[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99636.1

[Show Plain Result]


## Summary of Sequence Search
    1::298
   13::301     4e-95  58%  303 aa  YLYB_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   27::312     8e-68  47%  316 aa  Y901_CHLAA RecName: Full=Uncharacterized RNA pseudouridine synthase
   17::313     5e-67  46%  316 aa  Y1758_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
   33::325     4e-65  47%  327 aa  Y1629_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
   16::311     1e-62  46%  317 aa  RLUD_ZYMMO RecName: Full=Ribosomal large subunit pseudouridine
   19::314     1e-56  48%  325 aa  RLUD_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   10::312     3e-56  46%  325 aa  RLUD_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   18::311     7e-56  44%  324 aa  RLUD_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   19::312     2e-54  42%  325 aa  RLUD_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   44::332     2e-53  41%  344 aa  RLUD_NITEU RecName: Full=Ribosomal large subunit pseudouridine
   13::318     2e-52  42%  327 aa  Y723_CHLP8 RecName: Full=Uncharacterized RNA pseudouridine synthase
   19::312     5e-52  42%  325 aa  RLUD_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   19::311     8e-52  42%  320 aa  RLUD_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   19::310     2e-51  46%  326 aa  RLUD_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   19::310     2e-51  44%  326 aa  RLUD_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   19::310     2e-51  46%  326 aa  RLUD_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   19::310     5e-51  45%  326 aa  RLUD_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   18::311     1e-50  42%  324 aa  RLUD_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   39::332     6e-50  41%  374 aa  RLUD_NEIMB RecName: Full=Ribosomal large subunit pseudouridine
   26::318     8e-50  39%  331 aa  RLUD_XYLFT RecName: Full=Ribosomal large subunit pseudouridine
   26::318     8e-50  39%  331 aa  RLUD_XYLFA RecName: Full=Ribosomal large subunit pseudouridine
   19::312     8e-50  40%  326 aa  RLUD_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   19::312     8e-50  40%  326 aa  RLUD_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   39::332     8e-50  42%  374 aa  RLUD_NEIMA RecName: Full=Ribosomal large subunit pseudouridine
   26::318     2e-49  39%  331 aa  RLUD_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   26::318     2e-48  38%  331 aa  RLUD_XANAC RecName: Full=Ribosomal large subunit pseudouridine
   20::315     3e-48  40%  317 aa  RLUD_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   19::309     3e-48  42%  312 aa  RLUD_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   16::308     4e-48  40%  326 aa  RLUD_BORBU RecName: Full=Ribosomal large subunit pseudouridine
   19::312     6e-48  41%  324 aa  RLUD_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   17::320     6e-47  38%  321 aa  RLUD_BLOFL RecName: Full=Ribosomal large subunit pseudouridine
   25::279     4e-46  40%  283 aa  YJBO_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   51::350     2e-45  41%  358 aa  RLUD_RALSO RecName: Full=Ribosomal large subunit pseudouridine
   88::425     6e-45  43%  445 aa  PUS2_ORYSJ RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   45::296     3e-44  42%  302 aa  YHCT_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   83::422     1e-43  40%  430 aa  PUS2_ARATH RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   19::315     1e-41  35%  315 aa  RLUD_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   12::297     3e-40  37%  309 aa  Y292_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
   21::311     9e-38  36%  315 aa  RLUC_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   21::313     2e-37  36%  315 aa  RLUC_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   21::313     2e-36  34%  314 aa  RLUC_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   13::315     1e-35  35%  319 aa  RLUC_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   13::315     1e-35  35%  319 aa  RLUC_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   22::319     2e-35  36%  326 aa  RLUC_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   13::315     2e-35  35%  319 aa  RLUC_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   21::314     2e-35  35%  315 aa  RLUC_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   13::315     3e-35  35%  319 aa  RLUC_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   13::315     4e-35  35%  319 aa  RLUC_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   13::315     7e-35  35%  319 aa  RLUC_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   14::316     7e-35  34%  320 aa  RLUC_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   21::312     9e-35  36%  315 aa  RLUC_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
  124::304     1e-34  43%  308 aa  Y1567_MYCBO RecName: Full=Uncharacterized RNA pseudouridine
  124::304     1e-34  43%  308 aa  Y1540_MYCTU RecName: Full=Uncharacterized RNA pseudouridine
   21::318     2e-33  34%  322 aa  RLUC_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   21::313     4e-33  33%  314 aa  RLUC_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   25::288     7e-33  36%  308 aa  Y209_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
   25::304     1e-30  35%  327 aa  Y745_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   27::216     9e-30  40%  219 aa  RLUA_PASMU RecName: Full=Ribosomal large subunit pseudouridine
  106::304     6e-28  39%  327 aa  Y745_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
   59::231     2e-27  38%  245 aa  RLUA_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   13::315     2e-26  32%  320 aa  RLUC_YERPE RecName: Full=Ribosomal large subunit pseudouridine
  141::317     4e-26  43%  318 aa  RLUC_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   59::212     3e-25  41%  250 aa  RLUA_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
  127::366     5e-25  30%  462 aa  YDL36_YEAST RecName: Full=Uncharacterized protein YDL036C;
   27::212     5e-25  40%  250 aa  RLUA_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   88::241     7e-25  41%  242 aa  Y956_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
   88::241     1e-24  41%  242 aa  Y956_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   12::301     4e-24  31%  301 aa  RLUC_RICBR RecName: Full=Ribosomal large subunit pseudouridine
   51::217     6e-24  38%  219 aa  Y505_ZYMMO RecName: Full=Uncharacterized RNA pseudouridine synthase
   27::215     6e-24  37%  219 aa  RLUA_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   86::323     1e-23  29%  432 aa  YK27_CAEEL RecName: Full=Uncharacterized protein K07E8.7;
   15::231     2e-23  40%  239 aa  TRUC_HAEIN RecName: Full=tRNA pseudouridine synthase C;       
   10::298     3e-23  30%  305 aa  RLUC_RICFE RecName: Full=Ribosomal large subunit pseudouridine
   47::200     3e-23  39%  206 aa  RLUA_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   27::216     4e-23  38%  219 aa  RLUA_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   27::216     4e-23  38%  219 aa  RLUA_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   27::216     4e-23  38%  219 aa  RLUA_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   10::302     5e-23  31%  303 aa  RLUC_RICCN RecName: Full=Ribosomal large subunit pseudouridine
   27::216     8e-23  37%  219 aa  RLUA_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   60::216     1e-22  39%  219 aa  RLUA_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   12::300     2e-22  28%  303 aa  RLUC_RICPR RecName: Full=Ribosomal large subunit pseudouridine
   60::216     3e-22  38%  219 aa  RLUA_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   27::216     5e-22  34%  222 aa  RLUA_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   74::311     3e-21  35%  395 aa  PUS7_ARATH RecName: Full=RNA pseudourine synthase 7;       
   47::281     4e-21  28%  394 aa  YA32_SCHPO RecName: Full=Uncharacterized protein C18B11.02c;
   37::227     6e-21  38%  293 aa  RUSD1_DANRE RecName: Full=RNA pseudouridylate synthase
   16::230     1e-20  37%  243 aa  TRUC_HAEDU RecName: Full=tRNA pseudouridine synthase C;       
   12::302     1e-20  27%  303 aa  RLUC_RICTY RecName: Full=Ribosomal large subunit pseudouridine
  100::330     1e-20  30%  591 aa  RIB2_YEAST RecName: Full=DRAP deaminase;
  236::429     2e-20  36%  545 aa  RUSD2_HUMAN RecName: Full=RNA pseudouridylate synthase
   16::236     1e-19  36%  243 aa  TRUC_PASMU RecName: Full=tRNA pseudouridine synthase C;       
  125::296     2e-19  37%  393 aa  PUS7_ORYSJ RecName: Full=RNA pseudourine synthase 7;       
