[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99654.1

[Show Plain Result]


## Summary of Sequence Search
    1::429
  155::280     7e-09  29%  388 aa  MRP4_STRPY RecName: Full=Fibrinogen- and Ig-binding
  831::915     1e-07  35% 1203 aa  SMC2_XENLA RecName: Full=Structural maintenance of chromosomes
  864::994     4e-07  32% 1690 aa  CL190_DROME RecName: Full=Restin homolog;AltName: Full=Cytoplasmic
  340::472     5e-07  28%  654 aa  SAS6_MOUSE RecName: Full=Spindle assembly abnormal protein 6
  881::1005    5e-07  35% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
  622::720     9e-07  30% 1302 aa  CGNL1_HUMAN RecName: Full=Cingulin-like protein 1;AltName:
  696::767     2e-06  29%  808 aa  Y066_NPVAC RecName: Full=Uncharacterized 94.0 kDa protein in
  348::475     2e-06  32% 1805 aa  HMW2_MYCGE RecName: Full=Cytadherence high molecular weight protein
  814::937     3e-06  20% 1191 aa  SMC2_MOUSE RecName: Full=Structural maintenance of chromosomes
   85::204     3e-06  31% 1300 aa  NPHP3_XENLA RecName: Full=Nephrocystin-3;
  814::937     4e-06  20% 1197 aa  SMC2_HUMAN RecName: Full=Structural maintenance of chromosomes
  389::494     6e-06  27%  564 aa  ICR3_ARATH RecName: Full=Interactor of constitutive active ROPs 3;
   38::131     8e-06  31%  165 aa  ATPF_ELUMP RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  782::882     1e-05  29% 1128 aa  SMC6_XENLA RecName: Full=Structural maintenance of chromosomes
  388::524     1e-05  26%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
 1059::1158    1e-05  32% 1411 aa  EEA1_MOUSE RecName: Full=Early endosome antigen 1;
  793::919     1e-05  25% 1233 aa  SMC1A_RAT RecName: Full=Structural maintenance of chromosomes
  793::919     1e-05  25% 1233 aa  SMC1A_MOUSE RecName: Full=Structural maintenance of chromosomes
  793::919     1e-05  25% 1233 aa  SMC1A_HUMAN RecName: Full=Structural maintenance of chromosomes
  793::919     1e-05  25% 1233 aa  SMC1A_BOVIN RecName: Full=Structural maintenance of chromosomes
  509::628     1e-05  29%  879 aa  RAD50_PYRHO RecName: Full=DNA double-strand break repair rad50
 1518::1624    1e-05  26% 2050 aa  MY18A_MOUSE RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  337::437     1e-05  29%  572 aa  MOEH_CULQU RecName: Full=Moesin/ezrin/radixin homolog 1;
  632::736     1e-05  23% 1118 aa  CYTSA_CHICK RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  506::614     1e-05  30% 1140 aa  CP135_MOUSE RecName: Full=Centrosomal protein of 135 kDa;       
  964::1084    1e-05  24% 1454 aa  CCD18_HUMAN RecName: Full=Coiled-coil domain-containing protein
  477::576     2e-05  27%  975 aa  KINH_DROME RecName: Full=Kinesin heavy chain;
 1137::1259    2e-05  26% 1487 aa  GOGA3_MOUSE RecName: Full=Golgin subfamily A member 3;AltName:
  685::784     2e-05  36% 1622 aa  FKBP5_DICDI RecName: Full=FK506-binding protein 5;       
  631::735     2e-05  23% 1117 aa  CYTSA_PANTR RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  631::735     2e-05  23% 1117 aa  CYTSA_HUMAN RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  175::273     2e-05  21%  284 aa  TPM_CHLNI RecName: Full=Tropomyosin;
  236::345     2e-05  26%  638 aa  MYSP_OPIFE RecName: Full=Paramyosin;Flags: Fragment;
 1041::1140    2e-05  24% 1947 aa  MYO2_CAEEL RecName: Full=Myosin-2;AltName: Full=Myosin heavy chain C;
 1135::1290    3e-05  31% 1790 aa  USO1_YEAST RecName: Full=Intracellular protein transport protein
   53::180     3e-05  24%  187 aa  ATPF_CLOPH RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   59::146     4e-05  27%  202 aa  YJNB_SCHPO RecName: Full=Uncharacterized protein SPCC24B10.11c;
    4::91      4e-05  33%  203 aa  VATE_METM5 RecName: Full=V-type ATP synthase subunit E;AltName:
   20::111     4e-05  31%  759 aa  SEC2_YEAST RecName: Full=Rab guanine nucleotide exchange factor
 1209::1308    4e-05  24% 1979 aa  MYH11_CHICK RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
 1522::1632    4e-05  23% 2054 aa  MY18A_HUMAN RecName: Full=Myosin-XVIIIa;AltName: Full=Myosin
  506::620     4e-05  30%  782 aa  MUTS2_STAS1 RecName: Full=MutS2 protein;
  257::363     4e-05  23%  763 aa  KLPA_EMENI RecName: Full=Kinesin-like protein klpA;
  709::811     4e-05  27%  967 aa  KINH_LOLPE RecName: Full=Kinesin heavy chain;
  980::1080    4e-05  27% 1298 aa  CGNL1_MOUSE RecName: Full=Cingulin-like protein 1;AltName:
  793::919     5e-05  24% 1232 aa  SMC1A_XENLA RecName: Full=Structural maintenance of chromosomes
  185::296     5e-05  24%  642 aa  ODF2L_MOUSE RecName: Full=Outer dense fiber protein 2-like;
  376::476     5e-05  30% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  485::620     5e-05  25% 1251 aa  CING_XENTR RecName: Full=Cingulin;
  362::450     5e-05  29% 1197 aa  CING_PAPAN RecName: Full=Cingulin;
  798::867     5e-05  34% 1191 aa  CING_MOUSE RecName: Full=Cingulin;
  965::1085    5e-05  23% 1455 aa  CCD18_MOUSE RecName: Full=Coiled-coil domain-containing protein 18;
  334::453     6e-05  22% 1114 aa  SMC6_YEAST RecName: Full=Structural maintenance of chromosomes
  849::980     6e-05  26% 1418 aa  SMC4_YEAST RecName: Full=Structural maintenance of chromosomes
  936::1053    6e-05  27% 1415 aa  SMC4_DICDI RecName: Full=Structural maintenance of chromosomes
  486::600     6e-05  23%  993 aa  RAD50_METMP RecName: Full=DNA double-strand break repair rad50
  907::1018    6e-05  30% 1966 aa  MYO4_CAEEL RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain B;
  949::1062    6e-05  27% 2104 aa  MYO3_SCHPO RecName: Full=Myosin type-2 heavy chain 2;AltName:
  598::727     6e-05  21% 1115 aa  MBO1_SCHPO RecName: Full=Microtubule organizer protein 1;AltName:
 1164::1275    6e-05  27% 1364 aa  KTN1_CHICK RecName: Full=Kinectin;
 3126::3216    6e-05  25% 4334 aa  DYHC2_CHLRE RecName: Full=Cytoplasmic dynein 2 heavy chain 1;AltName:
  505::610     6e-05  26% 2028 aa  DAPLE_HUMAN RecName: Full=Protein Daple;AltName:
  132::193     6e-05  29%  601 aa  CIP4_PONAB RecName: Full=Cdc42-interacting protein 4;AltName:
  132::193     6e-05  29%  601 aa  CIP4_HUMAN RecName: Full=Cdc42-interacting protein 4;AltName:
  652::754     6e-05  31% 1101 aa  CC150_HUMAN RecName: Full=Coiled-coil domain-containing protein
  379::478     6e-05  29%  840 aa  CAGE1_MACFA RecName: Full=Cancer-associated gene 1 protein homolog;
    5::126     8e-05  28%  423 aa  SYS_MACCJ RecName: Full=Seryl-tRNA synthetase;       
  851::955     8e-05  24% 2115 aa  NUMA1_HUMAN RecName: Full=Nuclear mitotic apparatus protein 1;     
  201::314     8e-05  24%  463 aa  NUF2_ASPFU RecName: Full=Probable kinetochore protein nuf2;
 1344::1472    8e-05  26% 1509 aa  MYSN_ACACA RecName: Full=Myosin-2 heavy chain, non muscle;AltName:
  806::947     8e-05  27% 1875 aa  MLP1_YEAST RecName: Full=Protein MLP1;AltName: Full=Myosin-like
  742::850     8e-05  32% 1244 aa  MIX1_CAEEL RecName: Full=Mitotic chromosome and
  543::664     8e-05  26% 1031 aa  KINH_STRPU RecName: Full=Kinesin heavy chain;
  409::489     8e-05  38%  911 aa  IMH1_YEAST RecName: Full=Golgin IMH1;AltName: Full=Integrins and
 1718::1847    8e-05  21% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  100::225     8e-05  27%  483 aa  CE57R_XENTR RecName: Full=Cep57-related protein;       
   60::155     1e-04  33%  470 aa  Y864_MYCCT RecName: Full=Uncharacterized protein MCAP_0864;AltName:
 1021::1105    1e-04  34% 1149 aa  TACC2_MOUSE RecName: Full=Transforming acidic coiled-coil-containing
  282::375     1e-04  20%  640 aa  SAS6_CHICK RecName: Full=Spindle assembly abnormal protein 6
  977::1075    1e-04  36% 1318 aa  RAD50_DROME RecName: Full=DNA repair protein RAD50;       
 1010::1106    1e-04  34% 1962 aa  MYSA_DROME RecName: Full=Myosin heavy chain, muscle;
   96::209     1e-04  27%  498 aa  MNS1_RAT RecName: Full=Meiosis-specific nuclear structural protein
  275::409     1e-04  27%  467 aa  K1C1_CARAU RecName: Full=Keratin, type I cytoskeletal 50
  425::533     1e-04  24% 1029 aa  HIP1_MOUSE RecName: Full=Huntingtin-interacting protein 1;       
  132::193     1e-04  29%  547 aa  CIP4_RAT RecName: Full=Cdc42-interacting protein 4;AltName:
  132::193     1e-04  29%  603 aa  CIP4_MOUSE RecName: Full=Cdc42-interacting protein 4;AltName:
  323::445     1e-04  22%  703 aa  CEP63_MACFA RecName: Full=Centrosomal protein of 63 kDa;       
  176::246     1e-04  28%  246 aa  BAP31_HUMAN RecName: Full=B-cell receptor-associated protein
  261::357     1e-04  34% 1500 aa  SSP5_STRGN RecName: Full=Agglutinin receptor;AltName:
  767::865     1e-04  34% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
  379::478     1e-04  26%  697 aa  MFP1_SOLLC RecName: Full=MAR-binding filament-like protein 1;
   93::196     1e-04  23%  596 aa  LMNB2_MOUSE RecName: Full=Lamin-B2;
  461::573     1e-04  22%  963 aa  KINH_RAT RecName: Full=Kinesin-1 heavy chain;AltName:
  461::573     1e-04  22%  963 aa  KINH_HUMAN RecName: Full=Kinesin-1 heavy chain;AltName:
 1059::1191    1e-04  27% 1411 aa  EEA1_HUMAN RecName: Full=Early endosome antigen 1;AltName:
  364::452     1e-04  28% 1198 aa  CING_CALJA RecName: Full=Cingulin;
  176::246     1e-04  28%  246 aa  BAP31_PONAB RecName: Full=B-cell receptor-associated protein
  821::928     1e-04  31% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
  758::856     2e-04  34% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
  767::865     2e-04  34% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
  767::865     2e-04  34% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
   49::180     2e-04  20%  441 aa  ROCK1_BOVIN RecName: Full=Rho-associated protein kinase 1;       
  106::184     2e-04  33%  495 aa  MNS1_MACFA RecName: Full=Meiosis-specific nuclear structural
 1275::1402    2e-04  20% 1774 aa  KI20B_MOUSE RecName: Full=Kinesin-like protein KIF20B;AltName:
  620::745     2e-04  22% 1129 aa  FIL1L_DANRE RecName: Full=Filamin A-interacting protein 1-like;
  362::450     2e-04  28% 1197 aa  CING_HUMAN RecName: Full=Cingulin;
  593::715     2e-04  29% 1161 aa  CING_DANRE RecName: Full=Cingulin;
   12::113     2e-04  33%  284 aa  TPM2_SCHMA RecName: Full=Tropomyosin-2;AltName: Full=Tropomyosin
  692::819     2e-04  26% 1130 aa  TG278_CAEEL RecName: Full=Putative protein tag-278;
 2820::2904    2e-04  33% 2948 aa  TACC2_HUMAN RecName: Full=Transforming acidic coiled-coil-containing
  119::243     2e-04  26% 1286 aa  RPOC_TROWT RecName: Full=DNA-directed RNA polymerase subunit beta';
  119::243     2e-04  26% 1286 aa  RPOC_TROW8 RecName: Full=DNA-directed RNA polymerase subunit beta';
 1008::1102    2e-04  32% 1938 aa  MYS_AEQIR RecName: Full=Myosin heavy chain, striated muscle;
 1401::1541    2e-04  24% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
  625::724     2e-04  27%  873 aa  MYSP_BOOMI RecName: Full=Paramyosin;
 1733::1805    2e-04  37% 1938 aa  MYH13_HUMAN RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
   96::184     2e-04  30%  495 aa  MNS1_BOVIN RecName: Full=Meiosis-specific nuclear structural
  632::736     2e-04  21% 1118 aa  CYTSA_MOUSE RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  721::821     2e-04  29% 1223 aa  COS_DROPS RecName: Full=Kinesin-like protein costa;AltName:
  400::486     2e-04  27%  859 aa  CLPB_NEIMB RecName: Full=Chaperone protein clpB;
  400::486     2e-04  27%  859 aa  CLPB_NEIMA RecName: Full=Chaperone protein clpB;
  765::846     2e-04  31% 1153 aa  CING_SORAR RecName: Full=Cingulin;
  323::445     2e-04  23%  541 aa  CEP63_PONAB RecName: Full=Centrosomal protein of 63 kDa;       
 1174::1300    2e-04  28% 1709 aa  ANR26_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
 3112::3228    2e-04  32% 3911 aa  AKAP9_HUMAN RecName: Full=A-kinase anchor protein 9;       
