::68      4e-12  40%   71 aa  Y510_STRP8 RecName: Full=UPF0346 protein spyM18_0510;
    2::68      4e-12  40%   71 aa  Y467_STRP1 RecName: Full=UPF0346 protein SPy_0467/M5005_Spy0383;
    2::68      4e-12  40%   71 aa  Y408_STRP6 RecName: Full=UPF0346 protein M6_Spy0408;
    2::68      4e-12  40%   71 aa  Y401_STRPB RecName: Full=UPF0346 protein MGAS2096_Spy0401;
    2::68      4e-12  40%   71 aa  Y395_STRPZ RecName: Full=UPF0346 protein Spy49_0395;
    2::68      4e-12  40%   71 aa  Y384_STRPD RecName: Full=UPF0346 protein MGAS10270_Spy0384;
    2::68      4e-12  40%   71 aa  Y383_STRPC RecName: Full=UPF0346 protein MGAS9429_Spy0383;
    2::68      4e-12  40%   71 aa  Y382_STRPF RecName: Full=UPF0346 protein MGAS10750_Spy0382;
    2::68      4e-12  40%   71 aa  Y330_STRP3 RecName: Full=UPF0346 protein SpyM3_0330/SPs1527;
    2::68      4e-12  40%   71 aa  Y1485_STRPG RecName: Full=UPF0346 protein SpyM51485;
    2::67      5e-12  44%   71 aa  Y1690_BACCN RecName: Full=UPF0346 protein Bcer98_1690;
    1::72      8e-12  40%   74 aa  Y997_STAEQ RecName: Full=UPF0346 protein SERP0997;
    2::68      8e-12  40%   71 aa  Y1621_STRMU RecName: Full=UPF0346 protein SMU_1621c;
    1::72      8e-12  40%   74 aa  Y1114_STAES RecName: Full=UPF0346 protein SE_1114;
    2::68      1e-11  40%   83 aa  Y369_STRPM RecName: Full=UPF0346 protein M28_Spy0369;
    2::71      5e-11  40%   73 aa  YCRR_STAAU RecName: Full=UPF0346 protein in crr 3'region;
    2::71      5e-11  40%   73 aa  Y1510_STAA2 RecName: Full=UPF0346 protein SaurJH1_1510;
    2::71      5e-11  40%   73 aa  Y1481_STAA9 RecName: Full=UPF0346 protein SaurJH9_1481;
    2::71      5e-11  40%   73 aa  Y1456_STAAC RecName: Full=UPF0346 protein SACOL1456;
    2::71      5e-11  40%   73 aa  Y1434_STAAR RecName: Full=UPF0346 protein SAR1434;
    2::71      5e-11  40%   73 aa  Y1429_STAA8 RecName: Full=UPF0346 protein SAOUHSC_01429;
    2::71      5e-11  40%   73 aa  Y1421_STAAM RecName: Full=UPF0346 protein SAV1421;
    2::71      5e-11  40%   73 aa  Y1409_STAA1 RecName: Full=UPF0346 protein SAHV_1409;
    2::71      5e-11  40%   73 aa  Y1364_STAAS RecName: Full=UPF0346 protein SAS1364;
    2::71      5e-11  40%   73 aa  Y1358_STAAT RecName: Full=UPF0346 protein USA300HOU_1358;
    2::49      5e-11  50%   71 aa  Y1338_STRS2 RecName: Full=UPF0346 protein SSU98_1338;
    2::49      5e-11  50%   71 aa  Y1322_STRSY RecName: Full=UPF0346 protein SSU05_1322;
    2::71      5e-11  40%   73 aa  Y1314_STAA3 RecName: Full=UPF0346 protein SAUSA300_1314;
    2::71      5e-11  40%   73 aa  Y1311_STAAW RecName: Full=UPF0346 protein MW1311;
    2::71      5e-11  40%   73 aa  Y1276_STAAB RecName: Full=UPF0346 protein SAB1276c;
    2::71      5e-11  40%   73 aa  Y1254_STAAN RecName: Full=UPF0346 protein SA1254;