  249::442     4e-19  35%  553 aa  RUSD2_MOUSE RecName: Full=RNA pseudouridylate synthase
   15::231     2e-18  36%  257 aa  TRUC_YERPE RecName: Full=tRNA pseudouridine synthase C;       
   39::194     3e-18  38%  306 aa  RUSD1_MOUSE RecName: Full=RNA pseudouridylate synthase
  127::390     3e-18  38%  397 aa  PUS5_ORYSJ RecName: Full=RNA pseudourine synthase 5;       
   64::229     8e-18  39%  308 aa  RUSD1_BOVIN RecName: Full=RNA pseudouridylate synthase
   19::234     1e-17  34%  246 aa  TRUC_VIBPA RecName: Full=tRNA pseudouridine synthase C;       
  132::304     2e-17  35%  404 aa  PUS6_YEAST RecName: Full=Pseudouridylate synthase 6;       
   39::194     5e-17  38%  312 aa  RUSD1_HUMAN RecName: Full=RNA pseudouridylate synthase
   15::231     9e-17  34%  244 aa  TRUC_VIBCH RecName: Full=tRNA pseudouridine synthase C;       
  129::335     1e-16  35%  376 aa  TRUC_PECCC RecName: Full=tRNA pseudouridine synthase C;       
   15::235     3e-16  31%  245 aa  TRUC_VIBVU RecName: Full=tRNA pseudouridine synthase C;       
   82::294     4e-16  31%  298 aa  Y347_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
   16::185     7e-16  33%  224 aa  Y042_HAEIN RecName: Full=Uncharacterized RNA pseudouridine synthase
   17::299     1e-15  29%  323 aa  Y370_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
   14::273     2e-15  25%  291 aa  Y1592_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
   16::290     3e-15  28%  326 aa  Y548_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
   82::292     1e-14  30%  293 aa  Y347_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
  196::376     1e-14  37%  477 aa  PUS4_ARATH RecName: Full=RNA pseudourine synthase 4, mitochondrial;
   15::237     1e-13  32%  260 aa  TRUC_ECOL6 RecName: Full=tRNA pseudouridine synthase C;       
   56::295     1e-13  30%  369 aa  PUS5_ARATH RecName: Full=RNA pseudourine synthase 5;       
  129::334     1e-13  41%  345 aa  PUS1_ORYSJ RecName: Full=RNA pseudourine synthase 1;       
   15::237     3e-13  32%  260 aa  TRUC_SHIFL RecName: Full=tRNA pseudouridine synthase C;       
   15::237     3e-13  32%  260 aa  TRUC_ECOLI RecName: Full=tRNA pseudouridine synthase C;       
   15::237     3e-13  32%  260 aa  TRUC_ECO57 RecName: Full=tRNA pseudouridine synthase C;       
   15::231     1e-12  31%  260 aa  TRUC_SALTY RecName: Full=tRNA pseudouridine synthase C;       
   15::231     1e-12  31%  260 aa  TRUC_SALTI RecName: Full=tRNA pseudouridine synthase C;       
  225::373     8e-12  40%  478 aa  PUS3_ARATH RecName: Full=RNA pseudourine synthase 3, mitochondrial;
  189::354     2e-11  31%  448 aa  PUS4_ORYSJ RecName: Full=RNA pseudourine synthase 4, mitochondrial;
  110::289     4e-11  31%  377 aa  RUSD4_HUMAN RecName: Full=RNA pseudouridylate synthase
   88::316     4e-11  33%  322 aa  PUS1_ARATH RecName: Full=RNA pseudourine synthase 1;       
  110::289     5e-11  31%  377 aa  RUSD4_RAT RecName: Full=RNA pseudouridylate synthase
   62::308     7e-11  32%  324 aa  RUSD4_XENTR RecName: Full=RNA pseudouridylate synthase
  110::289     3e-10  33%  377 aa  RUSD4_BOVIN RecName: Full=RNA pseudouridylate synthase
  223::371     5e-10  37%  475 aa  PUS3_ORYSJ RecName: Full=RNA pseudourine synthase 3, mitochondrial;
  110::289     7e-09  28%  377 aa  RUSD4_MOUSE RecName: Full=RNA pseudouridylate synthase
 7392::7453    7e-09  52% 10061 aa  MLRR1_PLAF7 RecName: Full=MATH and LRR domain-containing protein
   29::277     2e-07  23%  302 aa  Y714_MYCCT RecName: Full=Uncharacterized RNA pseudouridine synthase
   16::198     4e-07  32%  247 aa  PUS5_CANAL RecName: Full=Pseudouridylate synthase PUS5;       
  102::351     6e-07  29%  358 aa  RUSD4_DANRE RecName: Full=RNA pseudouridylate synthase
   64::170     6e-07  38%  260 aa  PUS5_ASHGO RecName: Full=Pseudouridylate synthase PUS5;       
   67::185     2e-06  32%  254 aa  PUS5_YEAST RecName: Full=Pseudouridylate synthase PUS5;       
   86::259     3e-06  29%  343 aa  RUSD3_HUMAN RecName: Full=RNA pseudouridylate synthase
   87::260     5e-06  28%  344 aa  RUSD3_BOVIN RecName: Full=RNA pseudouridylate synthase
   87::260     7e-06  32%  344 aa  RUSD3_MOUSE RecName: Full=RNA pseudouridylate synthase
   17::201     3e-05  27%  249 aa  Y1464_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
   15::207     4e-05  22%  262 aa  YE59_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   15::207     8e-05  23%  262 aa  Y1459_HELPY RecName: Full=Uncharacterized RNA pseudouridine
   96::143     2e-04  45%  205 aa  RS4_DEIRA RecName: Full=30S ribosomal protein S4;
   84::131     3e-04  40%  192 aa  RS4B_CLOAB RecName: Full=Putative 30S ribosomal protein S4 B;
  372::399     3e-04  57%  472 aa  PUS6_ARATH RecName: Full=RNA pseudourine synthase 6, chloroplastic;
  366::394     6e-04  55%  477 aa  PUS6_ORYSJ RecName: Full=RNA pseudourine synthase 6, chloroplastic;
  100::161     8e-04  39%  209 aa  RS4_NATTJ RecName: Full=30S ribosomal protein S4;
   97::144     8e-04  43%  206 aa  RS4_DEIGD RecName: Full=30S ribosomal protein S4;
   97::144     8e-04  43%  206 aa  RS4_DEIDV RecName: Full=30S ribosomal protein S4;
  100::160     8e-04  35%  210 aa  RS4_ALCBS RecName: Full=30S ribosomal protein S4;
    1::298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
YLYB_BACSU      ---------KSERIDKFLASTENDWSRTQVQQWVKDGQVVVNGSAVKANYKIQPGDQVTVTVPEPEALDV
Y901_CHLAA      ------------RIDRFLAGAMPDLSRAQVQRLIEQGFVLYDGRSPRASQPVRPGAVIQLTIPPPIPTEL
Y1758_AQUAE     ------------RLDKFLARAYPDFSRSYIKKLVKEGLVYVNGEVRKPSRKLREGERVILHVPEPEPLDV
Y1629_SYNY3     ------------RLDKWLAEQLPELSRSRCQKLIESGQVQRNGLVQDKNLILKTGDRLVVNIPELIPLDV
RLUD_ZYMMO      ------------RLDRALASLITRLSRERLKNLISSGCVSNSQGVRDPAFKIKSLDCFTVDIPLPRPAHN
RLUD_VIBPA      ------------RLDQAIAELFADFSRSRLKEWLLDGKVQVNGEVTKPRTKVMGGEEITLQAELEDEERW
RLUD_HAEDU      ----EISADLLGRLDQALAQLFPDYSRSRIKVWIENDLVKVNGIVNRARGKVFGGXXXXXXXXXXXXXRF
RLUD_PASMU      ------------RLDQALAELFPDYSRSRLKTWIEQNLVHVNGDVVNVRAKVYGGEQIEIVVEIDDDTRF
RLUD_VIBVU      ------------RLDQAIAELFADFSRSRLKEWLLDGKVTVDGNVTKPRTKVMGGEVITVLAELEDEVRW
RLUD_NITEU      ------------RLDQALAQLLPQWSRSRLQGWIEQKCVSVDSAAATCKQKVWGGESIRVIAGQTENQSH
Y723_CHLP8      ------------RIDRYLTQQVENMTRNKVQAAIEEGRVLVNGKPVKSNYRVKSCDHITFLRPPAPELA-
RLUD_YERPE      ------------RLDQALAELFPDYSRSRIKEWILDSRVTVNGKINKPKEKVLGGELVAIDAQIEEDARW
RLUD_PSEAE      ------------RLDQIAAQLFPEHSRSRLAGWIKDGRLTVDGAVLRPRDIVHSGAQLVLEAEQEAQGEW
RLUD_SHIFL      ------------RLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVDKPKEKVLGGEQVAINAEIEEEARF
RLUD_ECOLI      ------------RLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVDKPKEKVLGGEQVAINAEIEEEARF
RLUD_ECOL6      ------------RLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVDKPKEKVLGGEQVAINAEIEEEARF
RLUD_ECO57      ------------RLDQALAEMFPDYSRSRIKEWILDQRVLVNGKLDKPKEKVLGGEQVAINAEIEEEARF
RLUD_HAEIN      ------------RLDQTLAELFPEYSRSRLKTWIEADLVKLNDRITNIREKVLGGERXXXXXXXXDETRF
RLUD_NEIMB      -----------GRLDAVLAKLLPDYSRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTRPSEENLAF
RLUD_XYLFT      ------------RFDAVLAELFPEFSRSRLTEWIKSGDVLLNGVLVRPRDPVYGGEVVWLQVMPDIRTDA
RLUD_XYLFA      ------------RFDAVLAELFPEFSRSRLTEWIKSGDVLLNGVLVRPRDPVYGGEVVRLQVVPDIRTDA
RLUD_SALTY      ------------RLDQALAEMFPDYSRSRIKEWILNQRVLVNGQLDKPKEKVLGGERVAIDAEIDEEIRF
RLUD_SALTI      ------------RLDQALAEMFPDYSRSRIKEWILNQRVLVNGQLDKPKEKVLGGERVAIDAEIDEEIRF
RLUD_NEIMA      -----------GRLDAVLAKLLPDYSRSRLTLWIKEGAVIVNDKPSQPKDKMIGGEQIRVTRPSEENLAF
RLUD_XANCP      ------------RFDAVLAELFPEFSRSRLSEWIKSGDALLDGETARPRDTLRGGXXXXXXXXXXXXXHA
RLUD_XANAC      ------------RFDAVLAELFPEFSRSRLSEWIKSGDALLDGEMARPRDTLRGGESVQVQVVLETQTHA
RLUD_BUCBP      ------------RLDQVLASLFKKHSRTILKRHILSKDVCVNGRIDQPDAKVLYKDIISINLKFKAKNDY
RLUD_BUCAI      ------------RLDLVLSKLFREYSRSYLKKLIIMNQVLVNESIVNQPDKKILGGETLTIHPFSKDLLV
RLUD_BORBU      ------------RLDLYLSGNFEVFTRSQIKRRNVEAFKKSNGKFLKIKLSVFKDDEILFDEESSQIDCL
RLUD_VIBCH      ------------RLDQAVAELFTDFSRSRLKEWLLEGKIAVNGDVTKPRTKVMGGEVITVQAELEDEQRW
RLUD_BLOFL      ------------RLDYILSKLLPQYSRSQIKHWILNKKVVVNNQVKKVVYGELIEIKYINNNDICKSEDI
YJBO_BACSU      ------------------------------------GDLQINGEHVTVKYVLKEGDLLIVKFPEEQSETL
RLUD_RALSO      ------------RLDKALAKLLPDYSRSRLQQWIDXXXXXXXXXXXXXXXXXXXXDRI-----EVVPQRA
PUS2_ORYSJ      -------------------------SRARIQASIRAGLVVVNGPVSKVSHMVKGGDIVSCTVLELQPLRA
YHCT_BACSU      --------------------------------------IKVNHESVLNNMIVKKGDRVFIDLQESEASSV
PUS2_ARATH      ------------RLDSWISSRINGVSRARVQSSIRLGLVTVNGRVDKVSHNVKSGDEVNCTISELQPLKA
RLUD_BUCAP      ------------RLDQILSKLFMQYSRSCLKKWIIMNNVYINGKIEQPDKKILGGEKITIYSTDEKLPIN
Y292_MYCPN      ------------RLDTFLATLL-NLSRVKVAKLIVDGLVSVNGKKITKNVHVNWSEEL-FEKVPVE---V
RLUC_VIBVU      ------------RIDNFLRNQLKDVPKSMIYRIVRKGEVRVNKKRVKAEYKLAAGDVVRI--PPVTLEKK
RLUC_VIBPA      ------------RIDNFLRNQLKDIPKSMIYRIVRKGEVRVNKKRIKAEYKLKAGDPVTVEKKEEDKLNK