  720::833     3e-04  25% 2064 aa  ZN318_MOUSE RecName: Full=Zinc finger protein 318;AltName:
  211::364     3e-04  26%  697 aa  TSG10_MOUSE RecName: Full=Testis-specific gene 10 protein;
  194::273     3e-04  22%  284 aa  TPM_PERVI RecName: Full=Tropomyosin;
  194::273     3e-04  22%  284 aa  TPM_MYTGA RecName: Full=Tropomyosin;
  194::273     3e-04  22%  284 aa  TPM_MYTED RecName: Full=Tropomyosin;
    5::114     3e-04  25%  436 aa  SYS_LACGA RecName: Full=Seryl-tRNA synthetase;       
  374::498     3e-04  24% 1189 aa  SMC2_CHICK RecName: Full=Structural maintenance of chromosomes
  106::184     3e-04  33%  495 aa  MNS1_HUMAN RecName: Full=Meiosis-specific nuclear structural
  166::280     3e-04  31%  483 aa  M6B_STRP6 RecName: Full=M protein, serotype 6;Flags: Precursor;
   93::189     3e-04  31%  566 aa  LMN1_CAEEL RecName: Full=Lamin-1;AltName: Full=CeLam-1;AltName:
 1385::1504    3e-04  24% 3259 aa  GOGB1_HUMAN RecName: Full=Golgin subfamily B member 1;AltName:
  254::375     3e-04  25%  731 aa  GOGA5_HUMAN RecName: Full=Golgin subfamily A member 5;AltName:
  687::778     3e-04  24% 1219 aa  FKB15_HUMAN RecName: Full=FK506-binding protein 15;AltName:
  131::192     3e-04  24%  605 aa  FBP1L_RAT RecName: Full=Formin-binding protein 1-like;AltName:
  131::192     3e-04  24%  605 aa  FBP1L_MOUSE RecName: Full=Formin-binding protein 1-like;AltName:
  131::192     3e-04  24%  605 aa  FBP1L_HUMAN RecName: Full=Formin-binding protein 1-like;AltName:
   72::156     3e-04  24%  520 aa  CNPD_BACCR RecName: Full=2',3'-cyclic-nucleotide
  543::635     3e-04  25% 1094 aa  CN145_HUMAN RecName: Full=Uncharacterized protein C14orf145;
  296::411     3e-04  27%  862 aa  CK5P2_MACFA RecName: Full=CDK5 regulatory subunit-associated
  758::877     3e-04  28%  987 aa  CE120_BOVIN RecName: Full=Centrosomal protein of 120 kDa;       
  400::538     3e-04  27% 1051 aa  APSB_EMENI RecName: Full=Anucleate primary sterigmata protein B;
  234::332     4e-04  27%  414 aa  Y9I8_ENCCU RecName: Full=Uncharacterized protein ECU09_1880;
  314::421     4e-04  26% 1186 aa  SMC_BACSU RecName: Full=Chromosome partition protein smc;
  107::179     4e-04  33%  286 aa  PU92_SCICO RecName: Full=Puff II/9-2 protein;Flags: Precursor;
 1120::1269    4e-04  25% 2057 aa  MYSN_DROME RecName: Full=Myosin heavy chain, non-muscle;AltName:
  114::206     4e-04  26% 1102 aa  MYSC_CHICK RecName: Full=Myosin heavy chain, cardiac muscle
  940::1055    4e-04  22% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
 1561::1656    4e-04  27% 1960 aa  MYH9_CANFA RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
  803::917     4e-04  31%  931 aa  MASK_XENLA RecName: Full=CPEB-associated factor Maskin;AltName:
 1165::1293    4e-04  28% 1922 aa  KIF4_DICDI RecName: Full=Kinesin-related protein 4;AltName:
  723::870     4e-04  29% 1388 aa  KIF15_HUMAN RecName: Full=Kinesin-like protein KIF15;AltName:
  282::398     4e-04  25%  457 aa  K2C7_RAT RecName: Full=Keratin, type II cytoskeletal 7;AltName:
  282::398     4e-04  25%  457 aa  K2C7_MOUSE RecName: Full=Keratin, type II cytoskeletal 7;AltName:
  132::200     4e-04  29%  610 aa  FNBP1_XENLA RecName: Full=Formin-binding protein 1 homolog;
  132::222     4e-04  26%  617 aa  FNBP1_HUMAN RecName: Full=Formin-binding protein 1;AltName:
  775::875     4e-04  26% 1133 aa  FBF1_HUMAN RecName: Full=Fas-binding factor 1;         Short=FBF-1;
  402::511     4e-04  24%  809 aa  EVI5_MOUSE RecName: Full=Ecotropic viral integration site 5
  402::511     4e-04  24%  810 aa  EVI5_HUMAN RecName: Full=Ecotropic viral integration site 5 protein
 1040::1147    4e-04  18% 2871 aa  DESP_HUMAN RecName: Full=Desmoplakin;         Short=DP;AltName:
  702::811     4e-04  25% 1164 aa  CP135_DANRE RecName: Full=Centrosomal protein of 135 kDa;       
   72::156     4e-04  24%  520 aa  CNPD_BACC1 RecName: Full=2',3'-cyclic-nucleotide
 1084::1179    4e-04  18% 1360 aa  CING_XENLA RecName: Full=Cingulin;
  323::445     4e-04  23%  703 aa  CEP63_HUMAN RecName: Full=Centrosomal protein of 63 kDa;       
  990::1043    4e-04  31% 1344 aa  CENPJ_MOUSE RecName: Full=Centromere protein J;         Short=CENP-J;
  804::897     4e-04  34% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein
 1957::2104    5e-04  21% 2873 aa  WDR87_HUMAN RecName: Full=WD repeat-containing protein 87;AltName:
 1046::1140    5e-04  21% 2363 aa  TPR_HUMAN RecName: Full=Nucleoprotein TPR;
  745::869     5e-04  26% 1097 aa  SMC6_MOUSE RecName: Full=Structural maintenance of chromosomes
   24::132     5e-04  31%  516 aa  P54_ENTFC RecName: Full=Protein P54;Flags: Precursor;
  294::392     5e-04  28%  556 aa  OPTN_CHICK RecName: Full=Optineurin;AltName: Full=Ag9-C5;AltName:
 1755::1865    5e-04  22% 1961 aa  MYH9_RAT RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1729::1801    5e-04  31% 1935 aa  MYH7_PIG RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1729::1801    5e-04  31% 1935 aa  MYH7_BOVIN RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1863::1941    5e-04  31% 1941 aa  MYH7B_MOUSE RecName: Full=Myosin-7B;AltName: Full=Myosin heavy chain
 1573::1661    5e-04  22% 1939 aa  MYH6_HUMAN RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1735::1807    5e-04  36% 1940 aa  MYH13_CANFA RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
 1202::1306    5e-04  24% 1972 aa  MYH11_HUMAN RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
 1574::1663    5e-04  33% 1976 aa  MYH10_RAT RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1574::1663    5e-04  33% 1976 aa  MYH10_MOUSE RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1574::1663    5e-04  33% 1976 aa  MYH10_HUMAN RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
 1574::1663    5e-04  33% 1976 aa  MYH10_BOVIN RecName: Full=Myosin-10;AltName: Full=Myosin heavy chain
  339::449     5e-04  24%  578 aa  MOEH_DROME RecName: Full=Moesin/ezrin/radixin homolog 1;       
  461::573     5e-04  21%  963 aa  KINH_MOUSE RecName: Full=Kinesin-1 heavy chain;AltName:
  425::556     5e-04  23% 1037 aa  HIP1_HUMAN RecName: Full=Huntingtin-interacting protein 1;       
  131::192     5e-04  24%  543 aa  FBP1L_XENLA RecName: Full=Formin-binding protein 1-like;AltName:
   67::142     5e-04  37%  517 aa  CNPD_CAMHC RecName: Full=2',3'-cyclic-nucleotide
 1900::2029    7e-04  26% 2285 aa  YOMI_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  196::270     7e-04  21%  496 aa  Y4393_ANASP RecName: Full=Uncharacterized protein alr4393;Flags:
 1049::1150    7e-04  22% 1211 aa  U634C_HUMAN RecName: Full=UPF0634 protein C;AltName: Full=Protein
  170::272     7e-04  17%  284 aa  TPM2_DROME RecName: Full=Tropomyosin-2;AltName: Full=Tropomyosin I;
  358::463     7e-04  26%  738 aa  NDC80_EMENI RecName: Full=Probable kinetochore protein ndc80;
  229::345     7e-04  26%  692 aa  MYSP_DERFA RecName: Full=Paramyosin;AltName: Full=Antigen
 1652::1769    7e-04  25% 2245 aa  MYOJ_DICDI RecName: Full=Myosin-J heavy chain;AltName:
  940::1055    7e-04  21% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
  929::1063    7e-04  31% 1568 aa  MYO2_SACBA RecName: Full=Myosin-2;AltName: Full=Class V
 1039::1167    7e-04  25% 1928 aa  MYO1_YEAST RecName: Full=Myosin-1;AltName: Full=Type II myosin;
 1147::1282    7e-04  34% 1960 aa  MYH9_MOUSE RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1561::1656    7e-04  24% 1960 aa  MYH9_HUMAN RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
 1731::1803    7e-04  31% 1939 aa  MYH6_MESAU RecName: Full=Myosin-6;AltName: Full=Myosin heavy chain
 1401::1534    7e-04  28% 1940 aa  MYH3_RAT RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1401::1534    7e-04  28% 1940 aa  MYH3_MOUSE RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain 3;
  558::672     7e-04  17%  722 aa  MFP1_TOBAC RecName: Full=MAR-binding filament-like protein 1-1;
  337::413     7e-04  23%  437 aa  LRRF2_RAT RecName: Full=Leucine-rich repeat flightless-interacting
  315::391     7e-04  23%  415 aa  LRRF2_MOUSE RecName: Full=Leucine-rich repeat
  179::320     7e-04  29%  817 aa  BRE1_USTMA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  157::232     7e-04  33%  241 aa  BAP29_HUMAN RecName: Full=B-cell receptor-associated protein
 7780::7857    7e-04  33% 8545 aa  ANC1_CAEEL RecName: Full=Nuclear anchorage protein 1;       
  829::939     0.001  27% 1989 aa  ZC3H1_HUMAN RecName: Full=Zinc finger C3H1 domain-containing
  936::1081    0.001  26% 1415 aa  UACA_CANFA RecName: Full=Uveal autoantigen with coiled-coil domains
  209::362     0.001  25%  712 aa  TSG10_RAT RecName: Full=Testis-specific gene 10 protein;AltName:
  324::441     0.001  26%  841 aa  TAXB1_XENTR RecName: Full=Tax1-binding protein 1 homolog;
    5::96      0.001  21%  428 aa  SYS_STAHJ RecName: Full=Seryl-tRNA synthetase;       
  844::929     0.001  24% 1235 aa  SMC1B_HUMAN RecName: Full=Structural maintenance of chromosomes
   62::140     0.001  31%  425 aa  SDPR_HUMAN RecName: Full=Serum deprivation-response
  208::300     0.001  30%  697 aa  PNP_THEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; 
  303::396     0.001  24%  517 aa  OPTN_DANRE RecName: Full=Optineurin;
  484::582     0.001  30%  876 aa  MYSP_SARSC RecName: Full=Paramyosin;
  951::1043    0.001  26% 1937 aa  MYH8_HUMAN RecName: Full=Myosin-8;AltName: Full=Myosin heavy chain
 1005::1105    0.001  28% 1935 aa  MYH7_HORSE RecName: Full=Myosin-7;AltName: Full=Myosin heavy chain
 1863::1933    0.001  27% 1941 aa  MYH7B_HUMAN RecName: Full=Myosin-7B;AltName: Full=Myosin heavy chain
  949::1041    0.001  26% 1940 aa  MYH3_HUMAN RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain
 1203::1306    0.001  23% 1972 aa  MYH11_MOUSE RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
   84::198     0.001  25%  689 aa  MAD1_SCHPO RecName: Full=Spindle assembly checkpoint component
  256::370     0.001  25%  586 aa  LMNB1_HUMAN RecName: Full=Lamin-B1;
 1098::1239    0.001  21% 1592 aa  LAMC1_XENTR RecName: Full=Laminin subunit gamma-1;Flags: Precursor;
  723::870     0.001  28% 1387 aa  KIF15_MOUSE RecName: Full=Kinesin-like protein KIF15;AltName:
  656::752     0.001  30% 1674 aa  KI21A_HUMAN RecName: Full=Kinesin-like protein KIF21A;AltName:
  289::405     0.001  26%  466 aa  K2C7_BOVIN RecName: Full=Keratin, type II cytoskeletal 7;AltName:
  361::492     0.001  24%  887 aa  IMH1_ASHGO RecName: Full=Golgin IMH1;
  555::652     0.001  30%  719 aa  HOOK3_XENLA RecName: Full=Protein Hook homolog 3;
  562::686     0.001  23% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
  319::448     0.001  25%  712 aa  GOGC3_ARATH RecName: Full=Golgin candidate 3;       
  267::403     0.001  24% 1135 aa  FIL1L_HUMAN RecName: Full=Filamin A-interacting protein
  131::192     0.001  24%  550 aa  FBP1L_XENTR RecName: Full=Formin-binding protein 1-like;AltName:
  455::550     0.001  25%  907 aa  EP15R_MOUSE RecName: Full=Epidermal growth factor receptor
 3187::3269    0.001  23% 4345 aa  DYHC_EMENI RecName: Full=Dynein heavy chain, cytoplasmic;AltName:
  621::724     0.001  20% 1118 aa  CYTSA_TAKRU RecName: Full=Cytospin-A;AltName: Full=SPECC1-like
  606::715     0.001  23% 1132 aa  CYTSA_DANRE RecName: Full=Cytospin-A-A;AltName: Full=SPECC1-like
 1811::1917    0.001  29% 2325 aa  CP110_HUMAN RecName: Full=Centriolin;AltName: Full=110 kDa
   72::156     0.001  24%  520 aa  CNPD_BACHK RecName: Full=2',3'-cyclic-nucleotide
   72::156     0.001  24%  520 aa  CNPD_BACCZ RecName: Full=2',3'-cyclic-nucleotide
   72::156     0.001  24%  520 aa  CNPD_BACCN RecName: Full=2',3'-cyclic-nucleotide
   72::156     0.001  24%  520 aa  CNPD_BACAN RecName: Full=2',3'-cyclic-nucleotide