    3::70      7e-11  37%   73 aa  Y2735_LYSSC RecName: Full=UPF0346 protein Bsph_2735;
    2::68      1e-10  37%   71 aa  Y501_STRS7 RecName: Full=UPF0346 protein SZO_05010;
    2::71      3e-10  40%   73 aa  Y1318_STAS1 RecName: Full=UPF0346 protein SSP1318;
    2::68      3e-10  36%   71 aa  Y1447_STREM RecName: Full=UPF0346 protein Sez_1447;
    2::71      2e-08  37%   73 aa  Y1485_STAHJ RecName: Full=UPF0346 protein SH1485;
    1::75

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
Y716_LACS1      MSKRQSFYQFLMTERNPDSTDEIAQFANNAFYDQSFPKQADDYDSLSQYLELNGTYLPSMVIFDNAWTKY
Y775_LACRD      ---RMSFYQFLMTQRNPNSADEVQQFANNAFFDTTFPKHSEDFDEISHYLEENADYLPSMTIFDEAWQRY
Y745_LACRJ      ---RMSFYQFLMTQRNPNSADEVQQFANNAFFDTTFPKHSEDFDEISHYLEENADYLPSMTIFDEAWQRY
Y1865_LACPL     ----KTFYTFLMTQRNPDSTDAIAEFANNAFLDQSFPKQSKDFHELSQYLELNAGYLPTMTVFDDAWQAY
Y996_LACSS      ---KQSFYRYLMTQRDPNNYEPVAQFANNAFFDQSFPKHEGDYELLSQYLELNGSYLPSMLIFDEAYQLY
Y1103_LACJO     MAYRESFYRFLMTQRNPDSLDDIAEFANNAQHDSSFPKQEEDYEKLSEYLELNAGYLPSMSVFDKAYQLY
Y976_LACAC      MAYRESFYRYLMTQRDADSSDEVAQFANNAQHDLTFPKQEQDYEELSDYLELNASYLPSMSVFDRAYKMY
Y1069_LACH4     MAYRESFYRYLMTQRDADSSDEIAQFANNAQHDLTFPKQEQDYEKLSDYLELNASYLPSMYIFDRAYRMY
Y911_LACGA      MAYRESFYRFLMTQRNPGSADDIAQFANNAQHDSSFPKQEEDYEKLSDYLELNAGYLPSMSVFDKAYQLY
Y1277_LACDA     MAYRQSFYQFLMTLRDPDSNGDLAQFANNAQFDSTFPRQEQDRTRLSEYLEENAAYLPSMTIFDDAYQAY
Y1194_LACDB     MAYRQSFYQFLMTLRDPDSNGDLAQFANNAQFDSTFPRQEQDRTRLSEYLEENAAYLPSMTIFDDAYQAY
Y1614_LACCB     ----RTFYEYLMTLRNPNDHSEIAEFAKNAFLDQSFPKQEKDYHRLSDYLELNGNYLPSMAVFDETYRAY
Y1394_LACC3     ----RTFYEYLMTLRNPNDHSEIAEFAKNAFLDQSFPKQEKDYHRLSDYLELNGNYLPSMAVFDETYRAY
Y1063_PEDPA     ---KKSFFEYLMTQRNPQPNNEVEEFANQAFFDQVFPKQSRDFDEISKYLELNAGYLQSMSIFDSAWQRY
Y790_LACBA      ----KTFYEFLMTQRNPESYEPVASFANNAFLDSAFPKQETQFEPLSKYLEENAPYLPSMTIFDDAWQLY
Y763_LEUMM      ----RSFYNWLMTNRNSMAANEVQQFANNAFLDSSFPKQSSDFDELSQYLEENTTYLMSMTTFDEAWSLY
Y1017_OENOB     --RSRGFYEWLMTQRKPENADEVQEFANAAFFDSEFPKQSQNFDEISKYLEENAPYLMSMEVFDEAWRRF
Y699_LISMH      ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWDAY
Y2292_BACLD     ----KSFYHYLMKYRHPKPKDAISEFANHAYLDHGFPKASTHYDEISSYLELNGDYLSSMTTFDEAWERY
Y1971_LISIN     ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWEAY
Y1885_LISMF     ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWDAY
Y1876_LISW6     ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWDAY
Y1873_LISMC     ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWDAY
Y1857_LISMO     ----RSFYHFLMTYRDPKLTDQKTEFANNAYRDHSFPKQTRNYHILCDYLEFNAPYLPGMSIFDELWDAY
Y1950_BACA2     ----KSFYHYLMKYRHPKPQDAISQFANQAYEDHGFPKTSSDYHELSSYLELSADYLETMATFDEAWEKY
Y1890_BACP2     ----KSFYHYLMKYRHPKPKDEISHFANAAYEDHSFPKASTDYHELSVYLELNGDYLSSMTTFDEAFEQY
YOZE_BACSU      ----KSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQY
Y1571_GEOKA     ----KSFYRYLLRFRHGHQEDPVVRFANGAYEDHSFPKGSTDYEELSGYLELNGDYLESMVVFDELWEQF