RLUC_BUCAP      ------------RIDNFLQKKLKNVPRSMIYRIIRTGKIRINKKRIKPDYKLKIGDKLRIPPIKIKKSSL
RLUC_SHIFL      -----ITADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDXXXXXSPHLQKVAA
RLUC_ECOLI      -----ITADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDXXXXXSPHLQKVAA
RLUC_PASMU      --------DEAGRIDNYLLAKLKGVPKSLIYRILRKGEVRVNKGRIKPEYKLQANDIVRVPPVRVSEKEH
RLUC_ECOL6      -----ITADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDXXXXXSPHLQKVAA
RLUC_BUCBP      ------------RIDNFLRKTFKRLPFNLICKIIRTGQIRINKKRINQNYKLKLGDSITIQSDSNKKIKL
RLUC_ECO57      -----ITADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDXXXXXSPHLQKVAA
RLUC_SALTI      -----IAADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLESGDXXXXXSPHLQKVAA
RLUC_SALTY      -----IAADEAGRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDXXXXXSPHLQKVAA
RLUC_HAEDU      ---FTISDDEAGRLDNFLLAKLKGVPKSLIYRIVRKGEVRVNKGRVKPDYKLQHNDIVRIPLVRVTPKNE
RLUC_VIBCH      ------------RIDNFLRNQLKNIPKSVVYRILRKGEVRVNKKRVKAEYKLEAGDXXXXXXPPSTKLSK
Y1567_MYCBO     ----------------------------------------------------------------------
Y1540_MYCTU     ----------------------------------------------------------------------
RLUC_HAEIN      --------DESGRIDNYLLAKLKGVPKSLIYRIVRKGEVRVNKGRIKPEYKLQTGDVVRIPPVRVAEKND
RLUC_BUCAI      ------------RIDNFMRSKFKSVPKSMIYRIIRTGKIRINKKRIKPHYKLKIGDILKI--PPIKILDI
Y209_MYCGE      --------------------------RVKVVKLIMNGQIKVNEKLTFKNIKVEIHDETTSDFIT----SV
Y745_HELPJ      -------------------------SKNQVLNLIKEGLVFCQKEVKKGGLALKEGDAITLLTPKIVPKPL
RLUA_PASMU      ----------------------------------------------------------------------
Y745_HELPY      ----------------------------------------------------------------------
RLUA_VIBCH      ----------------------------------------------------------------------
RLUC_YERPE      -----ISADEAGRIDNFLLAKLKGVPKSMIYRIVRKGEVRVNKGRIKPEYKLADGDXXXXXXXXXXXXXX
RLUC_PSEAE      ----------------------------------------------------------------------
RLUA_VIBPA      ----------------------------------------------------------------------
YDL36_YEAST     ------------KLVDVFISEFRDRESEYYKRTIENGDVHINDETADLSTVIRNGDLITH---QVHRHEP
RLUA_VIBVU      ----------------------------------------------------------------------
Y956_HELPY      ----------------------------------------------------------------------
Y956_HELPJ      ----------------------------------------------------------------------
RLUC_RICBR      ------------RLDKYLRRLYPLLTQGVIEKALRQKQIIVNSKKAEASLRVVEGDEIKFNLPQPTKLVF
Y505_ZYMMO      ----------------------------------------------------------------------
RLUA_HAEIN      ----------------------------------------------------------------------
YK27_CAEEL      ------------KMVEVFSGEFLSTNRNYAKIACKMGRIYVNGEMTDVDYVMRNGDRV---EHWAHRHEH
TRUC_HAEIN      ----------------------------------------------------------------------
RLUC_RICFE      ----------SSRLDKYLKRLYPLLTQGVIEKALRQKQITVNSQKAEASLRVKGGDKIKFNLPQPEKLVF
RLUA_YERPE      ----------------------------------------------------------------------
RLUA_SHIFL      ----------------------------------------------------------------------
RLUA_ECOLI      ----------------------------------------------------------------------
RLUA_ECOL6      ----------------------------------------------------------------------
RLUC_RICCN      ----------SSRLDKYLKRLYPLLTQGVIEKALRQKQITVNAQKAEASLRVKGGDKIKFNLPQPEKLVF
RLUA_ECO57      ----------------------------------------------------------------------
RLUA_SALTI      ----------------------------------------------------------------------
RLUC_RICPR      ------------RLDKYLKRLYPLLTQGVIEKALRQKQITVNFQKAEANLRVKVGDTIFFNLPVTQEIKL
RLUA_SALTY      ----------------------------------------------------------------------
RLUA_HAEDU      ----------------------------------------------------------------------
PUS7_ARATH      ---------------KTIVDLFADEFKGRPRDYVKSGRIKVDGEIVPVSYIVKSSQKITHEPPDVVILHQ
YA32_SCHPO      ---------------EVFNTEFRDRESGYYEKAIRNGQVKVNNQIGNVDTLIENGYIVSH---HAHRHEP
RUSD1_DANRE     ----------------------------------------------------------------------
TRUC_HAEDU      ----------------------------------------------------------------------
RLUC_RICTY      ------------RLDKYLKRLYPSLTQGVIEKALRQKQVTVNFQKAEANLRVKEGDTIFFNLPVTQEIKL
RIB2_YEAST      ------------KLVDVFVSEFRDREPSYYSKTIAEGKVYLNDEPANLDTIIRDGDLITH---KVHRHEP
RUSD2_HUMAN     ----------------------------------------------------------------------
TRUC_PASMU      ----------------------------------------------------------------------
PUS7_ORYSJ      ----------------------------------------------------------------------
RUSD2_MOUSE     ----------------------------------------------------------------------
TRUC_YERPE      ----------------------------------------------------------------------
RUSD1_MOUSE     ----------------------------------------------------------------------
PUS5_ORYSJ      ----------------------------------------------------------------------
RUSD1_BOVIN     ----------------------------------------------------------------------
TRUC_VIBPA      ----------------------------------------------------------------------
PUS6_YEAST      ----------------------------------------------------------------------
RUSD1_HUMAN     ----------------------------------------------------------------------
TRUC_VIBCH      ----------------------------------------------------------------------
TRUC_PECCC      ----------------------------------------------------------------------
TRUC_VIBVU      ----------------------------------------------------------------------
Y347_HELPY      ----------------------------------------------------------------------
Y042_HAEIN      ----------------------------------------------------------------------
Y370_MYCGE      ------------RIDQFCLKILPLIKRSDFFKYLRLGKVLLNKTKPQVNTRLKTKDEIAFINPYLQTLSL
Y1592_SYNY3     --------------------------RQAWQERIEQGQIEVDGKTVDPTYPLQAGQTLTYWRSPW----V
Y548_MYCPN      ------------RIEKFCLKLLPNIKLSQFFKLLRLGKVLLNNTKAKLGQRVSSGDTIVFNHSEVVDLTQ
Y347_HELPJ      ----------------------------------------------------------------------
PUS4_ARATH      ----------------------------------------------------------------------
TRUC_ECOL6      ----------------------------------------------------------------------
PUS5_ARATH      ---------------------------------IQNGQIQIDGEVKDPNTLLRSGSKLVYSRLPWK----
PUS1_ORYSJ      ----------------------------------------------------------------------
TRUC_SHIFL      ----------------------------------------------------------------------
TRUC_ECOLI      ----------------------------------------------------------------------
TRUC_ECO57      ----------------------------------------------------------------------
TRUC_SALTY      ----------------------------------------------------------------------
TRUC_SALTI      ----------------------------------------------------------------------
PUS3_ARATH      ----------------------------------------------------------------------
PUS4_ORYSJ      ----------------------------------------------------------------------
RUSD4_HUMAN     ----------------------------------------------------------------------
PUS1_ARATH      ----------------------------------------------------------------------
RUSD4_RAT       ----------------------------------------------------------------------
RUSD4_XENTR     ----------------------------------------------------------------------
RUSD4_BOVIN     ----------------------------------------------------------------------
PUS3_ORYSJ      ----------------------------------------------------------------------
RUSD4_MOUSE     ----------------------------------------------------------------------
MLRR1_PLAF7     ----------------------------------------------------------------------
Y714_MYCCT      ---------------------------SVIYKWIRNKSIKINSKVNDKNYLLKINDVVEVNKPIIRDQFN
PUS5_CANAL      ----------------------------------------------------------------------
RUSD4_DANRE     ----------------------------------------------------------------------
PUS5_ASHGO      ----------------------------------------------------------------------
PUS5_YEAST      ----------------------------------------------------------------------
RUSD3_HUMAN     ----------------------------------------------------------------------
RUSD3_BOVIN     ----------------------------------------------------------------------
RUSD3_MOUSE     ----------------------------------------------------------------------
Y1464_AQUAE     -------------------------SRRKAEKLILEGRVKVNGEVVRS-LGVKVNPEV--DIVEVDGKPV
YE59_HELPJ      ---------------------YTKHSRREAEKLVLEGRVKINHEHAKLASVVKENDKVFLDKRLIKPLKN
Y1459_HELPY     ---------------------YTKHSRREAEKLVLEGRVKINHEHAKLASVVKENDRVFLDKRLIKPLKN
RS4_DEIRA       ------------RLDNVVFRMGFASTRRQARQFVGHGHILVNGKVDIASYRVKIGDEIS-----------
RS4B_CLOAB      ------------RLDNLVYRLGFGSTLREARQMVSHGHILVNGQVDIPSYKVNIGDEVS-----------