   72::156     0.001  24%  520 aa  CNPD_BACAH RecName: Full=2',3'-cyclic-nucleotide
  228::316     0.001  27%  640 aa  CACO1_DANRE RecName: Full=Calcium-binding and coiled-coil
   87::176     0.001  30%  514 aa  BI2L1_MOUSE RecName: Full=Brain-specific angiogenesis inhibitor
    1::429

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTDSNNVTEVETSKVANNKQLTQNISMS
MRP4_STRPY      ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
SAS6_MOUSE      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
Y066_NPVAC      -------------------------------------------TDFESISEFISRDPAFNRNLNDERFQN
HMW2_MYCGE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
ATPF_ELUMP      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
FKBP5_DICDI     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
TPM_CHLNI       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
ATPF_CLOPH      ----------------------------------------------------------------------
YJNB_SCHPO      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
SEC2_YEAST      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MUTS2_STAS1     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
KINH_LOLPE      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_PAPAN      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
DYHC2_CHLRE     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CIP4_PONAB      ----------------------------------------------------------------------
CIP4_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
CAGE1_MACFA     ----------------------------------------------------------------------
SYS_MACCJ       ----------------------------------------------------------------------
NUMA1_HUMAN     ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
KINH_STRPU      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
Y864_MYCCT      ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
RAD50_DROME     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
HIP1_MOUSE      ----------------------------------------------------------------------
CIP4_RAT        ----------------------------------------------------------------------
CIP4_MOUSE      ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
BAP31_HUMAN     ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
LMNB2_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
CING_CALJA      ----------------------------------------------------------------------
BAP31_PONAB     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
MNS1_MACFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
FIL1L_DANRE     ----------------------------------------------------------------------
CING_HUMAN      ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RPOC_TROWT      ----------------------------------------------------------------------
RPOC_TROW8      ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
MNS1_BOVIN      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
COS_DROPS       ----------------------------------------------------------------------
CLPB_NEIMB      ----------------------------------------------------------------------
CLPB_NEIMA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
ZN318_MOUSE     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
TPM_PERVI       ----------------------------------------------------------------------
TPM_MYTGA       ----------------------------------------------------------------------
TPM_MYTED       ----------------------------------------------------------------------
SYS_LACGA       ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
MNS1_HUMAN      ----------------------------------------------------------------------
M6B_STRP6       ----------------------------------------------------------------------
LMN1_CAEEL      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
FBP1L_RAT       ----------------------------------------------------------------------
FBP1L_MOUSE     ----------------------------------------------------------------------
FBP1L_HUMAN     ----------------------------------------------------------------------
CNPD_BACCR      ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
CE120_BOVIN     ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
Y9I8_ENCCU      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MASK_XENLA      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
FNBP1_XENLA     ----------------------------------------------------------------------
FNBP1_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CNPD_BACC1      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPJ_MOUSE     ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH7B_MOUSE     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MOEH_DROME      ----------------------------------------------------------------------
KINH_MOUSE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
FBP1L_XENLA     ----------------------------------------------------------------------
CNPD_CAMHC      ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
Y4393_ANASP     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
TPM2_DROME      ----------------------------------------------------------------------
NDC80_EMENI     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
LRRF2_RAT       ----------------------------------------------------------------------
LRRF2_MOUSE     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
BAP29_HUMAN     ----------------------------------------------------------------------
ANC1_CAEEL      ----------------------------------------------------------------------
ZC3H1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYS_STAHJ       ----------------------------------------------------------------------
SMC1B_HUMAN     ----------------------------------------------------------------------
SDPR_HUMAN      ----------------------------------------------------------------------
PNP_THEAB       ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7B_HUMAN     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MAD1_SCHPO      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
LAMC1_XENTR     ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
K2C7_BOVIN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
FBP1L_XENTR     ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
DYHC_EMENI      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CNPD_BACHK      ----------------------------------------------------------------------
CNPD_BACCZ      ----------------------------------------------------------------------
CNPD_BACCN      ----------------------------------------------------------------------
CNPD_BACAN      ----------------------------------------------------------------------
CNPD_BACAH      ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
BI2L1_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KENQTHDSSSMVSAGETSDVNEVQENKSETISNDMSDLQVQLTSLxxxxxxxxxxxxxxxxxxxxxxxxx
MRP4_STRPY      ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
SAS6_MOUSE      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
Y066_NPVAC      LRQQYDEMSSKYSALETTKIKEMESIADQAVKSEMSKLNTQLDEL-------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
ATPF_ELUMP      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
FKBP5_DICDI     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
TPM_CHLNI       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
ATPF_CLOPH      ----------------------------------------------------------------------
YJNB_SCHPO      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
SEC2_YEAST      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MUTS2_STAS1     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
KINH_LOLPE      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_PAPAN      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
DYHC2_CHLRE     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CIP4_PONAB      ----------------------------------------------------------------------
CIP4_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
CAGE1_MACFA     ----------------------------------------------------------------------
SYS_MACCJ       ----------------------------------------------------------------------
NUMA1_HUMAN     ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
KINH_STRPU      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
Y864_MYCCT      ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
RAD50_DROME     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
HIP1_MOUSE      ----------------------------------------------------------------------
CIP4_RAT        ----------------------------------------------------------------------
CIP4_MOUSE      ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
BAP31_HUMAN     ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
LMNB2_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
CING_CALJA      ----------------------------------------------------------------------
BAP31_PONAB     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
MNS1_MACFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
FIL1L_DANRE     ----------------------------------------------------------------------
CING_HUMAN      ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RPOC_TROWT      ----------------------------------------------------------------------
RPOC_TROW8      ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
MNS1_BOVIN      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
COS_DROPS       ----------------------------------------------------------------------
CLPB_NEIMB      ----------------------------------------------------------------------
CLPB_NEIMA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
ZN318_MOUSE     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
TPM_PERVI       ----------------------------------------------------------------------
TPM_MYTGA       ----------------------------------------------------------------------
TPM_MYTED       ----------------------------------------------------------------------
SYS_LACGA       ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
MNS1_HUMAN      ----------------------------------------------------------------------
M6B_STRP6       ----------------------------------------------------------------------
LMN1_CAEEL      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
FBP1L_RAT       ----------------------------------------------------------------------
FBP1L_MOUSE     ----------------------------------------------------------------------
FBP1L_HUMAN     ----------------------------------------------------------------------
CNPD_BACCR      ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
CE120_BOVIN     ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
Y9I8_ENCCU      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MASK_XENLA      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
FNBP1_XENLA     ----------------------------------------------------------------------
FNBP1_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CNPD_BACC1      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPJ_MOUSE     ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH7B_MOUSE     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MOEH_DROME      ----------------------------------------------------------------------
KINH_MOUSE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
FBP1L_XENLA     ----------------------------------------------------------------------
CNPD_CAMHC      ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
Y4393_ANASP     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