Y1419_GEOTN     ----KSFYRYLLRFRHGYEEDPVVRFANGAYDDHGFPKGSADYEELSGYLELNGDYLESMVIFDELWEQF
Y1680_ENTFA     ---RRSFYHYLMTLKGP-AKDSETDFANEAAKDIQFPKQTEDYHELSSYLEMNADYLSNMDIFDELWEKY
Y1617_STRSV     ---RKSFYSWLMTERNPKSKEPKAILADLAFQDTAFPKHTDDFDEVSRFLEEHANFSFNLGEFDAIWEEY
Y954_STRZP      ---RKSFYTWLMTERNPKSNNPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y947_STRPN      ---RKSFYTWLMTERNPKSNSPKAILADLAFEESAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y921_STRPS      ---RKSFYTWLMTERNPKSNSPKAILADLAFEESAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y874_STRP4      ---RKSFYTWLMTERNPKSNSPKAILADLAFEESAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y869_STRPJ      ---RKSFYTWLMTERNPKSNSPKAILADLAFEESAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y1051_STRPI     ---RKSFYTWLMTERNPKSNSPKAILADLAFEESAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y986_STRP7      ---RKSFYTWLMTERNPKSNSPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y848_STRR6      ---RKSFYTWLMTERNPKSNSPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y837_STRP2      ---RKSFYTWLMTERNPKSNSPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDSIWQEY
Y1736_OCEIH     ----QTFYQFLMTYRGKLEKDDNSELAEWAFRNHNFPKHSNTYDEISNYLEWNSPFPSATVTFDSLWNEY
YCSE_STRTR      ---RKSFYTWLMAQRNPKSNEPVAILADLAFEDSTFPKHTDDFEEVSRYLEDHASFSFNLGQFDQIWEDY
Y477_STRTD      ---RKSFYTWLMAQRNPKSNEPVAILADLAFEDSTFPKHTDDFEEVSRYLEDHASFSFNLGQFDQIWEDY
Y441_STRT2      ---RKSFYTWLMAQRNPKSNEPVAILADLAFEDSTFPKHTDDFEEVSRYLEDHASFSFNLGQFDQIWEDY
Y441_STRT1      ---RKSFYTWLMAQRNPKSNEPVAILADLAFEDSTFPKHTDDFEEVSRYLEDHASFSFNLGQFDQIWEDY
Y2410_BACC7     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2383_BACC3     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2366_BACAA     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2336_BACC1     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLASMSIFDEAWELY
Y2302_BACAN     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2236_BACCQ     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2085_BACHK     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2081_BACCZ     ---KKTFYHYMMKHRAALFSNEISNLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y1568_STRA3     ---RKSFYSWLMTQRNPKSNEPVAILADYAFDETTFPKHSSDFETVSRYLEDEASFSFNLTDFDDIWEDY
Y1533_STRA1     ---RKSFYSWLMTQRNPKSNEPVAILADYAFDETTFPKHSSDFETVSRYLEDEASFSFNLTDFDDIWEDY
Y1509_STRA5     ---RKSFYSWLMTQRNPKSNEPVAILADYAFDETTFPKHSSDFETVSRYLEDEASFSFNLTDFDDIWEDY
Y886_STRZJ      ---RKSFYTWLMTERNPKSNSPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDAIWQEY
Y487_STRU0      ---RKSFYSWLMTQRNPKSDEPVAILADLAFDDTTFPKHSDDFEVISRYLEDQAIFSFNLGHFDAIWEDY
Y3040_BACC2     ---KKTFYHYMMKHRAALFRNEISDLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2287_LACLS     -----TFYNYLMRHRAPVEKDDATRLANLVFQDPLFPKQSKDFDEISTYLETEAPFYFNLTLFDNVWLSY
