[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99574.1

[Show Plain Result]


## Summary of Sequence Search
    1::203
   29::85      8e-06  37%  101 aa  Y53_BPT3 RecName: Full=Uncharacterized gene 5.3 protein;
    1::38      5e-05  37%  121 aa  Y38_BPT7 RecName: Full=Uncharacterized gene 3.8 protein;
    1::203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y53_BPT3        ----------------------------------------------------------------------
Y38_BPT7        ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYGKYTLVKVKRDGSKYEKWKPKQVHIWEQHNGPLPKGYI
Y53_BPT3        -------------------------------YFRYSIGSSRKGEKKFHRW------VWEQHKGPIPDGYE
Y38_BPT7        ---------------------------------------MRKSYKQFYKAPRRHIQVWEAANGPIPKGYY


                         +         .         .         .         .         *         .:210
query           ITFIDGDKSNLNIDNLACIKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y53_BPT3        IDHICLNRGCCNVEHLQCIPK------------------------------------------
Y38_BPT7        IDHIDGN--------------------------------------------------------