TPM2_DROME      ----------------------------------------------------------------------
NDC80_EMENI     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
LRRF2_RAT       ----------------------------------------------------------------------
LRRF2_MOUSE     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
BAP29_HUMAN     ----------------------------------------------------------------------
ANC1_CAEEL      ----------------------------------------------------------------------
ZC3H1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYS_STAHJ       ----------------------------------------------------------------------
SMC1B_HUMAN     ----------------------------------------------------------------------
SDPR_HUMAN      ----------------------------------------------------------------------
PNP_THEAB       ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7B_HUMAN     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MAD1_SCHPO      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
LAMC1_XENTR     ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
K2C7_BOVIN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
FBP1L_XENTR     ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
DYHC_EMENI      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CNPD_BACHK      ----------------------------------------------------------------------
CNPD_BACCZ      ----------------------------------------------------------------------
CNPD_BACCN      ----------------------------------------------------------------------
CNPD_BACAN      ----------------------------------------------------------------------
CNPD_BACAH      ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
BI2L1_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRP4_STRPY      ----------------------------------------------------------------------
SMC2_XENLA      ----------------------------------------------------------------------
CL190_DROME     ----------------------------------------------------------------------
SAS6_MOUSE      ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
CGNL1_HUMAN     ----------------------------------------------------------------------
Y066_NPVAC      ----------------------------------------------------------------------
HMW2_MYCGE      ----------------------------------------------------------------------
SMC2_MOUSE      ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
ATPF_ELUMP      ----------------------------------------------------------------------
SMC6_XENLA      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
EEA1_MOUSE      ----------------------------------------------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RAD50_PYRHO     ----------------------------------------------------------------------
MY18A_MOUSE     ----------------------------------------------------------------------
MOEH_CULQU      ----------------------------------------------------------------------
CYTSA_CHICK     ----------------------------------------------------------------------
CP135_MOUSE     ----------------------------------------------------------------------
CCD18_HUMAN     ----------------------------------------------------------------------
KINH_DROME      ----------------------------------------------------------------------
GOGA3_MOUSE     ----------------------------------------------------------------------
FKBP5_DICDI     ----------------------------------------------------------------------
CYTSA_PANTR     ----------------------------------------------------------------------
CYTSA_HUMAN     ----------------------------------------------------------------------
TPM_CHLNI       ----------------------------------------------------------------------
MYSP_OPIFE      ----------------------------------------------------------------------
MYO2_CAEEL      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
ATPF_CLOPH      ----------------------------------------------------------------------
YJNB_SCHPO      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
SEC2_YEAST      ----------------------------------------------------------------------
MYH11_CHICK     ----------------------------------------------------------------------
MY18A_HUMAN     ----------------------------------------------------------------------
MUTS2_STAS1     ----------------------------------------------------------------------
KLPA_EMENI      ----------------------------------------------------------------------
KINH_LOLPE      ----------------------------------------------------------------------
CGNL1_MOUSE     ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
ODF2L_MOUSE     ----------------------------------------------------------------------
HMW2_MYCPN      ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------
CING_PAPAN      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
CCD18_MOUSE     ----------------------------------------------------------------------
SMC6_YEAST      ----------------------------------------------------------------------
SMC4_YEAST      ----------------------------------------------------------------------
SMC4_DICDI      ----------------------------------------------------------------------
RAD50_METMP     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
MYO3_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      ----------------------------------------------------------------------
KTN1_CHICK      ----------------------------------------------------------------------
DYHC2_CHLRE     ----------------------------------------------------------------------
DAPLE_HUMAN     ----------------------------------------------------------------------
CIP4_PONAB      ----------------------------------------------------------------------
CIP4_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     ----------------------------------------------------------------------
CAGE1_MACFA     ----------------------------------------------------------------------
SYS_MACCJ       ----------------------------------------------------------------------
NUMA1_HUMAN     ----------------------------------------------------------------------
NUF2_ASPFU      ----------------------------------------------------------------------
MYSN_ACACA      ----------------------------------------------------------------------
MLP1_YEAST      ----------------------------------------------------------------------
MIX1_CAEEL      ----------------------------------------------------------------------
KINH_STRPU      ----------------------------------------------------------------------
IMH1_YEAST      ----------------------------------------------------------------------
CENPE_HUMAN     ----------------------------------------------------------------------
CE57R_XENTR     ----------------------------------------------------------------------
Y864_MYCCT      ----------------------------------------------------------------------
TACC2_MOUSE     ----------------------------------------------------------------------
SAS6_CHICK      ----------------------------------------------------------------------
RAD50_DROME     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MNS1_RAT        ----------------------------------------------------------------------
K1C1_CARAU      ----------------------------------------------------------------------
HIP1_MOUSE      ----------------------------------------------------------------------
CIP4_RAT        ----------------------------------------------------------------------
CIP4_MOUSE      ----------------------------------------------------------------------
CEP63_MACFA     ----------------------------------------------------------------------
BAP31_HUMAN     ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MFP1_SOLLC      ----------------------------------------------------------------------
LMNB2_MOUSE     ----------------------------------------------------------------------
KINH_RAT        ----------------------------------------------------------------------
KINH_HUMAN      ----------------------------------------------------------------------
EEA1_HUMAN      ----------------------------------------------------------------------
CING_CALJA      ----------------------------------------------------------------------
BAP31_PONAB     ----------------------------------------------------------------------
ANT1_ONCVO      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
ROCK1_BOVIN     ----------------------------------------------------------------------
MNS1_MACFA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
FIL1L_DANRE     ----------------------------------------------------------------------
CING_HUMAN      ----------------------------------------------------------------------
CING_DANRE      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
TG278_CAEEL     ----------------------------------------------------------------------
TACC2_HUMAN     ----------------------------------------------------------------------
RPOC_TROWT      ----------------------------------------------------------------------
RPOC_TROW8      ----------------------------------------------------------------------
MYS_AEQIR       ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
MYSP_BOOMI      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
MNS1_BOVIN      ----------------------------------------------------------------------
CYTSA_MOUSE     ----------------------------------------------------------------------
COS_DROPS       ----------------------------------------------------------------------
CLPB_NEIMB      ----------------------------------------------------------------------
CLPB_NEIMA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
ANR26_HUMAN     ----------------------------------------------------------------------
AKAP9_HUMAN     ----------------------------------------------------------------------
ZN318_MOUSE     ----------------------------------------------------------------------
TSG10_MOUSE     ----------------------------------------------------------------------
TPM_PERVI       ----------------------------------------------------------------------
TPM_MYTGA       ----------------------------------------------------------------------
TPM_MYTED       ----------------------------------------------------------------------
SYS_LACGA       ----------------------------------------------------------------------
SMC2_CHICK      ----------------------------------------------------------------------
MNS1_HUMAN      ----------------------------------------------------------------------
M6B_STRP6       ----------------------------------------------------------------------
LMN1_CAEEL      ----------------------------------------------------------------------
GOGB1_HUMAN     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
FKB15_HUMAN     ----------------------------------------------------------------------
FBP1L_RAT       ----------------------------------------------------------------------
FBP1L_MOUSE     ----------------------------------------------------------------------
FBP1L_HUMAN     ----------------------------------------------------------------------
CNPD_BACCR      ----------------------------------------------------------------------
CN145_HUMAN     ----------------------------------------------------------------------
CK5P2_MACFA     ----------------------------------------------------------------------
CE120_BOVIN     ----------------------------------------------------------------------
APSB_EMENI      ----------------------------------------------------------------------
Y9I8_ENCCU      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------------