PUS6_ARATH      ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
RS4_NATTJ       ------------RLDNVVYRMGFAASRAEARQFVNHGHIMVNGKVNVASYEVKPGDEVVVDIPRVQEL--
RS4_DEIGD       ------------RLDNVVFRMGFASTRRQARQFVGHGHILVNGKVDIPSYRVRIGDEIS-----------
RS4_DEIDV       ------------RLDNVVFRMGFASTRRQARQFVGHGHILVNGKVDIPSYRVKIGDEIS-----------
RS4_ALCBS       -----------GRLDNVVYRMGFGSTRSEARQLVSHRAILVNGSVNVASYQVKPGDQINVREKSKNQLRV


                         .         .         *         .         .         .         .:140
query           EPENIPLXXXXXXXXXXXXNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
YLYB_BACSU      LAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLVNGLMAHTDLSGINGVMRPGIVHRIDKDTSGL
Y901_CHLAA      VAEPIPLDVVYEDADIAVINKPAGMVVHPAPGHPRGTLVNALLARYPDLAIGGELRPGIVHRLDRDTSGL
Y1758_AQUAE     KPENIPINIIYEDEDIAVVEKPCGLVVHPSPGYTSGTLVNALLYHKDLSSIGGVERPGIVHRLDKETAGV
Y1629_SYNY3     VAQNIPLDILYEDEQLIIINKPAGLVVHPGPGHPDGTVVNALLAHCPLAGIGGVQRPGIVHRLDKDTTGA
RLUD_ZYMMO      EPQDIPLEIVFEDEHLLVVNKPAGMVVHPAAGNYDNTLVNALLYHGKLSGIGGVARPGIVHRIDKDTSGL
RLUD_VIBPA      EAQDIPLXXXXXXXXXXXXNKPRDFVVHPGAGTPDGTVLNALLHHYP--DIAEVPRAGIVHRLDKDTTGL
RLUD_HAEDU      EPQNIPLNIVHEXXXXXXXNKPKNLVVHPGAGNPDGTVLNALLYYYP--PIAEVPRAGIIHRLDKDTTGL
RLUD_PASMU      EPENLPLNIVYEDDDILVINKPKDFVVHPGAGNASGTVLNALLYHYP--AIAEVPRAGIVHRLDKDTTGL
RLUD_VIBVU      EAQDIPLDIVYEDDDILVINKPRDFVVHPGAGTPDGTVLNALLFHCP--EVAEVPRAGIVHRLDKDTTGL
RLUD_NITEU      QAEAIPLKILFEDDHLIIIDKPAGLVVHPGNGNWHGTLLNALLNHAP--QLSQVPRAGIVHRLDKDTTGL
Y723_CHLP8      -PEDIPITILYEDDDLMVIDKEAGMVVHPAFGNWTGTLANAILHHKDADELDKTMRPGIVHRLDKDTSGL
RLUD_YERPE      APQEIPLDIVYEDNDILVINKPRGLVVHPGAGNPDGTVLNALLHYYP--EIMDVPRAGIVHRLDKDTTGL
RLUD_PSEAE      LAQDIELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLLNALLYHVP--DIANVPRAGIVHRLDKDTTGL
RLUD_SHIFL      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_ECOLI      EPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_ECOL6      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_ECO57      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_HAEIN      EAENIPLNIVYEDDDIIVINKPKDLVVHPGAGNPNGTVLNALLYHYP--PIVEVPRAGIVHRLDKDTTGL
RLUD_NEIMB      VPEPMALDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXXXXXXAHCP--ELSQVPRAGIVHRLDKETSGL
RLUD_XYLFT      VPQDIPLDILYEDEHVFVINKPAGLVVHPGAGNPDGTLVNALLHRDP--ALAAVPRAGVVHRLDKDTSGV
RLUD_XYLFA      VPQDIPLDILYEDEHVFVLNKPAGLVVHPGAGNPDGTLVNALLHRDP--ALAAVPRAGVVHRLDKDTSGV
RLUD_SALTY      EAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_SALTI      EAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALLHYYP--PIADVPRAGIVHRLDKDTTGL
RLUD_NEIMA      VPEPMALDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXXXXXXAHCP--ELSQIPRAGIVHRLDKETSGL
RLUD_XANCP      APQDIPLNVLYEDDHVLVIDKPAGLVVHPGAGNPDGTLVNALLFRDP--NLAAVPRAGVVHRLDKDTSGV
RLUD_XANAC      APQDIPLSVLYEDEQVLVIDKPAGLVVHPGAGNPDRTLVNALLFRDP--ALASVPRAGVVHRLDKDTSGV
RLUD_BUCBP      QAENIFLNVIYEDDDILVINKQDNFVVHPGAGNTSGTLLNALLHRD--STFFNIPRAGIVHRLDKDTTGL
RLUD_BUCAI      DPENIFLDIVYEDSDILIINKPAGLVVHPGSGNKSGTILNALLYHYKNS--KDLPRAGIVHRLDKDTSGL
RLUD_BORBU      RPSNIPIAIIYEDSNVIVLNKPQGILSHPGISHWDDTVVNFLLYHIKSLKINFNIRPGIVHRLDKDTSGV
RLUD_VIBCH      EAQDLPLNIVYEDDDIIVINKPRDFVVHPGAGQADKTVLNALLFHSPIAEVP---RAGIVHRLDKDTTGL
RLUD_BLOFL      VPQNIPLNIIYEDNDILVINKASNMVVHPGIGHYQGTVLNALLYRYP-SILKISKQAGIVQRLDKDTTGL
YJBO_BACSU      LAEPVPLDILYEDEHVLVINKQPYVSSIPSREHPSGSIANGIIDHYQTTGVRATVH--LVTRLDRDTSGI
RLUD_RALSO      DDENVDLDVVYEDDTLLVINKPAGLVVHPAAGNWSGTVLNGLLHRYPQAA--GLPRAGIVHRLDKETSGL
PUS2_ORYSJ      EPEDIPLDIVYEDDHLLVVNKPAHMVVHPAPGNANGTLVNAILHHCKISTFTALVRPGIVHRLDKGTSGL
YHCT_BACSU      IPEYGELDILFEDNHMLIINKPAGIATHPNEDGQTGTLANLIAYHYQ---INGTCKVRHVHRLDQDTSGA
PUS2_ARATH      EAEDIPLDIVYEDKHVLVVNKPAHMVVHPAPGNPTGTLVNGILHHCSLPCVDASVRPGIVHRLDKGTTGL
RLUD_BUCAP      LPQNIALNTIYEDSNILIINKPPGLVVHPGAGNQDGTILNALLYR--YTNISSIPRCGIIHRLDKDTSGL
Y292_MYCPN      QPYDFPLDILYEDEQIMVVNKPNGLISHPTSFNESESLLGAALFHCNHQPVF------LVHRLDRDTSGV
RLUC_VIBVU      DPETAPSTKLNKVAELQDLNKPSGTAVHGGSG-LKFGAIEALRALRPEARFLE-----LVHRIDRDTSGI
RLUC_VIBPA      VAE-LEHMIIYEDDHMLILNKPSGTAVHGGSG-LKFGAIEALRALRPQARFLE-----LVHRIDRDTSGI
RLUC_BUCAP      YKKNLLNNILYEDNYLLIINKPSGIAVHGGSG----INLGVIEYFRKIRPLEKFLE--LVHRIDRDTSGV
RLUC_SHIFL      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_ECOLI      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_PASMU      APISTKLNKVSQLEKQILFNKPSGIAVHGGSG-LSFGVIEALR----------TLRPDLVHRLDRDTSGI
RLUC_ECOL6      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_BUCBP      NTRLSIIFNNMILYEDNYFNKPSGMSVHSGSG-INYGMIENLRILRPYNRYLD-----LVHRLDRDTSGV
RLUC_ECO57      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_SALTI      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_SALTY      LADVI----LYEDDHILVLNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_HAEDU      APISTKLNKVAELEQHILYNKPSGIGVHGGSG-LSFGVIEALRALRPQARFLE-----LVHRIDRDTSGI
RLUC_VIBCH      VAE-LEHCIVYEDDHLLILNKPSGTAVHGGSGHFG--AIEALRALRPQARFLE-----LVHRIDRDTSGI
Y1567_MYCBO     -------------------------------------------------TTSGVHRQGIVHRLDVGTSGV
Y1540_MYCTU     -------------------------------------------------TTSGVHRQGIVHRLDVGTSGV
RLUC_HAEIN      APISKNLNKVAALENQILFNKPSGIAVHGGSG-LNFGVIEALRALRPEARFLE-----LVHRLDRDTSGI
RLUC_BUCAI      KNTFFPLNHSTNLLNRILYNKPSGIAVHGGSG----LNFGVIEYFRKLRPLNKFLE--LVHRIDRDTSGV
Y209_MYCGE      EPYNLKLEVLFEDKDLMVINKPSGLLTHPTTFNEKASLLAACIFHNNKNPVY------LVHRLDRDTSGA
Y745_HELPJ      KKEDLEIEVIFEDEDXXXXXXXXXXXXHKAPSVKEPTLVDWLKSQNELSNLGLKERYGIVHRLDKDTSGG
RLUA_PASMU      -------------------NKPSGLLSVPGN--------QPQYYDSAMSRVKEKYEPA--HRLDMSTSGL
Y745_HELPY      ----------------------------------EPTLVDWLEFKNELSNLGLKERYGIVHRLDKDTSGG
RLUA_VIBCH      ----------------------------------------------------------VVHRLDMSTSGL
RLUC_YERPE      XXXSAKLDKVAALADCILFNKPSGTAVHGGSG-LSFGVIEGLRALRPEARFLE-----LVHRLDRDTSGV
RLUC_PSEAE      ----------------------------------------------------------LVHRLDRDTSGL
RLUA_VIBPA      ----------------------------------------------------------VVHRLDMSTSGL
YDL36_YEAST     PVTSRPIKVIFEDDNIMVIDKPSGIPVHPT-GRYRFNTITKMLQNNLGFVVNPC------NRLDRLTSGL
RLUA_VIBVU      -------------------NKPSGLLSVPGPEHHD----------SMWSRLQEQYPEQVVHRLDMSTSGL
Y956_HELPY      ----------------------------------------------------------LLHRLDKETSGV
Y956_HELPJ      ----------------------------------------------------------LLHRLDKETSGI
RLUC_RICBR      TDAEITLAKKITTEYLIYENKPAGLATQGG-SKINLSVDSALKY---LNSQGADFK--LVHRLDKETSGL
Y505_ZYMMO      --------------------------------------------------------PSIVHRLDRDTSGC
RLUA_HAEIN      -------------------NKPSGLLSVPGN--------QPQYYDSAMSRVKGFCEPA--HRLDMATSGI
YK27_CAEEL      PIRDLPIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLR------VLHRLDRATSGV
TRUC_HAEIN      -------------------NKPAGMLVHRS-------------WLDPHETVMQTLRDQIIHRLDRPTSGV
RLUC_RICFE      TDAEIKLAKKITTDYLIYENKPAGLATQGG-SKINLSIDSALKY---LNYKGADFK--LVHRLDKETSGL
RLUA_YERPE      -----------------------------------------------------------VHRLDMATSGV
RLUA_SHIFL      -------------------NKPSGLL--SVPGRLEEHK------DSVMTRIQRDYQAESVHRLDMATSGV
RLUA_ECOLI      -------------------NKPSGLL--SVPGRLEEHK------DSVMTRIQRDYQAESVHRLDMATSGV
RLUA_ECOL6      -------------------NKPSGLL--SVPGRLEEHK------DSVMTRIQRDYQAESVHRLDMATSGV
RLUC_RICCN      TDAEIKLAKKITTDYLIYANKPAGLATQGG------TKIN-LSIDSALKYLN--YKGALVHRLDKKTSGL
RLUA_ECO57      -------------------NKPSGLL--SVPGRLEEHK------DSVMTRIQRDYQAESVHRLDMATSGV
RLUA_SALTI      -----------------------------------------------------------VHRLDMATSGV
RLUC_RICPR      AKKILTDYLIYEDDHLIAINKPASLATQGG-SKINLSIDSALKY---LNYQGADFK--LVHRLDKETSGL
RLUA_SALTY      -----------------------------------------------------------VHRLDMATSGV
RLUA_HAEDU      -------------------NKPSGLLSVPGPEYYDSVMTRVQQRY-------GFAEPA--HRLDMATSGI
PUS7_ARATH      EPDVVTVC------------KPASVPVHPCGQYRKNTIVGILDAEHDL----GTLFP--IHRLDRLVSGL
YA32_SCHPO      PVSDQPVGIVHEDESYVVIDKPAGVPVHPTGRYNHNTVLHILMKENKCSLLYPC------NRLDRLTSGL
RUSD1_DANRE     ----------------------------------KQTVQSQLKHHFPELADPGTYYGRFCHQLDFSTSGA
TRUC_HAEDU      -------------------NKPAGMLVHRSWLDKAETL---FAMQTLRDQINQHVFP--IHRLDRPTSGV
RLUC_RICTY      AKKILTDYLIYEDDHLIAINKPASLATQGG-SKINLSIDSALKY---LNYQGADFK--LVHRLDKETSGL
RIB2_YEAST      PVTSKPIDIVFEDEDILVIDKPSSIPVHPT-GRYRFNTITKMLERQ----LGYSVHP--CNRLDKPTSGL
RUSD2_HUMAN     -------------------DKPSSIPVHPC-GRFRHTVIFILGKEHQLKELHP------LHRLDRLTSGV
TRUC_PASMU      -------------------NKPAGMLVHRSWLDRHET---QFVMQTLRDQIGQHVYP--IHRLDRPTSGV
PUS7_ORYSJ      --------------------KPASVPVHPCGQYRKNTVVGILQAEHGLVPLFP------VHRLDRLVSGL
RUSD2_MOUSE     -------------------DKPSSIPVHPC-GRFRHTVIFILGKEHQLKELHP------LHRLDRLTSGV
TRUC_YERPE      -------------------NKPAGWLVHRSWLDRNETVFVMQTVRDQIGQHVYT-----VHRLDRPTSGV
RUSD1_MOUSE     ------------------------------------TLQKQLRHHFPLADPDTCYGFRFCHQLDFSTSGA
PUS5_ORYSJ      -------------------NKPSGLQVLPK-GLFQQRTVLAQLWKMPSSFCSAQSHPVPVHRLGRGTSGX