Y2283_BACC4     ---KKTFYHYMMKHRAALFRNEISDLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y2280_LACLM     -----TFYNYLMRHRAPVEKDDATRLANLVFQDPLFPKQSKDFDEISTYLETEAPFYFNLTLFDNVWLSY
Y2253_BACCR     ---KKTFYHYMMKHRAALFRNEISDLAEAMYDDLSFPKQSEDYDEISSYLELSG-MLESMSIFDEAWDLY
Y1257_STRZT     ---RKSFYTWLMTERNPKSNSPKAILADLAFEEAAFPKHTDDFDEVSRFLEEHASFSFNLGDFDAIWQEY
YUIB_LACLA      -----TFYNYLMRHRAPVEKDDATRLANLVFQDPLFPKQSKDFDEISTYLETQAPFYFNLTLFDNIWESY
Y2120_BACWK     ---KKTFYHYMMKHRAALFKNEISDLAEAMYDDLSFPKQSEDYDVISSYLELSG-MLESMSIFDDAWDLY
Y510_STRP8      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y467_STRP1      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y408_STRP6      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y401_STRPB      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y395_STRPZ      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y384_STRPD      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y383_STRPC      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y382_STRPF      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y330_STRP3      ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y1485_STRPG     ---RKSFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
Y1690_BACCN     ---KKTFYHYMMKHRAPLVKNEISDLAEAIYDDLSFPKQSEDYHEISSYLECSG-LIESMSIFDKAWDLY
Y997_STAEQ      MVKNYSFYQFIMTVRG--RKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSVFDDLYDDY
Y1621_STRMU     ---RKSFYTWLMTQRHPKSHDPVAILADLVFEDTTFPKHTDSFERVSRYLEDEASFSFNLSEFDRIWEDY
Y1114_STAES     MVKNYSFYQFIMTVRG--RKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSVFDDLYDDY
Y369_STRPM      ---RKSFYSWLMTQRNPKSNAPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDY
YCRR_STAAU      --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1510_STAA2     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1481_STAA9     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1456_STAAC     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1434_STAAR     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1429_STAA8     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1421_STAAM     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1409_STAA1     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1364_STAAS     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1358_STAAT     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1338_STRS2     ---RRSFYSWLMTQRNPKSNEPVAILADYAFDESDFPKQSDNFDEVSRFLE-------------------
Y1322_STRSY     ---RRSFYSWLMTQRNPKSNEPVAILADYAFDESDFPKQSDNFDEVSRFLE-------------------
Y1314_STAA3     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1311_STAAW     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1276_STAAB     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y1254_STAAN     --KNYSFYQFVMTVRGRH--DDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEY
Y2735_LYSSC     ---KKSFYLYVLTFRGGDWSDPKVRFAEEMFHEHNFPKQSTDFNELSNYIESYATENLTIEAFDHLWELY
Y501_STRS7      ---RKAFYTWLMAQRNSTSNKPAALLADLVFEDTTFPKHTDDFETISRYLEEEASFSFNLGQFDQIWEDY
Y1318_STAS1     --KDHSFYHFALTARG--RKDEKGELAEEIFDDLSFPKHEKDFHILSDYIETQGHYTISLSVFDDLYEEY
Y1447_STREM     ---RKAFYTWLMAQRHSTSNKPAALLADLVFEDTTFPKHTDDFETISRYLEEEASFAFNLGQFDQIWEDY
Y1485_STAHJ     --KEHSFYQFALTVRG--RKDSKGDLAEEIFNDLSFPKHEKDFNQLSDYIEMQSDISVPMSEFDDLYEEY


                         .         .         *         .         .         .         .:140
query           EEFMS
Y716_LACS1      EEFMS
Y775_LACRD      IDAMN
Y745_LACRJ      IDAMN
Y1865_LACPL     -----
Y996_LACSS      QE---
Y1103_LACJO     LDNMN
Y976_LACAC      EEKM-
Y1069_LACH4     EDKM-
Y911_LACGA      LDNMN
Y1277_LACDA     EEKM-
Y1194_LACDB     EEKM-
Y1614_LACCB     E----
Y1394_LACC3     E----
Y1063_PEDPA     LE---
Y790_LACBA      -----
Y763_LEUMM      -----
Y1017_OENOB     -----
Y699_LISMH      -----
Y2292_BACLD     -----
Y1971_LISIN     -----
Y1885_LISMF     -----
Y1876_LISW6     -----
Y1873_LISMC     -----
Y1857_LISMO     -----
Y1950_BACA2     E----
Y1890_BACP2     D----
YOZE_BACSU      E----
Y1571_GEOKA     -----
Y1419_GEOTN     -----
Y1680_ENTFA     LE---
Y1617_STRSV     Q----
Y954_STRZP      LE---
Y947_STRPN      LE---
Y921_STRPS      LE---
Y874_STRP4      LE---
Y869_STRPJ      LE---
Y1051_STRPI     LE---
Y986_STRP7      LE---
Y848_STRR6      LE---
Y837_STRP2      LE---
Y1736_OCEIH     E----
YCSE_STRTR      -----
Y477_STRTD      -----
Y441_STRT2      -----
Y441_STRT1      -----
Y2410_BACC7     -----
Y2383_BACC3     -----
Y2366_BACAA     -----
Y2336_BACC1     -----
Y2302_BACAN     -----
Y2236_BACCQ     -----
Y2085_BACHK     -----
Y2081_BACCZ     -----
Y1568_STRA3     -----
Y1533_STRA1     -----
Y1509_STRA5     -----
Y886_STRZJ      LE---
Y487_STRU0      -----
Y3040_BACC2     -----
Y2287_LACLS     LE---
Y2283_BACC4     -----
Y2280_LACLM     LE---
Y2253_BACCR     -----
Y1257_STRZT     LE---
YUIB_LACLA      LE---
Y2120_BACWK     -----
Y510_STRP8      -----
Y467_STRP1      -----
Y408_STRP6      -----
Y401_STRPB      -----
Y395_STRPZ      -----
Y384_STRPD      -----
Y383_STRPC      -----
Y382_STRPF      -----
Y330_STRP3      -----
Y1485_STRPG     -----
Y1690_BACCN     -----
Y997_STAEQ      TEWL-
Y1621_STRMU     -----
Y1114_STAES     TEWL-
Y369_STRPM      -----
YCRR_STAAU      TEWL-
Y1510_STAA2     TEWL-
Y1481_STAA9     TEWL-
Y1456_STAAC     TEWL-
Y1434_STAAR     TEWL-
Y1429_STAA8     TEWL-
Y1421_STAAM     TEWL-
Y1409_STAA1     TEWL-
Y1364_STAAS     TEWL-
Y1358_STAAT     TEWL-
Y1338_STRS2     -----
Y1322_STRSY     -----
Y1314_STAA3     TEWL-
Y1311_STAAW     TEWL-
Y1276_STAAB     TEWL-
Y1254_STAAN     TEWL-
Y2735_LYSSC     E----
Y501_STRS7      -----
Y1318_STAS1     TEWL-
Y1447_STREM     -----
Y1485_STAHJ     IEWL-