PU92_SCICO      ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
MYSC_CHICK      ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CANFA      ----------------------------------------------------------------------
MASK_XENLA      ----------------------------------------------------------------------
KIF4_DICDI      ----------------------------------------------------------------------
KIF15_HUMAN     ----------------------------------------------------------------------
K2C7_RAT        ----------------------------------------------------------------------
K2C7_MOUSE      ----------------------------------------------------------------------
FNBP1_XENLA     ----------------------------------------------------------------------
FNBP1_HUMAN     ----------------------------------------------------------------------
FBF1_HUMAN      ----------------------------------------------------------------------
EVI5_MOUSE      ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------------
CNPD_BACC1      ----------------------------------------------------------------------
CING_XENLA      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CENPJ_MOUSE     ----------------------------------------------------------------------
CC150_MOUSE     ----------------------------------------------------------------------
WDR87_HUMAN     ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
SMC6_MOUSE      ----------------------------------------------------------------------
P54_ENTFC       ----------------------------------------------------------------------
OPTN_CHICK      ----------------------------------------------------------------------
MYH9_RAT        ----------------------------------------------------------------------
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH7B_MOUSE     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
MYH10_RAT       ----------------------------------------------------------------------
MYH10_MOUSE     ----------------------------------------------------------------------
MYH10_HUMAN     ----------------------------------------------------------------------
MYH10_BOVIN     ----------------------------------------------------------------------
MOEH_DROME      ----------------------------------------------------------------------
KINH_MOUSE      ----------------------------------------------------------------------
HIP1_HUMAN      ----------------------------------------------------------------------
FBP1L_XENLA     ----------------------------------------------------------------------
CNPD_CAMHC      ----------------------------------------------------------------------
YOMI_BACSU      ----------------------------------------------------------------------
Y4393_ANASP     ----------------------------------------------------------------------
U634C_HUMAN     ----------------------------------------------------------------------
TPM2_DROME      ----------------------------------------------------------------------
NDC80_EMENI     ----------------------------------------------------------------------
MYSP_DERFA      ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MYO2_SACBA      ----------------------------------------------------------------------
MYO1_YEAST      ----------------------------------------------------------------------
MYH9_MOUSE      ----------------------------------------------------------------------
MYH9_HUMAN      ----------------------------------------------------------------------
MYH6_MESAU      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------------
MYH3_MOUSE      ----------------------------------------------------------------------
MFP1_TOBAC      ----------------------------------------------------------------------
LRRF2_RAT       ----------------------------------------------------------------------
LRRF2_MOUSE     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
BAP29_HUMAN     ----------------------------------------------------------------------
ANC1_CAEEL      ----------------------------------------------------------------------
ZC3H1_HUMAN     ----------------------------------------------------------------------
UACA_CANFA      ----------------------------------------------------------------------
TSG10_RAT       ----------------------------------------------------------------------
TAXB1_XENTR     ----------------------------------------------------------------------
SYS_STAHJ       ----------------------------------------------------------------------
SMC1B_HUMAN     ----------------------------------------------------------------------
SDPR_HUMAN      ----------------------------------------------------------------------
PNP_THEAB       ----------------------------------------------------------------------
OPTN_DANRE      ----------------------------------------------------------------------
MYSP_SARSC      ----------------------------------------------------------------------
MYH8_HUMAN      ----------------------------------------------------------------------
MYH7_HORSE      ----------------------------------------------------------------------
MYH7B_HUMAN     ----------------------------------------------------------------------
MYH3_HUMAN      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
MAD1_SCHPO      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
LAMC1_XENTR     ----------------------------------------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
KI21A_HUMAN     ----------------------------------------------------------------------
K2C7_BOVIN      ----------------------------------------------------------------------
IMH1_ASHGO      ----------------------------------------------------------------------
HOOK3_XENLA     ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GOGC3_ARATH     ----------------------------------------------------------------------
FIL1L_HUMAN     ----------------------------------------------------------------------
FBP1L_XENTR     ----------------------------------------------------------------------
EP15R_MOUSE     ----------------------------------------------------------------------
DYHC_EMENI      ----------------------------------------------------------------------
CYTSA_TAKRU     ----------------------------------------------------------------------
CYTSA_DANRE     ----------------------------------------------------------------------
CP110_HUMAN     ----------------------------------------------------------------------
CNPD_BACHK      ----------------------------------------------------------------------
CNPD_BACCZ      ----------------------------------------------------------------------
CNPD_BACCN      ----------------------------------------------------------------------
CNPD_BACAN      ----------------------------------------------------------------------
CNPD_BACAH      ----------------------------------------------------------------------
CACO1_DANRE     ----------------------------------------------------------------------
BI2L1_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQAKEDLD
MRP4_STRPY      --------------------------------------------------------------AAAKSQLE
SMC2_XENLA      ----------------------------------------------------------------------
CL190_DROME     --------------------------------------------------------------SQLKSQAE
SAS6_MOUSE      ---------------------------------------------------------------RTKEAFD
CLIP1_CHICK     ---------------------------------------------------------------QLKSNLT
CGNL1_HUMAN     -------------------------------------------------------------------EVA
Y066_NPVAC      --------------------------------------------------------------------IS
HMW2_MYCGE      -------------------------------------------------------------------DIN
SMC2_MOUSE      ---------------------------------------------------------------EKQQEVE
NPHP3_XENLA     ----------------------------------------------------------------------
SMC2_HUMAN      ---------------------------------------------------------------EKQQEVE
ICR3_ARATH      ------------------------------------------------------------------EERD
ATPF_ELUMP      --------------------------------------------------------------------LE
SMC6_XENLA      ---------------------------------------------------------------EAEENLN
NUF1_YEAST      --------------------------------------------------------------AQLTQLES
EEA1_MOUSE      ----------------------------------------------------------------AQEDLI
SMC1A_RAT       -----------------------------------------------------------------EEEKV
SMC1A_MOUSE     -----------------------------------------------------------------EEEKV
SMC1A_HUMAN     -----------------------------------------------------------------EEEKV
SMC1A_BOVIN     -----------------------------------------------------------------EEEKV
RAD50_PYRHO     ----------------------------------------------------------------------
MY18A_MOUSE     -------------------------------------------------------------------ELQ
MOEH_CULQU      -----------------------------------------------------------------EDRIR
CYTSA_CHICK     --------------------------------------------------------------AHTRNDAN
CP135_MOUSE     ---------------------------------------------------------------------D
CCD18_HUMAN     --------------------------------------------------------------------LQ
KINH_DROME      --------------------------------------------------------------ANARREYE
GOGA3_MOUSE     --------------------------------------------------------------ALAKREAD
FKBP5_DICDI     ----------------------------------------------------------------------
CYTSA_PANTR     --------------------------------------------------------------AHTRNDAN
CYTSA_HUMAN     --------------------------------------------------------------AHTRNDAN
TPM_CHLNI       -------------------------------------------------------------------DLE
MYSP_OPIFE      -------------------------------------------------------------------DYD
MYO2_CAEEL      --------------------------------------------------------------AKLMQSLE
USO1_YEAST      ---------------------------------------------------------------ETKQQLN
ATPF_CLOPH      ----------------------------------------------------------------ARELLQ
YJNB_SCHPO      ----------------------------------------------------------------------
VATE_METM5      ---------------------------------------------------------------------E
SEC2_YEAST      ---------------------------------------------------------------QLIESVD
MYH11_CHICK     ---------------------------------------------------------------QAVEELT
MY18A_HUMAN     -------------------------------------------------------------------ELQ
MUTS2_STAS1     --------------------------------------------------------------------IQ
KLPA_EMENI      --------------------------------------------------------------AQHESELK
KINH_LOLPE      ---------------------------------------------------------------QHQKQLQ
CGNL1_MOUSE     -----------------------------------------------------------------RRELA
SMC1A_XENLA     -----------------------------------------------------------------EEEKV
ODF2L_MOUSE     ---------------------------------------------------------------------D
HMW2_MYCPN      ----------------------------------------------------------------------
CING_XENTR      --------------------------------------------------------------ANHDKDLD
CING_PAPAN      --------------------------------------------------------------------VE
CING_MOUSE      ----------------------------------------------------------------------
CCD18_MOUSE     --------------------------------------------------------------------LQ