RUSD1_BOVIN     ------------------------------------------------------------HQLDFSTSGA
TRUC_VIBPA      -------------------NKPAGMLVHRSWLDKHET---QFVMQTLRDQIGQHVFP--LHRLDRPTSGV
PUS6_YEAST      -------------------DKPSGIPVHPTGQFYQNTITELLKLHGVDALP--------CYRLDKITSGL
RUSD1_HUMAN     ------------------------------------TLQKQLRYRFPLADPDTCYGFRFCHQLDFSTSGA
TRUC_VIBCH      -------------------NKPAGMLVHRSWLDKHET---EFVMQTLRDQIGQHVFP--LHRLDRPTSGV
TRUC_PECCC      -------------------NKPSGWLVHRSWLDRKEKVVVMQTVRDQIGQHVYT-----VHRLDRPTSGV
TRUC_VIBVU      -------------------NKPAGMLVHRSWLDKHET---QFVMQTLRDQIGQHVFP--LHRLDRPTSGV
Y347_HELPY      -------------------DKPHQVYTHPKGYFYHESLLDCIQSH-----FGKNAHPA--HRLDYETSGL
Y042_HAEIN      -------------------NKSEGISVHKDQEEQGLTELVAKQLNVP--------KVWLVHRLDKVTSGL
Y370_MYCGE      DLVKDKLKIIFEDENIIVVDKPTGIVCQPDKKHSIINLSNMLLKHCGYRQFDSNFYPQFAHRIDRNTSGI
Y1592_SYNY3     EPEPLQLSVLHRDEDLWAIDKPSGLPVLPGGDFVYHTVLEQLKIQYPQESLFP------LHXXXXXXXXX
Y548_MYCPN      VQDDLQVIFEDEQLIVV--DKPAGVVCQPDAKHELFNLANSLLKHCGYNQYSLSFIPRFAHRIDRNTCGL
Y347_HELPJ      -------------------DKPAQIYTHPKGYFYHESLLDCIQSH-----FGKNAHPA--HRLDYETSGL
PUS4_ARATH      -------------------NKPHGLAVQGGSGI--KTSIDELA--ASCLKFDKSESPRLVHRLDRDCSGL
TRUC_ECOL6      -------------------NKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
PUS5_ARATH      EPDTYSLEVLYEDDDLIALNKPSGLQVLPGGLFQQRTVLTQLQWNDSYIGSRESPHPVPVHRLGRGTSGI
PUS1_ORYSJ      ----------------------------------------------------------LANRLDRDTSGL
TRUC_SHIFL      -------------------NKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
TRUC_ECOLI      -------------------NKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
TRUC_ECO57      -------------------NKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
TRUC_SALTY      -------------------NKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
TRUC_SALTI      -------------------NKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFT-----AHRLDRPTSGV
PUS3_ARATH      --------------------------------------------------------PRLVHRLDRETSGL
PUS4_ORYSJ      -------------------NKPPGMPVQGGVG-----IKNSIDVLASMFEENSSEAPRLVHRLDRDCSGI
RUSD4_HUMAN     -------------------NKPYGLPVHGGPG-VQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGV
PUS1_ARATH      -------------------NKPKGVYCE------------AVLRSAPQIVLDSSSEYHLANRLDRDTSGV
RUSD4_RAT       -------------------NKPYGLPVHGGPG-VQLCISDVLPILAKMLHGHKAEPLHLCHRLDKETTGV
RUSD4_XENTR     -------------------NKPHGLPVHPTVERSVASLLPALAKHEPLK---------LCHRLDRDTTGA
RUSD4_BOVIN     -------------------NKPYGLPVHGGPGVSDVLPVLAKILHGPKA------KPHLCHRLDKETTGV
PUS3_ORYSJ      --------------------------------------------------------PKLVHRLDRESSGL
RUSD4_MOUSE     -------------------NKPYGLPVHGGPG-VQLCISDVLPILAKMLHGHKAEPLHLCHRLDKETTGV
MLRR1_PLAF7     ----------------------------------------------------------------------
Y714_MYCCT      YISNVNLDIVYEDNNILIVNKPNNLEMHSIYNLCLDDMVKSYLVDKKEYDIENSFVISHVHRLDKLTSGL
PUS5_CANAL      -------------------NKPSGMVCDAS---HTNNIITALTFTKILPSVNSS-QFRLVQRLDRFVTGG
RUSD4_DANRE     -------------------NKPYDVPLHNING-----IRNSIAECLPLAKITDNMRPGLCHKLEKETTGV
PUS5_ASHGO      -----------------------------------------------------------VHRLDEPVTGG
PUS5_YEAST      -----------------------------------------------------------VHRLDHCVTGG
RUSD3_HUMAN     -------------------NKPQGLPVTGKPG--ELTLFSVL---PELSQSLGLREQEVVRASGKESSGL
RUSD3_BOVIN     -------------------NKPQGLPVTGKPG--ELTLLSVLPELSRSLGL-GEQEVQVVRASGKEASGL
RUSD3_MOUSE     -------------------NKPQGLPVTGRPG--ELTLLSVLLEHQELQVVRA---PG------KEASGL
Y1464_AQUAE     KPQR---------KRYIILNKPCCYLTQLGRSPDGRKTIEELIKDIP-------ERVFPVGRLDYNTEGL
YE59_HELPJ      KKFSV-----------LVYHKPKGELVSKADPLKRHVI------YESLEKKYAHFAP--VGRLDFASEGV
Y1459_HELPY     KKFSV-----------LVYHKPKGELVSKA-----DPLKRRVIYES-LEKKYAHFAP--VGRLDFASEGV
RS4_DEIRA       ----------------------------------------------------------------------
RS4B_CLOAB      ----------------------------------------------------------------------
PUS6_ARATH      ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
RS4_NATTJ       ----------------------------------------------------------------------
RS4_DEIGD       ----------------------------------------------------------------------
RS4_DEIDV       ----------------------------------------------------------------------
RS4_ALCBS       K---------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
YLYB_BACSU      LMVAKNDMAHESLVNQLVNKTVTRKYTAVVHGLISHDDGTIDAPIGRDKKDRQSMTVTRDGKNAVTHFHV
Y901_CHLAA      LVIARHDQAMRSLVDQQQARRMRKIYQALVIGRPPE-TGTIDAPIGRDPRDRLRMAVVPDGRPARTHYRL
Y1758_AQUAE     MVIAKNNTAHRNLVRQFQERKTEKFYKVLVKGLVKKDYGAIDTPIARHPVDRKRFWVRKEGKEALTEYWV
Y1629_SYNY3     MVVAKTELALHNLQVQLKEKTARRLYWGIVYGSPKEIQGTVNLPVGRHPGDRQKMGIVKGGREAVTHWRL
RLUD_ZYMMO      LVVAKTDPAHAGLAAQFADHSINRRYRAIVDGH-PSLQGHVDAPLARSSVNRQKMAIVSDGRRAVTHYRM
RLUD_VIBPA      MVVAKTVPAQTRLVRALQKRNITREYEAIAIGRMTA-GGKVDQPIGRHSTKRTLMAVAPLGKPAVTHYRV
RLUD_HAEDU      MVVAKNIPAQTHLVTALQKRRITREYEAIASG-IMTQGGKVDEPMARHPTKRTAMAVHPMGKPAITHYRI
RLUD_PASMU      MVIAKTIPAQTKLVRDLQKRKITREYEAIACG-IMTKGGMVDQPMARHPTKRTHMAVHPMGKPAVTHYRI
RLUD_VIBVU      MVVAKTVPAQTRLVRALQKRNITREYEAIAIGRMTA-GGKVDKPIGRHATKRTLMAVSPMGKPAVTHFRV
RLUD_NITEU      LVVAKTIEAQFDLARQLQQRTVKRHYLALVLGKLEKD-GVVDAPIGRHPIHRTRMAVVQNGKPARTHYRV
Y723_CHLP8      IIIAKNPTALHKLARQFANRQVEKVYKAIVWGVPKAESGTIKTNIGRSHKNRKVMANFAEGKHAITDYQV
RLUD_YERPE      MVVAKTVPAQTRLVEALQAREITREYEAVAIGNMTA-GGRVDEPISRHSTKRTHMAVHPMGKPATTHYRI
RLUD_PSEAE      MVVAKTLEAHTKLVAQLQARSVSRIYEAXXXXXXXXXXXX-DAPIGRHGVQRQKMAVVDAGKVAVSHYRV
RLUD_SHIFL      MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
RLUD_ECOLI      MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
RLUD_ECOL6      MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
RLUD_ECO57      MVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRI
RLUD_HAEIN      MVVAKTIPAQTKLVRDLQKRKITREYEAVASG-IMTKGGTVDQPMARHATKRTLMAVHPMGKPAVTHYRI
RLUD_NEIMB      MVVAKTLPAQNSLVRQLQERTVKRIYRAVANGIVPFD-GKIETQIGRDPHNRLKMAVVKGGKPAVTHVKV
RLUD_XYLFT      MVVARTLQAQTALVEQLSSRQVHRQYLAVVVSALVS-GGTVNAAIERHPRDRLRMEVSDTGKEAVTHYRL
RLUD_XYLFA      MVVARTLQAQTALVEQLSSRQVHRQYLAVVVSALVS-GGTVNAAIERHPRDRLRMAVSDTGKEAVTHYRL
RLUD_SALTY      MVVAKTVPAQTRLVESLQLREITREYEAVAIGHMTA-GGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRI
RLUD_SALTI      MVVAKTVPAQTRLVESLQLREITREYEAVAIGHMTA-GGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRI
RLUD_NEIMA      MVVAKTLPAQNSLVWQLQERTVKRIYRAVANGIVPFD-GKIETQIGRDPHNRLKMAVVKGGKPAVTHVKV
RLUD_XANCP      MVVARTLQAQTALVEQLSARDVHRQYXXXXXXXXXXXX-TADAPIDRHPRDRLKMAVRDDGRDAVTHYRL
RLUD_XANAC      MVVARTVQAQTALVEQLSAREVHRQYXXXXXXXXXXXX-TANAPIDRHPRDRLKMAVRDDGRDAVTHYRL
RLUD_BUCBP      MVIAKNNLSYMALIDQIKCKKVIREYQAIVYGKVIS-GGTIVKSIIRNPIKRTTMIVNKCGKRAITHYRI
RLUD_BUCAI      MVIAKNIFSYNHXXXXXKEKKIIREYEGIVHGKMIA-GGTINKPIMRHYNRRTCMMVHHLGKPSVTHYKV
RLUD_BORBU      LICAKNISTLRFLAQQFKDKRTNKVYIAIVKGNFNSFFGSIESFIDRDKHNRKKFSVSKDGKKALTEYRL
RLUD_VIBCH      MVVAKTVPAQTRLVRALQKRDVTREYEAIVIGTMTA-GGMIDKPIGRHSTKRTLMSVSPMGKHAVTHYRV
RLUD_BLOFL      MIIAKTVSAYDNLLRSFKLRKVVKEYDAIVYGKFTSNAGVVNQPMRRHFAKRTFMSVHYTGKSAVTYYSV
YJBO_BACSU      MLVAKHRFAHSILSSAQKNGLVKRRYAAVVHGRMAQMEGTVDAPIGRHPDSIIERTVTPDGQKAVTHFYV
RLUD_RALSO      MVVARTLPAQTDLVRQLQARTVKRTYLALVWGETPE-AGTIDAPIGRDPRDRTRMAIIESGKPARTHFKT
PUS2_ORYSJ      LVVAKDEHSHAQLAEQFKLHTIRRVYISLTCGAPNPNSGRIEVPIARDPNNRIRMIATRYARHAASRYKV
YHCT_BACSU      IVFAKHRLAHAILDQQLEKKTLKRTYTAIAEGKLRTKKGTINSPIGRDRSHPTRRRVSPGGQTAVTHFKV
PUS2_ARATH      LVVAKDEHSHAHLAEQFKLHTIERVYVSLTTGVPSPPQGRIEIPIGRDSSNRIRMAAIXXXXXXXXXYKV
RLUD_BUCAP      MVIAKTIFSYNKLVTLLKKRKIIRKYQGIIKGNM-ISGGIVNYPIMRHPFKRICMTTDSLGKKSITHYKI
Y292_MYCPN      IMLAKNXXXXXXXXXXXXXRVMKRYYLALVHFPLDSLSGTISAPLGNNKVMWKVGNSSNKAKNAFTKFTV
RLUC_VIBVU      LLVAKKRSALRHLQAQFREKTVQKYYFALVMGEWKNSCKVVNAPLLKNEVNSIVR-VNPNGKPSETRFKV
RLUC_VIBPA      LLVAKKRSALRHLQAQFREKTVKKFYFALVMGQWKSSCKVVNAPLLKNEVNSIVR-VNPNGKPSETRFKI
RLUC_BUCAP      LMLAKKRRSLLSLHKQIREKKVQKKYIALVHGLWPLSLRKVSEPLLKTHLKNKQRKILKEGKPAETYFKI
RLUC_SHIFL      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_ECOLI      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_PASMU      LLVAKKRSALRSLHEQLREKTVQKDYLALVRGQWQSHCKVVKAPLLKNELSSGERRVSEQGKPSETRFSI
RLUC_ECOL6      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSYVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_BUCBP      LIIAKKRSILRNLHEQLREKKIKKKYVALVHGVWPDILKSISKPLLKTSSRKNKNIVKIDGKESITHFNI
RLUC_ECO57      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_SALTI      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKTVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_SALTY      LLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKTVQAPLLKNILQSGERIVSQEGKPSETRFKV
RLUC_HAEDU      LLVAKKRSALRALHEQLREKVVQKDYLALVRGQWQAHINVIKAPLLKNELQSGERIVKEQGKPSETRFSI
RLUC_VIBCH      LLVAKKRSALRHLQAQFREKTVQKYYYALVMGHWDAECKVVNAPLLKNEVNSIVR-VNPNGKPSETRFRI