SMC6_YEAST      -----------------------------------------------------------------QQKVD
SMC4_YEAST      ------------------------------------------------------------------EEVD
SMC4_DICDI      ---------------------------------------------------------------EKKEQID
RAD50_METMP     ----------------------------------------------------------------SKAELE
MYO4_CAEEL      -----------------------------------------------------------------KTQLS
MYO3_SCHPO      ----------------------------------------------------------------------
MBO1_SCHPO      -----------------------------------------------------------------KEEVE
KTN1_CHICK      ----------------------------------------------------------------------
DYHC2_CHLRE     -----------------------------------------------------------------ESELH
DAPLE_HUMAN     ---------------------------------------------------------------QLSKKIE
CIP4_PONAB      ------------------------------------------------------------------KQLE
CIP4_HUMAN      ------------------------------------------------------------------KQLE
CC150_HUMAN     -----------------------------------------------------------------KEDLE
CAGE1_MACFA     -----------------------------------------------------------------KKTLQ
SYS_MACCJ       ----------------------------------------------------------------------
NUMA1_HUMAN     ---------------------------------------------------------------EAKEKVA
NUF2_ASPFU      --------------------------------------------------------------AQVKEKVD
MYSN_ACACA      -------------------------------------------------------------------EIE
MLP1_YEAST      -----------------------------------------------------------------QKKID
MIX1_CAEEL      --------------------------------------------------------------AQVKTNIN
KINH_STRPU      --------------------------------------------------------------ASLLKDLG
IMH1_YEAST      ----------------------------------------------------------------------
CENPE_HUMAN     ---------------------------------------------------------------EKQEELK
CE57R_XENTR     ---------------------------------------------------------------ESEKQSA
Y864_MYCCT      ---------------------------------------------------------------------N
TACC2_MOUSE     ---------------------------------------------------------------QALADLN
SAS6_CHICK      ----------------------------------------------------------------------
RAD50_DROME     ----------------------------------------------------------------------
MYSA_DROME      ---------------------------------------------------------------QAAEDLN
MNS1_RAT        -------------------------------------------------------------------ELA
K1C1_CARAU      --------------------------------------------------------------AAPQEDLS
HIP1_MOUSE      ---------------------------------------------------------------QAMDDCE
CIP4_RAT        ------------------------------------------------------------------KQLE
CIP4_MOUSE      ------------------------------------------------------------------KQLE
CEP63_MACFA     --------------------------------------------------------------SQGQGDLD
BAP31_HUMAN     ----------------------------------------------------------------------
SSP5_STRGN      ----------------------------------------------------------------AKNEAL
ROCK2_BOVIN     -------------------------------------------------------------------DLK
MFP1_SOLLC      ---------------------------------------------------------------------E
LMNB2_MOUSE     --------------------------------------------------------------ARLQIEIG
KINH_RAT        --------------------------------------------------------------ASTRRDQD
KINH_HUMAN      --------------------------------------------------------------ASTRRDQD
EEA1_HUMAN      ----------------------------------------------------------------AQEDLI
CING_CALJA      --------------------------------------------------------------------VE
BAP31_PONAB     ----------------------------------------------------------------------
ANT1_ONCVO      ---------------------------------------------------------------EARADIV
ROCK2_RAT       -------------------------------------------------------------------DLK
ROCK2_MOUSE     -------------------------------------------------------------------DLK
ROCK2_HUMAN     -------------------------------------------------------------------DLK
ROCK1_BOVIN     -----------------------------------------------------------------KHNLE
MNS1_MACFA      ----------------------------------------------------------------------
KI20B_MOUSE     -------------------------------------------------------------------ELE
FIL1L_DANRE     ------------------------------------------------------------------KDLT
CING_HUMAN      --------------------------------------------------------------------VE
CING_DANRE      ---------------------------------------------------------------QWKKQFS
TPM2_SCHMA      ----------------------------------------------------------------------
TG278_CAEEL     -------------------------------------------------------------------DKD
TACC2_HUMAN     ---------------------------------------------------------------QALADLN
RPOC_TROWT      ----------------------------------------------------------------APKDLD
RPOC_TROW8      ----------------------------------------------------------------APKDLD
MYS_AEQIR       ---------------------------------------------------------------QAEEDLN
MYSS_CYPCA      ----------------------------------------------------------------AEESIE
MYSP_BOOMI      ----------------------------------------------------------------AEQSLE
MYH13_HUMAN     ----------------------------------------------------------------------
MNS1_BOVIN      -------------------------------------------------------------------ELA
CYTSA_MOUSE     --------------------------------------------------------------AHTRNDAN
COS_DROPS       --------------------------------------------------------------AKLEAECD
CLPB_NEIMB      ----------------------------------------------------------------------
CLPB_NEIMA      ----------------------------------------------------------------------
CING_SORAR      ----------------------------------------------------------------------
CEP63_PONAB     --------------------------------------------------------------SQGQGDLD
ANR26_HUMAN     --------------------------------------------------------------------VQ
AKAP9_HUMAN     ----------------------------------------------------------------------
ZN318_MOUSE     --------------------------------------------------------------------LI
TSG10_MOUSE     -----------------------------------------------------------------EKDLS
TPM_PERVI       ----------------------------------------------------------------------
TPM_MYTGA       ----------------------------------------------------------------------
TPM_MYTED       ----------------------------------------------------------------------
SYS_LACGA       ----------------------------------------------------------------------
SMC2_CHICK      --------------------------------------------------------------ASAQQHFN
MNS1_HUMAN      ----------------------------------------------------------------------
M6B_STRP6       -----------------------------------------------------------------KKTLD
LMN1_CAEEL      ---------------------------------------------------------------------D
GOGB1_HUMAN     ------------------------------------------------------------------EHLR
GOGA5_HUMAN     ---------------------------------------------------------------ETQEELN
FKB15_HUMAN     --------------------------------------------------------------------LT
FBP1L_RAT       ------------------------------------------------------------------KQMD
FBP1L_MOUSE     ------------------------------------------------------------------KQMD
FBP1L_HUMAN     ------------------------------------------------------------------KQMD
CNPD_BACCR      ----------------------------------------------------------------------
CN145_HUMAN     -----------------------------------------------------------------RKELN
CK5P2_MACFA     -----------------------------------------------------------------EEDLR
CE120_BOVIN     ---------------------------------------------------------------RAKEDVE
APSB_EMENI      --------------------------------------------------------------AEAQEELD
Y9I8_ENCCU      ----------------------------------------------------------------------
SMC_BACSU       ----------------------------------------------------------------AVQNQE
PU92_SCICO      ----------------------------------------------------------------------
MYSN_DROME      --------------------------------------------------------------------IT
MYSC_CHICK      --------------------------------------------------------------SELKKDID
MYO3_CAEEL      ------------------------------------------------------------------EDMQ
MYH9_CANFA      -------------------------------------------------------------------NLQ
MASK_XENLA      ---------------------------------------------------------------QVQVDLN
KIF4_DICDI      -------------------------------------------------------------------DQY
KIF15_HUMAN     -----------------------------------------------------------------QEQMS
K2C7_RAT        ---------------------------------------------------------------------E
K2C7_MOUSE      ---------------------------------------------------------------------E
FNBP1_XENLA     ------------------------------------------------------------------KQLE
FNBP1_HUMAN     ------------------------------------------------------------------KQLE
FBF1_HUMAN      ---------------------------------------------------------------QRDEQLR
EVI5_MOUSE      ----------------------------------------------------------------------
EVI5_HUMAN      ----------------------------------------------------------------------
DESP_HUMAN      ----------------------------------------------------------------------
CP135_DANRE     ----------------------------------------------------------------AHQQID
CNPD_BACC1      ----------------------------------------------------------------------
CING_XENLA      --------------------------------------------------------------------LQ
CEP63_HUMAN     --------------------------------------------------------------SQGQGDLD
CENPJ_MOUSE     ----------------------------------------------------------------------
CC150_MOUSE     --------------------------------------------------------------------LD
WDR87_HUMAN     --------------------------------------------------------------AKEEKALN
TPR_HUMAN       ---------------------------------------------------------------EVQEALQ
SMC6_MOUSE      --------------------------------------------------------------ATLEDEAE
P54_ENTFC       --------------------------------------------------------------AAAADDFD
OPTN_CHICK      ----------------------------------------------------------------------
MYH9_RAT        ---------------------------------------------------------------KANLQID
MYH7_PIG        ----------------------------------------------------------------------
MYH7_BOVIN      ----------------------------------------------------------------------
MYH7B_MOUSE     ----------------------------------------------------------------------
MYH6_HUMAN      ----------------------------------------------------------------------
MYH13_CANFA     ----------------------------------------------------------------------
MYH11_HUMAN     --------------------------------------------------------------AQAVEELT
MYH10_RAT       --------------------------------------------------------------AQFERDLQ
MYH10_MOUSE     --------------------------------------------------------------AQFERDLQ
MYH10_HUMAN     --------------------------------------------------------------AQFERDLQ
MYH10_BOVIN     --------------------------------------------------------------AQFERDLQ
MOEH_DROME      ----------------------------------------------------------------------
KINH_MOUSE      --------------------------------------------------------------ASTRRDQD
HIP1_HUMAN      ---------------------------------------------------------------QAADDCE
FBP1L_XENLA     ------------------------------------------------------------------KQMD
CNPD_CAMHC      ----------------------------------------------------------------------
YOMI_BACSU      ---------------------------------------------------------------KAAKGFP
Y4393_ANASP     ----------------------------------------------------------------------
U634C_HUMAN     --------------------------------------------------------------ARCDARVE
TPM2_DROME      --------------------------------------------------------------AFVEDELE
NDC80_EMENI     ------------------------------------------------------------------EELE
MYSP_DERFA      ----------------------------------------------------------------------
MYOJ_DICDI      ----------------------------------------------------------------------
MYO3_CAEBR      ------------------------------------------------------------------EDMQ
MYO2_SACBA      -----------------------------------------------------------------KSDAK
MYO1_YEAST      --------------------------------------------------------------SSSEEDLD
MYH9_MOUSE      ---------------------------------------------------------------ELEDTLD
MYH9_HUMAN      -------------------------------------------------------------------NLQ
MYH6_MESAU      ----------------------------------------------------------------------
MYH3_RAT        ----------------------------------------------------------------SEEQVE
MYH3_MOUSE      ----------------------------------------------------------------SEEQVE
MFP1_TOBAC      -----------------------------------------------------------------EKELT
LRRF2_RAT       ----------------------------------------------------------------------
LRRF2_MOUSE     ----------------------------------------------------------------------
BRE1_USTMA      -----------------------------------------------------------------KQDLF
BAP29_HUMAN     ----------------------------------------------------------------------
ANC1_CAEEL      ----------------------------------------------------------------AKDDAN
ZC3H1_HUMAN     ----------------------------------------------------------------AESKLK
UACA_CANFA      ------------------------------------------------------------------QNMK
TSG10_RAT       -----------------------------------------------------------------EKDLS
TAXB1_XENTR     -----------------------------------------------------------------KEELG
SYS_STAHJ       ----------------------------------------------------------------------
SMC1B_HUMAN     ----------------------------------------------------------------------
SDPR_HUMAN      --------------------------------------------------------------------LD
PNP_THEAB       ----------------------------------------------------------------------
OPTN_DANRE      -----------------------------------------------------------------KVQME
MYSP_SARSC      ----------------------------------------------------------------------
MYH8_HUMAN      --------------------------------------------------------------SELKKDID
MYH7_HORSE      ---------------------------------------------------------------QALDDLQ
MYH7B_HUMAN     ----------------------------------------------------------------------
MYH3_HUMAN      --------------------------------------------------------------SELKKDID
MYH11_MOUSE     ---------------------------------------------------------------QAVEELT
MAD1_SCHPO      ----------------------------------------------------------------------
LMNB1_HUMAN     ----------------------------------------------------------------------
LAMC1_XENTR     ------------------------------------------------------------------ERLQ
KIF15_MOUSE     -----------------------------------------------------------------QEQLS
KI21A_HUMAN     ----------------------------------------------------------------------
K2C7_BOVIN      ---------------------------------------------------------------------E
IMH1_ASHGO      ----------------------------------------------------------------SNEELE
HOOK3_XENLA     ----------------------------------------------------------------------
HMW2_MYCGA      ------------------------------------------------------------------ERAD
GOGC3_ARATH     ----------------------------------------------------------------ATESLT
FIL1L_HUMAN     ----------------------------------------------------------------AKETHT
FBP1L_XENTR     ------------------------------------------------------------------KQMD
EP15R_MOUSE     --------------------------------------------------------------AKLRDMLS
DYHC_EMENI      ---------------------------------------------------------------EKREDLE
CYTSA_TAKRU     ---------------------------------------------------------------QAHSDLG
CYTSA_DANRE     -------------------------------------------------------------------DKE
CP110_HUMAN     --------------------------------------------------------------AAAEENSK
CNPD_BACHK      ----------------------------------------------------------------------
CNPD_BACCZ      ----------------------------------------------------------------------
CNPD_BACCN      ----------------------------------------------------------------------
CNPD_BACAN      ----------------------------------------------------------------------
CNPD_BACAH      ----------------------------------------------------------------------
CACO1_DANRE     ---------------------------------------------------------------------E
BI2L1_MOUSE     ------------------------------------------------------------------ETLD


                         .         *         .         .         .         .         +:350
query           KVQAKLAKDQKNEQKAKENIAKLEADIKTKQADYDKAKQEISTKQEALKKSQTELAEQKKVKAHAKKVLD
MRP4_STRPY      AKNAEIEALKQQDASKTEEIAKLQSEAATLENLLGSAKRELTELQAKLDTATAEKAKLESQVTTLENLLG
SMC2_XENLA      ----------KREQTTKQQIETVDEAMKAYQEQADSMASEVSKNKEAVKKAQDELAKQKEIIMGHDKEIK
CL190_DROME     ETQSELKSTQSNEAKSKQLEASLEEEAKKSGEQITKLKSEVGETQAALSSCHTDVESKTKQLEAANAALE
SAS6_MOUSE      TIQEQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEDLKTLMGKLKLKNTVTIQQEKLLAEKEEMLQ
CLIP1_CHICK     VMETKLKEREEREQQLTEAKVKLENDIADSSAQLMKMNDELRLKERQLEQIQLELANEKAVQLQ-KNVEQ
CGNL1_HUMAN     ELQRQLQLEVKNQQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLEESEGELR--------------
Y066_NPVAC      NLQEQLKRERALMQQISEQHRIANERVETLQSQYD----ELDLKYKEIFEDKSEFAQQKSENVRKIKQLE
HMW2_MYCGE      KLQAKHLEHQQNEQKQSDSLLKLETEYKALQHKINEFKNESATKSEELLNQERELFEKRR---EIDTLLT
SMC2_MOUSE      AITLELEELKREHASNEQQLDAVNEAIKAYEGQIEKMAAEVAKNKESVNKAQDELMKQKQIITAQDNIIK
NPHP3_XENLA     ----EVASMQKKEIKLDEENKRLRAELQALQKTYQKILREVEAKYQAMERAATFEHDRDKVKRQFKIFRE
SMC2_HUMAN      AITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIK
ICR3_ARATH      NFSMKLMKNQKEIKKLREAIENLKADLMDKETELQIVSDENETLKSDIHKSETDVQDAFLKLGIAMEEAD
ATPF_ELUMP      ARENKISQDKKDAQEARDEAQKIKAELDVRLSNISKEAQEKLAQVEALAKQQKD-AMIKDAQASSERMIA
SMC6_XENLA      KIE--LVKQEV--ELAKEKMGNLKSFLTTAEINYEEIKKKISSVAEVAEPVKEDLQEVENCKRHRKHYEE
NUF1_YEAST      KLNQRDSQLGSREEELKKTNDKLQKDIRIAREETVSKDERIIDLQKKVKQLENDLFVIKKTHSESKTITD
EEA1_MOUSE      SNRNQIGNQNKSIQELQAAKASLEQDSAKKEAALEDAQREKSVKEKELVAEKSKLAEMEEIKCRQEKEIT
SMC1A_RAT       KRQNEIAKKRLEFENQKTRLG-IQLDFEKNQLKEDQDK--VHMWEQTVKKDENEIEKLKKEEQRHMKIID
SMC1A_MOUSE     KRQNEIAKKRLEFENQKTRLG-IQLDFEKNQLKEDQDK--VHMWEQTVKKDENEIEKLKKEEQRHMKIID
SMC1A_HUMAN     KRQNEIAKKRLEFENQKTRLG-IQLDFEKNQLKEDQDK--VHMWEQTVKKDENEIEKLKKEEQRHMKIID
SMC1A_BOVIN     KRQNEIAKKRLEFENQKTRLG-IQLDFEKNQLKEDQDK--VHMWEQTVKKDENEIEKLKKEEQRHMKIID
RAD50_PYRHO     ----------------RERLSKINLDLKRDKEEYELLKSELKGEVESLKKEVNELNDYKNESTKLEIEID
MY18A_MOUSE     DISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGSIQMLEQA--KLRLEMEMERMRQTHSKEMES
MOEH_CULQU      NMQEEMERSQANLIEAQDMIRRLEEQLKQLQA----AKDDLEQRQNELQVMITRLEETKNMEAAERAKLE
CYTSA_CHICK     RLQDAIAKVEDEQEEAKKQIEDLNVTLEKLRAELDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIIS
CP135_MOUSE     ELQRMLERFEKYMEDIQSNVKLLTAERDKLNVLYKEAKEELST----LRKESTNSTSPNHLVSCVEKEKE
CCD18_HUMAN     ELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWELKQRAAQVTHLDMTIG
KINH_DROME      TLQSEMARIQQENESAKEEVKEVLQALEELAVNYDQKSQEIDNKQSVFNAASTELQQLKDMSSHQKKRIT
GOGA3_MOUSE     XXXXXXXXXXXXXRKEEED-RQMKQLVQALQVSLEKEKMEVNSLKEQMAAARIEAGHNRRHFKAATLELS
FKBP5_DICDI     -VEDDLADKQMLHTKSQSVINQLKRDYNTLQEELNSAKEENQKSQEALKQAEKDYA--LKIRAFKKSLLD
CYTSA_PANTR     RLQDAIAKVEDEQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIIS
CYTSA_HUMAN     RLQDAIAKVEDEQEEAKKQIEDLNMTLEKLRSDLDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIIS
TPM_CHLNI       RAETRLEAADAKVHELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLSKNLKDAETRATEAERQLT
MYSP_OPIFE      NLQAKYEEESEEASNLRNQVSKFNADLAAMKSKFERELMSKTEEYEELKRKLTDTAERERARA-------
MYO2_CAEEL      DSEQTMEREKRNRADMDKNKRKAEGELKIAQETLEELNKSKSDAENALRRKETEL--------HTLGMLE
USO1_YEAST      SLRANLESLEKEHEDLAAQLKKYEEQIANKERQYNEEISQLSTQQESIKKKNDELEEQSNLKKSEIDALN
ATPF_CLOPH      KRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKEASKEVDEILSRKKALKR-ENDIVDEAKVEA--SRIVD
YJNB_SCHPO      ------------DMNAKE-VDVYEGELKKTQTFCEAEKTEISQLEQDLLVAQEELRKREQYDELAKPIMS
VATE_METM5      KITSKIVED------ANKNAEKILAELNEKEAILTEAKEEASTKEQAIAKKGEKDAEMTKNRILAEARLS
SEC2_YEAST      K-QSHL-EEQLN--KSLKTIASQKAAIENYKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEAD
MYH11_CHICK     EQLEQFKRAKANLDKTKQTLEKDNADLANEIRSLSQAKQDVEHKK---KKLEVQLQDLQSKYSDGERVRT
MY18A_HUMAN     DISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQA--KLRLEMEMERMRQTHSKEMES
MUTS2_STAS1     KAKSMIGQD---EQEINEMIASLESNSKRQRIELDYLLREAQDTHDALAKQYEQYQNHEKQLMNEAK--E
KLPA_EMENI      ELRRQFERELEDEKCARQLHSKTALDAQLSQIELDKTIKELAATREDLQSLRTELDRERKNTNNLRQNLD
KINH_LOLPE      SLRDEISEKQATVDNLKDDNQRLSLALEKLQADYDKLKQEEVEKAAKLADLSLQIDRREQAKQDLKGLEE
CGNL1_MOUSE     EMQTQLKEKCLEVEKARLAASKMQDELRLKEEDYQRAEEEALTKRQLLEQSLKDLEYELEAKSHLKDDRS
SMC1A_XENLA     KRQNEIAKKRLEFENQKTRLG-IQLDYEKNQLKEDQGK--VQTWEQSVKKDDNEIEKLKKEEQRHMKIID
ODF2L_MOUSE     RLQRQIQKREAENEKLKEHVQSLETQIAKWNLQVKMNKQEAVAIKEASRQKAVALKKASKV---YRQRLR
HMW2_MYCPN      ------------ERKQQESLLKLETEHKQLQKRIGEFKIESEAKSEALLIQERELLEKRR---EIDDLLT
CING_XENTR      RVREQYQNDVQQLRKNMENVSQDQLSLETER---QKINQVVRNLQRELEESSDEINQWKEMFQKNKEELR
CING_PAPAN      ELQRKLDEEVKRRQKLEPSRVGLERQLEEKT-------EECSRLQELLERRKGEAQQSNKELQNMKRLLD
CING_MOUSE      ------------------------ARLGQEQQALNRALEEEGKQREALRRSKAELEEQKRL---LNRTVD
CCD18_MOUSE     ELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELIEMDQALKERNWELKQRAAQVTHLDMTIG
SMC6_YEAST      EVTEKIRNRQEKIERYTSDGTTIEAQIDAKVIYVNEKDSEHQNARELLRDVKSRFEKEKSNQAEAQSNID
SMC4_YEAST      KIERELSERENNFRVASDTVHEMEEELKKLESQISKAEMEADSSELTLAEQQVKEAEMAYVKAVSDKALE
SMC4_DICDI      SIKESLIVDQKSLDKVQEKVNKLESEVQEIQPQLKMQKNKVESLQSRIDSNQTNTTKANQIKSLAKKILN
RAD50_METMP     KTKCHVCQSKITEEKKQELLEKYNSEIQNEQLSTESLKKQLEIILNKKEKMKVKLNEIDSFKLKYGELKE
MYO4_CAEEL      DAEERLAKLEAQQKDASKQLSELNADNEDRTADVQRAKKKIEAEVEALKKQIQDL---------------
MYO3_SCHPO      -LEKKLSSIKKDEQTISSKYKELEKDYLNIMADYQHSSQHLSNLEKAINEKNLNIRE-------LNEKLM
MBO1_SCHPO      KLTDEITQLSERYNDKCHEFDELQKRLQTLEEENNKAKEDSTSKTEQLKMTEAEVDSLRKENEENKQVIA
KTN1_CHICK      ---------EEEESKWKIKVEESQKELKQMRSSVASLEHEVERLKEEIKEVET----LKKEREHLESELE
DYHC2_CHLRE     RLQSSLEESQRLIKQYEEELVQLDAAVASLKAEFSKKTSEAETLKISVDKAESVLSS-------ARQLLD
DAPLE_HUMAN     KLQTQLEREKQSNQDLEREKEQLQSDMETLKADKARQIKDLEQEKDHLNRAMWSLRERSQVSSEARKDVE
CIP4_PONAB      NSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQ------------
CIP4_HUMAN      NSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQ------------
CC150_HUMAN     AVEKKVGNFQRQLAEAKEDNCKVTIMLENVLASHSKM-------QGALEKVQIELGRRDSEIAGLKKERD