Y1567_MYCBO     MVVAISERAYTVLKRAFKYRTVDKRYHALVQGHPDPSSGTIDAPIGRHRGHEWKFAITKNGRHSLTHYDT
Y1540_MYCTU     MVVAISERAYTVLKRAFKYRTVDKRYHALVQGHPDPSSGTIDAPIGRHRGHEWKFAITKNGRHSLTHYDT
RLUC_HAEIN      LLIAKKRSALRNLHEQLRVKTVQKDYLALVRGQWQSHIKVIQASLLKNELSSGERIVSEQGKPSETRFSI
RLUC_BUCAI      LILAKKRTSLVSLHEQLREKKIKKEYIALVHGLWPDHIKKISEPLLKIQFKNKQKMVLKKGKPSETYFQI
Y209_MYCGE      IVVCKXXXXXXXXXXXXXXRTLKRYYVALVHFPFNALTGSINAPLARVNNNKXXXXXXXXXXXXXXXXXV
Y745_HELPJ      IVIAKNNFTHVCLSEQLKTKMMGRYYIALLSTPLKEEKMSVECYLTRNPNNRLKMIALKAAKKEKSRYSL
RLUA_PASMU      ILFALSKVADRELKRQFREREPKKHYQALVWGHLEEDQGEVNLPLICDWENRPRQKIFERGKPALTLYEV
Y745_HELPY      IVIAKNNFTHVHLSEQLKTKMMGRYYIALLSTPLKEEKMSVECYLTRNPNNRLKMIALKAVKKEKSRYSL
RLUA_VIBCH      ILFAKGKHMESALKKQFQYRLTHKIYYARVWGVMEQNEGEVNLPLCCDWPNRPKQKVCEEGRDSLTRYQV
RLUC_YERPE      LLVAKKRSALRSLHEQLRLKSMQKDYLALVRGQWQSHCKAIQAPLLKN-IMQSGERVVKEGKPSETRFKI
RLUC_PSEAE      LMIAKKRSMLRHLHEALREKIVDKRYHALVRGHWPAGKKNVRAPLLKNNL-RSGERMVEEGKDALTEFRV
RLUA_VIBPA      MVLAKNKRAESALKKQFQFRLTHKIYYARVWGHVEQEEGEIDLPLICDWPNRPLQKVFEDGKPSKTLFQV
YDL36_YEAST     MFLAKTPKGADNIGDQLKAREVTKEYVAKVVGEFPETEVIVEKPLKRLALNAVCQMDEKGAKHAKTVFNR
RLUA_VIBVU      MVFAKNKRAEAALKKQFQYRLTHKVYYARVWGHVEADSGMIDLPLICDWPNRPMQKVCHEGKPSQTAFQV
Y956_HELPY      LLVKENSEFHLKAKKAFKDRAVKKEYLALTQGIIEEER-EINAPILTFKTTKAFSKISKKGQEAVTIITP
Y956_HELPJ      LLVKENSEFHLKAKKAFKDRAVKKEYLAIVQGIIEEER-EINAPILTIKTTKAFSKISKKGQEAVTIITP
RLUC_RICBR      LLIAKNYVSSVKLHDAFKEKLVEKTYLAVTYGKPIKDQGEVKTNIEKSKGSIPKITDINDGKLAITYYKL
Y505_ZYMMO      LLLARNPKMHRRLSEAFSQGQVKKCYWAILEGVPEKNEGIIDLPLLKISSPKSGWRIVADGKRAVTHWEI
RLUA_HAEIN      IVFALSKAADRELKRQFREREPKKHYQAIVWGHLENDYGEVNLPMICDWENRPRQRLFVLGKRAVTKFEV
YK27_CAEEL      LLFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQVCEQPIGPLVISMGIQCVRPDGKDAKSRFRK
TRUC_HAEIN      LLFALSSEIANLMCEQFEQKYVQKSYLAVVRGYL-QGKERIDYPLKLDKIADKFSQEDKEPQEAITDYEG
RLUC_RICFE      LLIAKNYLSNVKLHDAFKEKLVVKTYFAVTYGKPIKNVGEVRSNIEKSKGSTPKITDIENGKLAITYYKL
RLUA_YERPE      IVVALTKAAERELKRQFREREPKKTYIARVWGHLAQDEGLIDLPLICDWPNRPKQKVYETGKSAQTEYQV
RLUA_SHIFL      IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
RLUA_ECOLI      IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
RLUA_ECOL6      IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
RLUC_RICCN      LLIAKNYLSSVKLHNAFKEKLVVKTYFAVTYGKPIKNVGEVRSNIEKSKGSTPKITDIENGKLAITYYKV
RLUA_ECO57      IVVALTKAAERELKRQFRERVPKKQYVTRVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYEV
RLUA_SALTI      IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYNV
RLUC_RICPR      LLIAKNYLSSVKLHNAFKEKLVIKKYFAITYGRPVKNVGTVKSNIGKSKRRLSKIANIDDGKLAITYYXX
RLUA_SALTY      IVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRPKQKVYETGKPAQTEYNV
RLUA_HAEDU      ILLALSKVAEKELKRQFRDREPKKHYIALLWGKLGDQTGEINFPLICDWENRPRQKICYEGKKATTHYEV
PUS7_ARATH      LIIARTAAKADFFRQQIEGGMVKKRYIAKVIGVFPEDEMIVDANIGRSTAEDANSSKVK-GKPACTKFTR
YA32_SCHPO      MFFSKSPKAAEEMRVHMISKSLKKEYVARVIGEFPNSGEVIDAPLLTVAPTLGLNRIHPDGKEASTVFKR
RUSD1_DANRE     LCVALNKAAAGQAYRCFKDRRVTKAYLALVRGTVTEENLSLDFAIGKNTTEGKTHMMCTEGKPCQTEVTV
TRUC_HAEDU      LLFALNSEMARLMSEQFEQHKVEKEYLAIVRGYIAE-KGEIDYPL-KVILDKDKFSQPKAAQQAVTFYQN
RLUC_RICTY      LLIAKNYLSSVKLHDAFKEKLVIKKYFAITYGRPVKNVGIVKSNIGKSKGRMFKITDIDNGKLAITYYXX
RIB2_YEAST      MFLAKTPLGADRMGDQMKAREVTKEYVARVKGEFPIGIVEVDKPVRSVNPKVALNAVCENAKHAKTVFQR
RUSD2_HUMAN     LMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPIGVCRVDPR-------GKPCETVFQR
TRUC_PASMU      LLFALSSEVANLLCLQFENKQVQKSYLAIVRGYLVGE-GRIDYPL-KVQLDKIADKFAQDDKEAVTDYLG
PUS7_ORYSJ      LIFAKNADKAESFRQQIEASLLQKEYVAKVVGVFPDGEQTVNANVHFNAREGRSTAEVCDGKQACTKFQR
RUSD2_MOUSE     LMFAKTAAVSEKIHEQVRDRQLEKEYVCRVAGEFKEPILVVSYKVGVCRVDPR-------GKPCETVFQR
TRUC_YERPE      LLMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLE-GGTVDYAMAEEKIADKFAKSDKAPQPSVSHYEA
RUSD1_MOUSE     LCVALNKAAAGSAYKCFKERRVTKAYLALVRGHVQESQVTINYAIGRNSTEGRTHTMCIEGKPSLTELLV
PUS5_ORYSJ      XXXATNAGKSRDETDICKARKISKFYRALVTGILENDEVMITQPIGLVRVAEGLYAACSSGKPAMSKVRV
RUSD1_BOVIN     LCVALNKAAAGSAYRCFKDRRVTKAYLALVRGHVQESRMTISYAIGKNSTEGRTHTMCIEGKPSLTELVV
TRUC_VIBPA      LVFALSSEVASQVMPMFAEHKMEKTYHAIVRGWIEEE-GVLDYALKLDKIADKFASQEKEAQEAVTAYKP
PUS6_YEAST      LILAKNSQSAGEIQKSIRSRDMIKIYLARVKGRFPEDTSKVTVEMTPISIDPKRQFPVSTSKDAITKFYP
RUSD1_HUMAN     LCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIGRNSTEGRAHTMCIEGKPSLTDLVV
TRUC_VIBCH      LVFALSSQIASEVMPMFANHEMEKTYHAIVRGWI-EEANVLDYPLKEEKIADKFAKQDKEAQSAVTAYRP
TRUC_PECCC      LLLALSSEVARALSQQFESHQMQKTYHAVVRGYVLDD-GVIDYALTEEKIADKFTNPDKAPQPAVTHYRS
TRUC_VIBVU      LVFALSSEVASQVMPMFAGQEMSKTYHAIVRGWIEEE-GELDYALKLDKIADKFASQEKEAQDAITLYKP
Y347_HELPY      VLAGKTLQSVKDLKALFMQKKVKKTYLALAHGLV-EKSMKIDKPILTPQNIQKRSKISPLGKQSITLVEP
Y042_HAEIN      LILALNAESAAEFSRLFSEHKIHKTYLALSNQKPKKKQGLIIGDMKKAREGAWKLCQTKDNP-AITRFES
Y370_MYCGE      VIGAKTNKALKELNKVFKNNHLTKRYKGLVFGQFNH----LGLQTAYWKKDNNNGIVTPEAKKISTFFEN
Y1592_SYNY3     XXXXXXXXXXXXXXXQFREHICRKIYRTVIGPCDLPEKFECHQAIGKIPYPQLGYAASSHGKPAQSYGRI
Y548_MYCPN      VIGAKTNQALQELEAVFRHNLLMKQYQGLVFGNFKGTQKAYWAKDAYQALVTVKAKPFPNAKPITTIFEN
Y347_HELPJ      VLAGKTLQSTKDLKALFMQKKVKKTYLALAHGLVDKSNKPILTPQNIQKDLRIRSQISPLGKPSITLVEP
PUS4_ARATH      LVLARTQTAATVLHSIFREKTTKRKYMALVIGCPPRQRGQISAPLRKVVVDKSERITVNDNQHAITEYRV
TRUC_ECOL6      LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEA-VLDYPLAEDKIADKFAREDKGPQPAVTHYRG
PUS5_ARATH      XXXXXXXXXXXXXXXYFAEGTSSKIYRALADGIVEEDEVVIKQPIGVVRYPGVAQGLYPEGKPAFSKVFV
PUS1_ORYSJ      MVITKCNKVAGKLVKAFTEHKVKKTYLALCIGKIKICSGH-----GRSKHGAWRVYAMSDVRDMSTRFEV
TRUC_SHIFL      LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEA-VLDYPLVEDKIADKFAREDKGPQPAVTHYRG
TRUC_ECOLI      LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEA-VLDYPLVEDKIADKFAREDKGPQPAVTHYRG
TRUC_ECO57      LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEA-VLDYPLVEDKIADKFAREDKGPQPAVTHYRG
TRUC_SALTY      LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDA-VLDYPLERDKIADKFAREDKAPQPAVTQYRG
TRUC_SALTI      LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLIDDA-VLDYPLERDKIADKFAREDKAPQPAVTQYRG
PUS3_ARATH      LVMGRTDYLH-SVFSDYKGRNSSQQYWALVIGSPKEKEGLISAPLSKVLLDDGKRVVLAQGQDAITEYKV
PUS4_ORYSJ      LVLGRNQLSTSMLHAIFREKTAQRKYVALVIGTPRHPKGLLSAPLAKILLQKSERLTIRASSNAASVQDA
RUSD4_HUMAN     MVLADKDMAHQ-VQELFRTRQVVKKYWAITVHVPMPSAGVVDIPIVEKRMDDGKMVKVRRSRNAVTQYQV
PUS1_ARATH      MIITKSHKVAAKLVKAFTEHKIRKSYIALCIGSSPNRRVTVSSGHGRSKHGAWRVYAALDGGSFVRDMEV
RUSD4_RAT       MVLAEKDMAHQ-VQELFRTRQVEKKYWAITVRVPLPSAGVVDIPIMEKEVDNGKMVKVRASRDAVTQYQV
RUSD4_XENTR     LILARTTEAAERVQQALREREVHRVYWALCLGTPSPREGILDIPIMEKETSGERVRVPRSAHEAVTRYRT
RUSD4_BOVIN     MVLAEKEVAHQ-VQELFRTRQVTKKYWAITVRVPVPEAGVVDIPIVEKRMDDGKMVRVRSSRNAVTQYQV
PUS3_ORYSJ      LLFGRTKESHWLFTSVNLAKTNSQRYWALVIGTPKEREGIISAPLSKVLLDDGKPSGIDGAQEAVTAYRV
RUSD4_MOUSE     MVLAEKDMAHQ-VQELFRTRQVEKKYWAITVRVPLPSAGVVDIPIKEKEVDNGKMVKVRASRDAVTQYQX
MLRR1_PLAF7     ----------------------------------------------------------------------
Y714_MYCCT      VIYAKNKISSIILAFKTKDQINKYYYALTSYDWNLNDFLQVNGYINYNSNTQKADFSLVE-KNNYKYCQT
PUS5_CANAL      LVVARNKKWADKVRKSFFQEGTTRRYVGLIADQIPESTGTIDFPIQALEKDYRGKNKSRETYSAVTHYKL
RUSD4_DANRE     LILAKTEEAAEHVQTLIQSHKVEMKYLAITVGVPVPSEGVIDIPIERAVVGPQPHKVNEDGXXXXXXYQV
PUS5_ASHGO      VLVSRNKRAAAMFSRSLALGGNTRRYVALLA--------------------REAKGLPSEGR--ITMGDM
PUS5_YEAST      MLIAKTKDGSVKFSRFLQKGGNNRKYVAIV-----ESSGRFNKPNNEIKYGPKYNFLISHGGREITKFKE
RUSD3_HUMAN     VLLSSCPQTASRLQKYFRAQRPTATYCAVTDGIPAASEGKIQAALKLEHIDGSRKDILEGVKKTLSHFRV
RUSD3_BOVIN     VLLSSCSQTASRLQKFFTHSRRARKYCAVTDGIPVTSEGKIQAALKLEHIDGSRKDIMEGVKRTLSHFRV
RUSD3_MOUSE     VLLSSCPQTASRLQKSRRAQRPTATYCAVTDGIPEPSEGTVCMPLKMEQMNDVDLAVIQEGKRTLSRFHV
Y1464_AQUAE     LILTNDELANRILHPRYK---LPKVYLALVEGKVDQKT-----------LKRMKQGILEDGFAKPDNIRI
YE59_HELPJ      LLLSDSKLMHANLEKEYLVKIQTREMENAMQEGLKLENAT--------KGAHQKTPIKSMEFAPFIGYEI
Y1459_HELPY     LLLSDSKLMHADLEKEYLIKIQTREMENAMQEGLKLENAT--------KGAHQKTPIKSMEFAPFIGYEI
RS4_DEIRA       ----------------------------------------------------------------------
RS4B_CLOAB      ----------------------------------------------------------------------
PUS6_ARATH      ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
RS4_NATTJ       ----------------------------------------------------------------------
RS4_DEIGD       ----------------------------------------------------------------------
RS4_DEIDV       ----------------------------------------------------------------------
RS4_ALCBS       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
YLYB_BACSU      LERFQDFTLVECQLETGRTHQIRVHMKYIGFPLAGDPKYGPRKTIDFNGQALHAGVLGFDHPRTGEYVEF
Y901_CHLAA      LDTFGDYSLLEVQLETGRTHQIRVHLRHLGYPIVGDPVYGPRRSLHLSRQFLHAAYLGLVHPRSGRWQEF
Y1758_AQUAE     LKRYEKYTLLKVKIHTGRTHQIRVHFASIGHPVLGDRTYGPKELLSLMGEMLIAYHLGFYHPTKGEWMVF
Y1629_SYNY3     LERIGNHSWLEFQLETGRTHQIRVHSKQMGHPLVGDNLYSPGSVNVNPGQALHAHQLSLIHPVSGEIITA
RLUD_ZYMMO      ITPLKNASLIECRLETGRTHQVRVHMSSIGHSLLGDPVYGRSKSLAFQRQALHAAHLGFIHPISGKQVDF
RLUD_VIBPA      AEHFREHTRIRLRLETGRTHQIRVHMSYLQHPLLGDTAYGGRARIGFDRQALHAVMLRFEHPITGEELEF
RLUD_HAEDU      MERFRNYTXXXXXXETGRTHQIRVHMAHIAHPLLGDQLYGPRPPKGSSEAFLHATMLRLEHPINGELIEC
RLUD_PASMU      MERFRNYTXXXXXXETGRTHQIRVHMAHIAHPLLGDQTYGGRQTLRDKRQALHAIMLRLAHPITGELMEW
RLUD_VIBVU      AEHFREHTRIRLRLETGRTHQIRVHMSYLQHPLLGDAAYGGRARIPAGAQALHAVMLRFEHPITGEEMEF
RLUD_NITEU      LEKFTASTLLHCSLETGRTHQIRVHLLSIGHPLAGDPVYGPDPSTADARQALHAWQLELTHPHSGQILLW
Y723_CHLP8      VEDLGYFSLMDVTLHTGRTHQIRVHLQHLGHSILGDETYGPRTLPFSSRQALHAQTLRFRQPTTGEPLSF
RLUD_YERPE      MEHFRAHTXXXXXXETGRTHQIRVHMSHINHPLVGDQLYGPRPPKGASDSFLHATMLRLYHPIRGIQMEW
RLUD_PSEAE      LERFRAHTHTRVKLETGRTHQIRVHMSHIGYPLVGDPVYGGRQTLVQTRQALHARFLELDHPATGVRMKW
RLUD_SHIFL      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
RLUD_ECOLI      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
RLUD_ECOL6      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
RLUD_ECO57      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGPRPPKGASEAFLHATMLRLYHPISGIEMEW
RLUD_HAEIN      MXXXXXXXXXXXXXETGRTHQIRVHMAHIAHPLLGDQTYGPRPPKNASEDFLHAVMLRLAHPITGEMMEW
RLUD_NEIMB      LERYLTHSYIECSLETGRTHQIRVHMREANHPLAADPVYGPRHPCGDARQALHAYRLSFTHPESGETVSF
RLUD_XYLFT      RERFRAHTALECRLDTGRTHQIRVHMAHLRHPIVGDRLYGGSLKLPKGGQALHAEVLEFLHPVRALPVRI
RLUD_XYLFA      RERFRAHTALECRLDTGRTHQIRVHMAHLRHPIVGDRLYGGSLKLPKVGQALHAEVLEFLHPVGALPVRI
RLUD_SALTY      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDQVYGPRPPKGASEEFLHATMLRLYHPVSGIEMEW
RLUD_SALTI      MEHFRVHTXXXXXXETGRTHQIRVHMAHITHPLVGDQVYGPRPPKGASEEFLHATMLRLYHPVSGIEMEW
RLUD_NEIMA      LERYLAHSYIECSLETGRTHQIRVHMREANHPLAGDPVYGPRHPCGDARQALHAYRLSFTHPESGETVSF
RLUD_XANCP      RERFRAHTALECRLETGRTHQIRVHMAHLKSPIVGDPLYGGALKLGFKRQALHAETLEFLHPVSGEPIRA
RLUD_XANAC      RERFRAHTALECRLETGRTHQIRVHMAHLKSPIVGDPLYGGALKLPKGAQALHAETLEFLHPVSGEPVRA
RLUD_BUCBP      LKRFTHHTHLKIILETGRTHQIRTHMLYINFPLVGDKTYGNKKFYKNISQALHASRLCLYHPVTKHLMEW
RLUD_BUCAI      LSRFKFHTHIAIRLETGRTHQIRVHMLHIKYPLVGDPCYSGFKIQSNPRQALHANHLSLHHPIKKNVMSW
RLUD_BORBU      LLNFGEYSLLALKPKTGRTHQLRVHMKYLNFPILGDEVYGVDGSLKKITLMLHSYKLE-IDVGKNSFKKF
RLUD_VIBCH      AXXXXXXXXXXXXXXXXXXXQIRVHMAYLQHPLLGDTAYGGRARIPKGAQALHAVMLKFEHPVTGEELEF
RLUD_BLOFL      VEEFKAHSRVRINLKTGRTHQIRVHMAYINHPLVGDQKYKGNFSLDFNRQALHACTLQLLHPITQVQMKW
YJBO_BACSU      TCANDDMTSVALQLETGRTHQIRVHMSYLGHPLCGDTLYGTRQEIGR--QALHSEHLSFIHPLTQENMRF
RLUD_RALSO      LDGRAQVSLVQCQLETGRTHQIRVHFESEGHPLLGDPVYTRNFRRGRARQALHAVRLGLVHPASGQSVHW
PUS2_ORYSJ      REVFGGSALVEWRLETGRTHQIRAHAKYLGIPLLGDETYGGTKSMALSRPCLHAALLGFKHPHSGKILEF
YHCT_BACSU      MASNAKLSLVELELETGRTHQIRVHLASLGHPLTGDSLYGGGSKLLNR-QALHANKVQAVHPITDELIVA
PUS2_ARATH      IETFGGSALVEWRLETGRTHQIRAHAKYMGVPLLGDEVYGGTKSMALSRPCLHAIVLGFTHPCTGEIVKF
RLUD_BUCAP      INRFKFHTHVSFRLETGRTHQIRVHMLHXXXXXXXXXXXXXXXXXCNFRQALHADYIEFIHPFTQKVMSW
Y292_MYCPN      LNQNEKAALIKCELLTGRTHQIRVHLQFIKHPVYNDPLYGLKSEQATEGQYLHAQQISFIHPTLNKEMGF
RLUC_VIBVU      IEKFPQATLVQASPITGRTHQIRVHTQYSGHPIAWDDRYGDRRFDAYTAQFLHAANIRFTHPATEQPMEI
RLUC_VIBPA      LEKFEQATLIQASPITGRTHQIRVHTQYTGHPIAWDDRYGDRRFDAYTGQFLHAANIKFQHPSNDEWMEI
RLUC_BUCAP      KKQYLFTTLVSITPKTGRTHQIRVHTLHAGHPILFDKRYGKRDLDCNNRLLLHATSINFIHPETGKKMHI
RLUC_SHIFL      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
RLUC_ECOLI      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
RLUC_PASMU      EERYEYATLVKASPVTGRTHQIRVHTQYAGHPIALDDKYGDKTQLGLTRLFLHAFSIRFEHPKTGETLRI
RLUC_ECOL6      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
RLUC_BUCBP      KKKYTKNTLISITPITGRTHQIRVHLLHLNYPIVLDAKYGIKKKFNINRLLLHAESINFFHPKRKKNILI
RLUC_ECO57      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLNRLFLHAAALKFTHPGTGEVMRI
RLUC_SALTI      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLKRLFLHAAALKFTHPGTGDVMRI
RLUC_SALTY      EERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREGTGLKRLFLHAAALKFTHPGTGEVMRI
RLUC_HAEDU      EERYPNATLIKASPITGRTHQIRVHTQYAGHPIACDDRYGDQKQAGLNRLFLHAHSIRFEHPKTAEQMFI
RLUC_VIBCH      LEKFAEATLVQASPVTGRTHQIRVHTQYMGHPIAWDDRYGDRRQFGIERLFLHAANIQFVHPASEKKLEI
Y1567_MYCBO     LEAFVAASLLDVHLETGRTHQIRVHFAALHHPCCGDLVYGAAKRLGLDRQWLHARSLAFAHPADGRRVEI
Y1540_MYCTU     LEAFVAASLLDVHLETGRTHQIRVHFAALHHPCCGDLVYGAAKRLGLDRQWLHARSLAFAHPADGRRVEI
RLUC_HAEIN      EERYINATLVKASPVTGRTHQIRVHTQYAGHPIALDDKYGDKNELGLNRLFLHAFSIRFEHPKNGETLRF
RLUC_BUCAI      KKKFSSSTLLSIIPKTGRTHQIRVHALHAGHPIFFDKRYGKNADIKNNHKLLHSSGVHFIHPKNGNKIYI
Y209_MYCGE      INQNEKAALISLELLTGRTHQIRVHLKFIQHPVYNDPLYGIKSEKKDSGQFLHANRICFIHPTLNKPMDF
Y745_HELPJ      LTSQNGMDLIGAKLFTGRTHQIRAHLEYLNRHIIGDNLYGLNGVLSKERIMLHAYLIEFKHPRSEQKLRF
RLUA_PASMU      LARYNNTTRVKLTPITGRSHQLRLHMLALGHPILGDKFYAPPQAKALSPRLLHAEQLAFRHPITQEWLSF
Y745_HELPY      LTSQNNLNLIGAKLFTGRTHQIRAHLEYLNRHIIGDNLYGLNGALPKERIMLHAYLIEFKHPRSEQKLRF
RLUA_VIBCH      VKREEKTTVVRLIPITGRSHQLRVHMQSLGHPIVGDDLYAPPEAVEFADRLLHAAELCFYHPRSHWLRTL
RLUC_YERPE      EERFEHATLVKASPVTGRTHQIRVHALHAGHPIAFDDRYGYRQGTGXXXXXXXXXXXXXEHPNTGETMRI
RLUC_PSEAE      LRRFGDFTLVEARPITGRTHQIRVHAKHAGHAIAGDPKYGDERELGGKRLFLHAAQLRVPLP-DGQVLEL
RLUA_VIBPA      AKREEQTTIVRLLPITGRSHQLRVHMQALGHPIVGDEFYATEEAKVFSERLLHASELSFYHPKSH-----
YDL36_YEAST     ISYDGKTSIVKCKPLTGRSHQIRVHLQYLGHPIANDPIYSNDEVWGNN----------------------
RLUA_VIBVU      AKREAQTTIMRLLPVTGRSHQLRVHMQALGHPIVGDEFYAQGDAFTFSERLLHAAELSFYHPKSH-----
Y956_HELPY      LKIINKKTLLKVGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPSLAKR-LMLHAHKIALLG------YEF
Y956_HELPJ      LKIINKKTLLKVGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPSSAKR-LMLHAHKIALLG------YEF
RLUC_RICBR      LKSLNNLFLVEFIPITGRMHQLRLHAKLLGCPIFGDNKYGNDKLMPYSKMFLHANNIVLSKKVFGKEVNL
Y505_ZYMMO      LAKNKGRSLVAFRPETGRTHQLRVHAATLGLPIVGDPFYGSHKDENISRMMLHAHSLEIAR-LEKKPITA
RLUA_HAEIN      LARLNNSTRVKLTPVTGRSHQLRLHMLALGHPILGDKFYSPQAKVMSPRLCLHAEELTITHPITGETMTF
YK27_CAEEL      LWSDGTQSVVQVHIETGRTHQIRVHSQFLGHPIAGDQIYGPTK---------------------------
TRUC_HAEIN      LKRYARYSLVKLIPHTGRKHXLRXHMKHVFHPIXGDTQYGDMSHLGCSRLFLHSDSLSFIHPITKEQITI
RLUC_RICFE      LKSLNNLFLIEFTPVTGRMHQLRLHAKLLGCPIVGDDKYGNKEIMPYSKMFLHANNICLSEKIFGKEINL
RLUA_YERPE      ISRDDDSTRVKLSPITGRSHQLRVHMLAMGHPILGDGFYAPEAKAMASRLQLHAQQLCITHPEFGTPMHF
RLUA_SHIFL      VEYAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDRFYSPEARAMAPRLLLHAEMLTITHPAYGNSMTF
RLUA_ECOLI      VEYAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDRFYSPEARAMAPRLLLHAEMLTITHPAYGNSMTF
RLUA_ECOL6      VEYAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDRFYSPEARAMAPRLLLHAEMLTITHPAYGNSMTF
RLUC_RICCN      LKSLNNLFLIEFTPVTGRMHQLRLHAKLLGCPILGDDKYGNKEIMPYSKMFLHANNICLSEKIFGQESKL
RLUA_ECO57      VEYAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDRFYSPEARAMAPRLLLHAEMLTITHPAYGNSMTF
RLUA_SALTI      VEFAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDQFYASPEALSLAPRLLHAEMLTITHPAYGNSMTF
RLUC_RICPR      XXXXXXXXXIEFMPVTGRMHQLRLHAQLLGCPILGDDKYGNKEIMPYSKMFLHANNIYLSETIVGKEIKL
RLUA_SALTY      VEFAADNT-ARVVLKTGRSHQLRVHMLALGHPILGDRFYASPEALSLAPRLLHAEMLTITHPAYGNSMTF
RLUA_HAEDU      LEHLANNTTVKFTPITGRSHQLRVHSLALGHPIIGDKFYANPLAKSLAPRLLHAESLTIAHPISAELMTF
PUS7_ARATH      IDTNGTHSLVSCEPVTGRTHQIRVHLQYTGHPIANDPLY-------------------------------
YA32_SCHPO      IAFDGHTSLVLCKPLTGRTHQLRVHLQYLGYPIANDPIYANKRVWGPS----------------------
RUSD1_DANRE     LE-YGTYQVTKVLLQTGRTHQLRVHCSAIGHPIVGDYTYSLRTDNSPYRMMLHAY---FLHPLHNEPIHV
TRUC_HAEDU      LAKVERYSLVALSPKTGRKHQLRRHMKHLFHPIMGDTKYGDTEKTGCNRLMLHARLLHFTHPKTLQKITI
RLUC_RICTY      XXXXXXXXXIEFMPVTGRMHQLRLHAQLLGCPILGDDKYGNKEVMPYSKMFLHANNIYLSESIVGKEIKL
RIB2_YEAST      VSYDGQTSIVKCKPLTGRTHQIRVHLQYLGFPIANDPIY-------------------------------
RUSD2_HUMAN     LSYNGQSSVVRCRPLTGRTHQIRVHLQFLGHPILNDPIY-------NSVAWGPSRGRGGYIPKTNEELLR
TRUC_PASMU      LKKYPTYSLVRLIPHTGRKHQLRRHMKHLFHPILGDTQYGDRALTTHTGLMLHAERLIFTHPITQQQITI
PUS7_ORYSJ      ICTDGIHSIVLCKPVTGRTHQIRVHLKHIGYPIANDEVYSPRSSKG------------------------
RUSD2_MOUSE     LSYNGRSSVVQCRPLTGRTHQIRVHLQFLGHPILNDPIYNSTAWGPSRGQGGHI-------PKTDEELLR
TRUC_YERPE      LARYARYSLVALKPETGRKHQLRRHMAHIRHPIIGDSTHGDLRQFGCSRLMLHASHLHLNHPVTGEALTL
RUSD1_MOUSE     LEHYAGDPVSKVLLKTGRTHQLRVHCSALGHPIVGDLTYG------------------------------
PUS5_ORYSJ      LERLKNHTLIQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGPTSTAGDCGYHLHAHWLVLCHPTTNEMIKI
RUSD1_BOVIN     LEHYAGDPVSKVLLQTGRTHQLRVHCSALGHPIVGDLTYG--HALGQEDQMLHAFYLRI--PTSAECVEA
TRUC_VIBPA      LAKVERYCLMEMKPKTGRKHQLRRHMAHLRHPIVGDTSHGDRNEFDSHRLLLHASELRFVHPFTNEELVM
PUS6_YEAST      IRYFSDETVVACKPITGRTHQIRIHLARLGHPIVNDSVY-------------------------------
RUSD1_HUMAN     LEHYAGDPVSKVLLKTGRTHQLRVHCSALGHPVVGDLTYG------------------------------
TRUC_VIBCH      LAKVGKFATTRCLMETGRKHQLRRHMAHLRHPIVGDTTHGDREHFSAQRLMLHASELRFMHPYTQQPLVI
TRUC_PECCC      LARYARYSLMELKPQTGRKHQLRRHMSHIHHPIIGDTAHGDRHNRGMESHFLHASELQLNHPVSGQPLTL
TRUC_VIBVU      LAKVERYGLMELKPKTGRKHQLRRHMAHLRHPIVGDTTHGDREEFDAPRLLLHASELRFVHPYTQQEVVI
Y347_HELPY      LSYFLDISLLKITPLTGRTHQIRLHLSSVDHRIVGEGLYGVADE--NAREYLQLKRLLMLHAASLEFYKI
Y042_HAEIN      VSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPILGDGLYG-KNTEKIDRTYLHATQLEF-----------
Y370_MYCGE      SSYIADMSLITIRLISGRTHQIRACLNLFSNQLVGDKKYSLIQFKNRNNKYLHAYELVFPKLETSKF---
Y1592_SYNY3     LARSPEKTWLEVEIRTGRPHQIRIHLASLGYPLLGDRLYGPTARPSDGGYTLHSYQLGFLHLHTQQAIKL
Y548_MYCPN      SKYLTDLSLLTIRLVSGKTHQIRACLNLLNTQLVGDRKYQLLQFKNRNRDFLHATNLSF-----------
Y347_HELPJ      LSYFLDISLLKITPLTGRTHQIRLHLSSVDHRIVGEGLYGVKRENNAPTLMLHAASLEFEF--KGAHYKI
PUS4_ARATH      IESSHGYTWLELRPLTGRKHQLRVHAEVLGTPIVGDYKYG------------------------------
TRUC_ECOL6      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQFGLQRLMLHASQLSLTHPFTGEPLAI
PUS5_ARATH      LERDREKSLVKVEIQSGRPHQIRIHLAYMGHPLVGDPLY-------------------------------
PUS1_ORYSJ      LEKAADLTLVRAYPQSGRTHQIRLHCQYLGFPIRGDVKYSEWNGVDYDGHALHAESLSFVHPVTGLPVTF
TRUC_SHIFL      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQFGLQRLMLHASQLSLTHPFTGEPLTI
TRUC_ECOLI      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQFGLQRLMLHASQLSLTHPFTGEPLTI
TRUC_ECO57      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQFGLQRLMLHASQLSLTHPFTGEPLTI
TRUC_SALTY      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQNRSAAEMLHASRLELTHPFTGQPLII
TRUC_SALTI      LARYPTYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGDLRQNRSAAEMLHASRLELTHPFTGQPLII
PUS3_ARATH      LPKINGCSWVELRPITSRKHQLRVHAEALGTPIVGDYKYG------------------------------
PUS4_ORYSJ      LTEYQGYTWLELFPRTGRKHQRFLEPQLLG----------------------------------------
RUSD4_HUMAN     LSSTLSSALVELQPITGIKHQLRVHLSFLDCPILGDHKY-------------------------------
PUS1_ARATH      IVAEGERELXRAFPRSGRTHQIRLHCQYLGIPIRGDVKYGVYEWNGRTGHELHAECLSLDHPVTGDSIVI
RUSD4_RAT       LSSTPSSALVELQPVTGIKHQLRVHLAFLDCPILGDHKY-------------------------------
RUSD4_XENTR     LGAASGASLVELHPITGVKHQLRVHLALLNCPILGDHKYAPQKALGTLSLHLHAVQLTLPSSDGSTPIVL
RUSD4_BOVIN     XXXXXXXXXXELQPITGIKHQLRVHMSFLDCPILGDHKY-------------------------------
PUS3_ORYSJ      MPTIHGCSWIELRPLTGRKHQLRVHAEALGTPIVGDYKYG------------------------------
RUSD4_MOUSE     XXXXXXXXXXELQPVTGIKHQLRVHLSFLDCPILGDHKY-------------------------------
MLRR1_PLAF7     -----EFTLCNVKIHTGRTHQIRVHMRHIGHPLVSDKKY-LNPSLSNLDKFLHSLILEFNNP--------
Y714_MYCCT      EFXXXXXXXXXXXXXTGKKHQIRSVLSFYNNPILNDFRYNGKKENDQKMIYLAAFKIEF-----------
PUS5_CANAL      IPQQGPILPIILELETGRKNQIRDHIQKFGVPLLNDDNFSDFK---------------------------
RUSD4_DANRE     LDNTSGCSLVELQPLTGVKNQLRVHMALLTCPILGDHKYSPEGTLRRLGLHLHSRRIVLPGFKGHRDITV
PUS5_ASHGO      ITDYKENDLVLLQLQTGRKHQIRKQMAQVGQPVVNDKMYG------------------------------
PUS5_YEAST      V----DENCIVLQLVTGKKHQIRNHVSQINQPILNDKRHG------------------------------
RUSD3_HUMAN     VATGSGCALVQLQPLTVFSSQLQVHMVLQLCPVLGDHMYSAR----------------------------
RUSD3_BOVIN     VATGSGCALVQLQPLTVFPSQLQAHMALQLCPVLGDHTYSAR----------------------------
RUSD3_MOUSE     MATGRGCALVQLQPLTVFPNQLQVHMALQLCPILGDHTYAAR----------------------------
Y1464_AQUAE     VRYEGKNTLLEITFHEGRKHLVKRFLGAFGH---------------------------------------
YE59_HELPJ      IKNHAKYSKLRVIINEGKNRELR-----------------------------------------------
Y1459_HELPY     IKNHAKYSKLRVIINEGKNRELR-----------------------------------------------
RS4_DEIRA       ----------------------------------------------------------------------
RS4B_CLOAB      ----------------------------------------------------------------------
PUS6_ARATH      -------------LLTGKTHQIRAQLAACGAPLVGDSMYMP-----------------------------
PUS6_ORYSJ      ----------KINLLTGKTHQIRAQLAAIGTPIVGDSAY-------------------------------
RS4_NATTJ       ----------------------------------------------------------------------
RS4_DEIGD       ----------------------------------------------------------------------
RS4_DEIDV       ----------------------------------------------------------------------
RS4_ALCBS       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TAPLPENFKKLLESLDKR
YLYB_BACSU      EAPLPEDMAELIENLRK-
Y901_CHLAA      TAPLPADLQIVLRQLQDR
Y1758_AQUAE     EIEEPETFKSVYSWLEE-
Y1629_SYNY3     IAPMPAHFEKLLVYLRQR
RLUD_ZYMMO      DAEMPQDMQLLFKML---
RLUD_VIBPA      HAPVPDDMVAMTEALRK-
RLUD_HAEDU      HAPLPADFVELIEAL---
RLUD_PASMU      HAPLPTDFVELVEAL---
RLUD_VIBVU      HAPVPDDMVELTETL---
RLUD_NITEU      ESPLPDDMAALLQAI---
Y723_CHLP8      SAPLPEDMELVLEKI---
RLUD_YERPE      HAALPEDMVELINAL---
RLUD_PSEAE      ESPLPEDFLWLLSLL---
RLUD_SHIFL      HAPIPQDMVELIE-----
RLUD_ECOLI      HAPIPQDMVELIE-----
RLUD_ECOL6      HAPIPQDMVELIE-----
RLUD_ECO57      HAPIPQDMVELIE-----
RLUD_HAEIN      YAPLPDDFVELLNAL---
RLUD_NEIMB      EAPIPNDIYHLLSVL---
RLUD_XYLFT      VAPVPEDLCQLLAAL---
RLUD_XYLFA      VAPVPEDLCQLLAVL---
RLUD_SALTY      HAPIPQDMVDLIDAM---
RLUD_SALTI      HAPIPQDMVDLIDAM---
RLUD_NEIMA      EAPIPDDIYHLLSVL---
RLUD_XANCP      SAPVPEDLQRLMSAL---
RLUD_XANAC      SAPVPADLQRLMTVL---
RLUD_BUCBP      NSTLPRDMLNLIALLNK-
RLUD_BUCAI      TVPLPQDIQELL------
RLUD_BORBU      ISEFPKRFVIFLSNFYK-
RLUD_VIBCH      HAPVPDDMVEMTLAL---
RLUD_BLOFL      NAPLPQDILQLIAILKK-
YJBO_BACSU      HAPLPQDMSKLIK-----
RLUD_RALSO      HAGVPDDLAELMDALE--
PUS2_ORYSJ      SCPPPDDFTEVLNEL---
YHCT_BACSU      EAPFPADMKNL-------
PUS2_ARATH      SCPPPSDLAEIV------
RLUD_BUCAP      SASLPQDMKDILLYLKK-
Y292_MYCPN      EAQLDKTFSDKLDNLN--
RLUC_VIBVU      NAPMGEQLEKVVQSL---
RLUC_VIBPA      NAPMESKLEKVLVGLRK-
RLUC_BUCAP      VAPLDVYFKNYLNTL---
RLUC_SHIFL      EAPMDEGLKRCLQKL---
RLUC_ECOLI      EAPMDEGLKRCLQKL---
RLUC_PASMU      NAPLDPEMKKILGAL---
RLUC_ECOL6      EAPMDEGLKRCLQKL---
RLUC_BUCBP      TAPLDYVFKTVLKNL---
RLUC_ECO57      EAPMDDGLKRCLQKL---
RLUC_SALTI      EAPMDKQLKRCLEVL---
RLUC_SALTY      EAPMDNALKRCLQVL---
RLUC_HAEDU      TAPLDHHLKTILAKL---
RLUC_VIBCH      HAPLEAHLEQALTKM---
Y1567_MYCBO     VSPYPADLQHALKIL---
Y1540_MYCTU     VSPYPADLQHALKIL---
RLUC_HAEIN      NASLDHQMKAILQKL---
RLUC_BUCAI      KAPLDIDFQNYLNTI---
Y209_MYCGE      HAPLEPKF----------
Y745_HELPJ      KVPL---LKDMLEYLKK-
RLUA_PASMU      SAP---------------
Y745_HELPY      KVPL---LKDMLEYLKK-
RLUA_VIBCH      FVPYPEAEEQILQHFD--
RLUC_YERPE      EAPLDNQLRHCLLALRK-
RLUC_PSEAE      EAPVDEMWQRSLERLN--
RLUA_VIBPA      ------------------
YDL36_YEAST     ------------------
RLUA_VIBVU      ------------------
Y956_HELPY      EAIAPKEFE---------
Y956_HELPJ      EAIAPKEFE---------
RLUC_RICBR      EAKLPSYFNRV-------
Y505_ZYMMO      EAPLPKAFTDL-------
RLUA_HAEIN      NA----------------
YK27_CAEEL      ------------------
TRUC_HAEIN      TAGLDEQWQQLM------
RLUC_RICFE      EAKLPFYF----------
RLUA_YERPE      ------------------
RLUA_SHIFL      KAP---------------
RLUA_ECOLI      KAP---------------
RLUA_ECOL6      KAP---------------
RLUC_RICCN      EAKLPFYFTRRL------
RLUA_ECO57      KAP---------------
RLUA_SALTI      KVP---------------
RLUC_RICPR      EAKLPFYFTR--------
RLUA_SALTY      KVP---------------
RLUA_HAEDU      ------------------
PUS7_ARATH      ------------------
YA32_SCHPO      ------------------
RUSD1_DANRE     TAPDP-------------
TRUC_HAEDU      SALLDQQWQML-------
RLUC_RICTY      EAKLPFYFTRRL------
RIB2_YEAST      ------------------
RUSD2_HUMAN     DLVAEHQAKQSLDVLD--
TRUC_PASMU      CAGVDQQWLDLINIFD--
PUS7_ORYSJ      ------------------
RUSD2_MOUSE     DLVAEHQAKESLSMLD--
TRUC_YERPE      TARWDEPWQGLM------
RUSD1_MOUSE     ------------------
PUS5_ORYSJ      TAPLPHILQTREEQQD--
RUSD1_BOVIN     CTPDP-------------
TRUC_VIBPA      KASIDDTWQQL-------
PUS6_YEAST      ------------------
RUSD1_HUMAN     ------------------
TRUC_VIBCH      RAGLDEVWQGLL------
TRUC_PECCC      QA----------------
TRUC_VIBVU      RAEVDKVWQQLFERFE--
Y347_HELPY      ASPMPERFMPFLKDL---
Y042_HAEIN      ------------------
Y370_MYCGE      ------------------
Y1592_SYNY3     TAPLP-------------
Y548_MYCPN      ------------------
Y347_HELPJ      ASPMPERFMPFLK-----
PUS4_ARATH      ------------------
TRUC_ECOL6      HAGLDDTWMQALSQFGWR
PUS5_ARATH      ------------------
PUS1_ORYSJ      RSPLP-------------
TRUC_SHIFL      HAGLDDTWMQALSQFGWR
TRUC_ECOLI      HAGLDDTWMQALSQFGWR
TRUC_ECO57      HAGLDDTWMQALSQFGWR
TRUC_SALTY      QAGLDETWMQAL------
TRUC_SALTI      QAGLDETWMQVL------
PUS3_ARATH      ------------------
PUS4_ORYSJ      ------------------
RUSD4_HUMAN     ------------------
PUS1_ARATH      RAPLP-------------
RUSD4_RAT       ------------------
RUSD4_XENTR     QCPLPYTFRKTLRKL---
RUSD4_BOVIN     ------------------
PUS3_ORYSJ      ------------------
RUSD4_MOUSE     ------------------
MLRR1_PLAF7     ------------------
Y714_MYCCT      ------------------
PUS5_CANAL      ------------------
RUSD4_DANRE     SCPLPKYFINALKRLE--
PUS5_ASHGO      ------------------
PUS5_YEAST      ------------------
RUSD3_HUMAN     ------------------
RUSD3_BOVIN     ------------------
RUSD3_MOUSE     ------------------
Y1464_AQUAE     ------------------
YE59_HELPJ      ------------------
Y1459_HELPY     ------------------
RS4_DEIRA       ------------------
RS4B_CLOAB      ------------------
PUS6_ARATH      ------------------
PUS6_ORYSJ      ------------------
RS4_NATTJ       ------------------
RS4_DEIGD       ------------------
RS4_DEIDV       ------------------
RS4_ALCBS       ------------------