CAGE1_MACFA     NLQEILANTQKHLQESRNDKEMLQLQFKKIKANYVRLQERYMTEMQQKNKSVSQYLEMDKTKEEEVKRLQ
SYS_MACCJ       ----KLFRTEPEFVKKKLEMRAIDTSIVDEILELDIAARELTARTEELKKTSEEIAQKKRNKENADDAIK
NUMA1_HUMAN     GIESQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLSTLQEKMAATSKEVARLETLVRKAGEQQE
NUF2_ASPFU      ELKARLLELRRNQERIAETLERVKADKARRQAQLEKTERSVRTRQEVEKLRPYAMQSPVSLQSALTELSE
MYSN_ACACA      ELKKRVAKETSDKQKAQDQKANYQRENESLKADRDSAERQVRDLRAQLDDALSRLDSEKR----AKEKSV
MLP1_YEAST      ELEDALSELKKETSQKDHHIKQLEEDIEALKKDYESVITSVDSKQTDIEKLQYKVIEEDKIRLHTYNVMD
MIX1_CAEEL      NSEFGIVRDLKHSEEYEKNQAEIEATVKTLKDVEDKIKTLESMKQEKRKKELTALLQKEQTVAQNKNRGE
KINH_STRPU      EIGTALGGNAADMKPNVENIEKVDEEFTMARLFVSKMKTEVKTMSQRCKILEASNAEETKIRT-------
IMH1_YEAST      ------AKDEIKESSSKQN-----EEVKTVKLELDDLRHKNATMIEAYEAKNTEL--RSKIELLSKKVEH
CENPE_HUMAN     IVHMHLKEHQETIDKLRGIVSEKTNEISNMQKDLEHSNDALKAQQEELRIAHMHLKEQQETIDKLRGIVS
CE57R_XENTR     ELAAKEATNQQNDIGKQLNNAKQRCSLLEKQLDYMKEMMENADTQKTTIHEHQMLTEQKEIQSKLKK-LE
Y864_MYCCT      ELKSLLLEDEKNLISSKDKINKLKQDFDQKQMDLTNLKLESETKKDQKAKVESELNNLKKTRKHKDELKD
TACC2_MOUSE     SVEKSLADLFRRYEKMKEVLEGF------------RKNEEVLKKQEYLSRVKKEEQRYQALKVHAEEKLD
SAS6_CHICK      ELKAKLSGVEDECQRAKQEVVSLRRENTTLDAECHEKEKFINQLQTRVAVLEQEIKDKDQLVIRTKEVLD
RAD50_DROME     ----------------RNEIKKLDEIIMASKDKLRKLATEISLKTDELETIKTECSNQQTVERDLKD---
MYSA_DROME      KVKAKL------EQTLDELEDSLEREKKVR-GDVEKSKRKV---EGDLKLTQEAVADLERNKKELEQTIQ
MNS1_RAT        RLKHESLKDEKMRQQVRENSIELELEQKLKAAYMNKERAAQIVEKDVIKY------EQMKRDAEIERIMM
K1C1_CARAU      RVMAEIR--EQYEGVSAKNQRELDAWFQTKSETLTK---EVTANTETLQVSKTEVTELRRTLQGLEIELQ
HIP1_MOUSE      FLRTELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEELVQNHADLLRKNAEVTKQVSVARQAQVDLE
CIP4_RAT        NSKRKFERDCREAEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNEYAAQ------------
CIP4_MOUSE      NSKRKFERDCREAEKAAHTAERLDQDINATKADVEKAKQQAHLRNHMAEESKNEYAAQ------------
CEP63_MACFA     SVLSQLNFTHTSEELLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRME---AHNNEYRAEIKKLKE
BAP31_HUMAN     ---------------------KLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYD
SSP5_STRGN      KVENEAIKQRNETAKATYEAAQYEADL----AAIKKANEDNDADYQALAAYQTELARVQKANAEAKEAYD
ROCK2_BOVIN     QSQQKINELLKQKDVLNEDVRNLTLKIEQEQNDLKMQTQQVNT----LKMSEKQLKQENNHLLEMKMSLE
MFP1_SOLLC      QLGTALSEASKNETREKENLRRM---VDAELDNVNKLKQEIEVTQESLENSRSEVSDITVQLEQLRDLSS
LMNB2_MOUSE     KVQAELEEARKSAKKREGELTVAQGRVKDLESLFHRSEAELATALSDKQGLETEVAELRAQLAKAEDGHA
KINH_RAT        NMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQ
KINH_HUMAN      NMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQ
EEA1_HUMAN      SNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQKALQDISLKEKELVNEKSKLAEIEEIKCRQEKEIT
CING_CALJA      ELQRKLDEEVKKRQKLEPSRVGLERQLEEKT-------EECSQLQELLERRKGEAQQSNKELQNMKRLLD
BAP31_PONAB     ---------------------KLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYD
ANT1_ONCVO      ALNDRLAKMDANFK------IKLDETIKKSPADHETIKSRESKSEKIIVKHETKIYEINKYRA-------
ROCK2_RAT       QSQQKLNELLKQKDVLNEDVRNLTLKIEQEQNDLKMQTQQVNT----LKMSEKQIKQENNHLMEMKMNLE
ROCK2_MOUSE     QSQQKLNELLKQKDVLNEDVRNLTLKIEQEQNDLKMQTQQVNT----LKMSEKQIKQENNHLMEMKMNLE
ROCK2_HUMAN     QSQQKINELLKQKDVLNEDVRNLTLKIEQEQNDLKMQTQQVNT----LKMSEKQLKQENNHLMEMKMNLE
ROCK1_BOVIN     RVEGKEAQDMLNHSEKEKNNLEIDLNYKLKSLEHKVTKARLTDKHQSIEEAKSAMCEMEKKLKEERDARE
MNS1_MACFA      -------KDEKMRQQVRENSIELELEKKLKAAYMNKERAAQIAEKDAIKY------EQMKRDAEIAKTMM
KI20B_MOUSE     KKKNQYSQDLDMKQRTIQQLKEQLSNQKMEEAQYEKVCKDLSVKEKLVEDMRLTLVEQEQTQAEQDRVLE
FIL1L_DANRE     QEVERLRRKLKEMKVVEGDLLKTEDEFESLEKRYSNEQERAKALMEELETSRKELSKAEKEESNQEQILY
CING_HUMAN      ELQRKLDEEVKKRQKLEPSQVGLERQLEEKT-------EECSRLQELLERRKGEAQQSNKELQNMKRLLD
CING_DANRE      SANQELLKAQQGKRELEE---KLLAVVKTDETDSNSVMKELQQCRDSLKKAQSELEKQKAETL-------
TPM2_SCHMA      KLDKENAVDEADQLEAKLREKELEMQTKDEEAEVLKKIQQVDTDKET---AQTQLAE-------TNTKLE
TG278_CAEEL     NLLEELESKNKNIEHLKQEIAQLNEKISTKETEKDSELEKTIAQLEIDNSSKSDQIE--KLHLRVNDMLD
TACC2_HUMAN     SVEKSLADLFRRYEKMKEVLEGF------------RKNEEVLKRQEYLSRVKKEEQRYQALKVHAEEKLD
RPOC_TROWT      KVIAAYMVVSLDEEGRKEDLQDLENELRLDIKQLDACDASIASAVSELERTITELQDAKTSASRINKVRS
RPOC_TROW8      KVIAAYMVVSLDEEGRKEDLQDLENELRLDIKQLDACDASIASAVSELERTITELQDAKTSASRINKVRS
MYS_AEQIR       KLKAKL------EQALDELEDNLEREKKVR-GDVEKAKRKV---EQDLKSTQENVEDLERVKRELEENVR
MYSS_CYPCA      AVNSKCASLEKTKQRLQERANSLAANLDKKQRNFDKVKQKYEESQAELEGAQKEARSLSTELFKMKNSYE
MYSP_BOOMI      ESQARLTTINVNIAAAKN---KLESELSALQADYDELHKELRVVDERCQRTIVELKSTKDILVEEQERYI
MYH13_HUMAN     ---------------------KLEADIAQCQAEVENSIQESRNAEEKAKKAITDMAEELKKEQDTSAHLE
MNS1_BOVIN      KLKRESLKDEKLRQQVRENSAELELEKKLKAAYMNKERAAQIAEKDAIKYG------QMKRDAEIARTMM
CYTSA_MOUSE     RLQDTIAKVEDEQEEAKKQIEDLNMTLEKLRSELEEKDTERSDMKETIFELEDEVEQHRAVKLHDNLIIS
COS_DROPS       KAKKHLAKAQGREKGETERWSAIIAHIEHRLEDLSSMKHIAGESGQKLKKLQQSMAESRKQQEELEKKIR
CLPB_NEIMB      -----------------------------------RVKMEKETKPEAMDKIDRRLIQLRMEKAHVEKEKD
CLPB_NEIMA      -----------------------------------RVKMEKETKPEAMDKIDRRLIQLRMEKAHVEKEKD
CING_SORAR      -----------------------------EQQALSRALEEEGKQREALRRGKAELEEQKRL---LDRTVE
CEP63_PONAB     SVLFQLNFTHTSEDLLQAEVTRLEGSLESVSATCKQLSQELMEKYEELKRME---AHNNEYKAEIKKLKE
ANR26_HUMAN     KLQAESEKQSLLEERNKELISECN-HLKERQYQYENEKAE---REVVVRQLQQELADTLKKQSMSEASLE
AKAP9_HUMAN     -----LKREQESEKPSQE---LLEYNIQQKQSQMLEMQVELSSMKDRATELQEQLSSEKMVVAELKSELA
ZN318_MOUSE     KYNPKKISDEKNRASQKQKVIEEREKLKTEQEARQKKMFYLTTELERLHKQQGEMLRKKRLLMEVSRLQD
TSG10_MOUSE     DTQRHLAKDEKIDNFTRQNIAQLAKEKECLQACLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASR
TPM_PERVI       ----------------EEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVS
TPM_MYTGA       ----------------EEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVS
TPM_MYTED       ----------------EEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVS
SYS_LACGA       ----KVIRENLDWSKKKLATRGIKPEELDKLVAIDKERREALTKSEQLKQKRNEVSDQKEDASDAIKTMR
SMC2_CHICK      AVSAGLSSNDSGQMTCKNEISKAATEAKQAQMKLKYAQQELKTKQAEVKKMDGSYKEDQEAFEAIRKTKE
MNS1_HUMAN      -------KDEKMRQQVRENSIELELEKKLKAAYMNKERAAQIAEKDAIKY------EQMKRDAEIAKTMM
M6B_STRP6       EVKDKIAKEQESKETIGTLKKTLDETVKDKIAKEQESKETIGTLKETVKDKIAKEQESKETIGTLKKILD
LMN1_CAEEL      RFEAEKARLRRALDSAQDELAKY-------RIEYDAAKVEVKKLKPQVEKLERELAGAEEQALHAQSIAD
GOGB1_HUMAN     ELQPKLDELQKLISKKEEDVSYLSGQLSEKEAALTKIQTEIIEQEDLIKALHTQLEMQAKEHDERIKQLQ
GOGA5_HUMAN     KARARVEKWNADHSKSDEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEMQDQSEGNSLQNQALQ
FKB15_HUMAN     KVQAKLSELQETSEQAQSKFKSEKQNRKQLELKVTSLEEELTDLRVEKESLEKNLSERKKKSAQER---S
FBP1L_RAT       NSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQ------------
FBP1L_MOUSE     NSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQ------------
FBP1L_HUMAN     NSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNEYAAQ------------
CNPD_BACCR      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CN145_HUMAN     DVLTKRALQEEELHSKEEKLR----DIKSHQADLEL---EVKNSLDTIHRLESELKKQSKIQSQMKVEKA
CK5P2_MACFA     EKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQ-----KAQTQEFQG
CE120_BOVIN     LERLKMKQLEEDKHRLQQQLNDAENKYKTLEKEFHQFKDQQSSKPEIRLQSEINLLTLEKVKLHYKQQWG
APSB_EMENI      ALGDEL--DQKIEECQRDNLRALQAEMRSASEGIIRLEEDAQNNLQRYKAVQQELEQCNEEMESLEKSLY
Y9I8_ENCCU      ----KMAQSKQKESMLQSSIDKLLQDIDQKIQDTQKMKDRLHTKKNHLRNLQINIKEVEVQRGRTLALIR
SMC_BACSU       QLEEAIVQFQQKETVLKEELSKQEAVFETLQAEVKQLRAQVKEKQQALSLHNENVEEK-------IEQLK
PU92_SCICO      ---------QKNTENLKETIEQL--------------KKELAEAQKALEKCKKELADCKKENAKLLNKIE
MYSN_DROME      ELEERLHKDQQQRQKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQR
MYSC_CHICK      DLEITLAKVEKEKHATENKVKNLTEEMATLDENISKLTKEKKSLQEAHQQVLDDLAEEDKV--------N
MYO3_CAEEL      ERNEDLARQKK---KTDQELSDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKEKKHQE
MYH9_CANFA      AMKAQFERDQGRDEQSEEKKKQLVRQVREMEAELEDEKKQRSMAVAARKKLEMDLKDLEAHIDSANKNRD
MASK_XENLA      SMESELFKRLEKQKEALEGYRKNEEALKKCVEDY-------------LVRIKKEEQRYQALKAHAEEKLN
KIF4_DICDI      KISTNKLESQISDRNEEINNLKLKAEINALKEENISLKDQL-TKLKKAPKSQTD-REKDMIKKELEKLRE
KIF15_HUMAN     ALQAKLDEEEHKNLKLQQHVDKLEHHFSSERIDWTKQQEELLSQLNVLEKQLQETQTKNKSEVHLRVVLH
K2C7_RAT        TLQAQAGKHGDDLRNTRNEIAEMNRSIQRLQAEIDTLKNQRAKLESSIAEAE-EQGELAIKDAHAKQGEL
K2C7_MOUSE      TLQAQAGKHGDDLRNTRNEIAEMNRSIQRLQAEIDTLKNQRAKLESSIAEAE-EQGELAIKDAHAKQGEL
FNBP1_XENLA     ASKRRFERDCKEAERAQQHFEKMDADINVTKADVEKARQQAQIRHQMSDDS----------KGDYSSVLQ
FNBP1_HUMAN     SSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDS----------KADYSSILQ
FBF1_HUMAN      ALQERLGQQQRDMEEEREVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRALEEQRKVTAQ-QMAME
EVI5_MOUSE      ----------KYNSKKMKKLEKEYTTIKTKEMEEQGEIKRLRTENRLLKQRIETLEKHKCSSTYNEDFVL
EVI5_HUMAN      ----------KYNSKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIETLEKHKCSSNYNEDFVL
DESP_HUMAN      --ELRLARDANSENCNKNKF--LDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIK
CP135_DANRE     KLEEKIADLSRHGSSQKDEVVILQNTIASLDREKDTLQDAVDQKTESVVLLQQEV--------HRKE---
CNPD_BACC1      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CING_XENLA      ELQVEKETVELDKQMISQRLQSLEQDIESKKRVQDDRSRQVKVLEDKLKRMEAELDEEKNTVELLTDRVN
CEP63_HUMAN     SVLSQLNFTHTSEDLLQAEVTCLEGSLESVSATCKQLSQELMEKYEELKRME---AHNNEYKAEIKKLKE
CENPJ_MOUSE     -------KEREEIQALKQQIADLQEDLKRKETKWSSTQSRLRSQIEMLVKENTDLREEIKV---------
CC150_MOUSE     HLQEKLESKERERQSLKEQVAKVEAELHAERIE--ALRKQFQTERETAKKSQREVSE-------LKKALD
WDR87_HUMAN     LEMKRLAEEKMRLVEGKETLSKGETPETSRQRKMTQVEQELFERKLSLEKGKLEFTRGQRIFVQGQRKLA
TPR_HUMAN       RASTALS----NEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQ
SMC6_MOUSE      ENKIKMQMVEKNMEQQKENMENLKSLKIEAENKYDTIKLKINQLSEELNLADSEVDSQKRGKQHYE---D
P54_ENTFC       QQDKKIADLQNQQASAQSQIEALEGQVSA----INTKAQDLLTKQDTLRKESAQL----------KQEIK
OPTN_CHICK      -----------------------EAHEKLKEAELKKLQEKCQTLEKVNSAAATELEEKQQLIYTIKKLVE
MYH9_RAT        QINTDLNLERSHAQKARQQLERQNKELKAKLQEMESAKASIAALEAKIAQLEEQLDNETKERQAASKQVR
MYH7_PIG        ---------------------KMEADLSQLQTEVEEAVQECRNAEEKAKKAITDMAEELKKEQDTSAHLE
MYH7_BOVIN      ---------------------KMEADLSQLQTEVEEAVQECRNAEEKAKKAITDMAEELKKEQDTSAHLE
MYH7B_MOUSE     -------EDRKNLARMQDLVDKLQSKVKSYKRQFEEAEQQASTNLAKYRKAQHELAEERKLRARSRDALG
MYH6_HUMAN      EIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEV---LRVKKKMEGDLNEMEIQLSHANRMAA
MYH13_CANFA     ---------------------KLEVDIAQCQAEVENSLQESRNAEEKAKKAITDMAEELKKEQDTSAHLE
MYH11_HUMAN     EQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLQELQSKCSDGERARAELNDKVH
MYH10_RAT       ------TRDEQNEEKKRKQVRELEAELE------DERKQR-ALAVASKKKMEIDLKDLEAQIEAANKARD
MYH10_MOUSE     ------TRDEQNEEKKRKQVRELEAELE------DERKQR-ALAVASKKKMEIDLKDLEAQIEAANKARD
MYH10_HUMAN     ------TRDEQNEEKKRKQVRELEAELE------DERKQR-ALAVASKKKMEIDLKDLEAQIEAANKARD
MYH10_BOVIN     ------TRDEQNEEKKRKQVRELEAELE------DERKQR-ALAVASKKKMEIDLKDLEAQIEAANKARD
MOEH_DROME      -------------QEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDEQKELQAMLQRLEE
KINH_MOUSE      NMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLTDEFNQKSATLASIDAELQ
HIP1_HUMAN      FLRAELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEELVQNHADLLRKNAEVTKQVSMARQAQVDLE
FBP1L_XENLA     NSKRKFERECREAEKAQQSYERLDNDTNATKSDVEKAKQQLHLRTHMADESKNEYAAQ------------
CNPD_CAMHC      -------------KKAYEDKAKLQKDYNAKFDEISKKEQTVLTEQEILKDSREELEKEKK---SAQTIYD
YOMI_BACSU      DIQEQITEEIENKDKQKDFNLELYNTKKSIKDIYKSLADEVVSKEMYEKMRDIELEAHQKATQDLIDEID
Y4393_ANASP     --------------EAKKAIEQRDRELANRQQAIEQRDRELANRQQALQQRDQKISQ-------LDKIIQ
U634C_HUMAN     NLQAECRKHRLLLEEDNKMLVNELNHSKEKKCQYEKEKAEREVAVRQLQQKQDDVLNKRSA---TKALLD
TPM2_DROME      VAEDRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVK
NDC80_EMENI     KNAPDMAKLDKQFRILEDDKRKFEDYIQNVQGKIEKYESRIAFLEDEIRKTESELAEEERAGLQASQDID
MYSP_DERFA      ---------RKMAQKISEYEEQLEA-LLNKCSSLEKQKSRLQSEVEVLQQLEKRVAQLEKINLDLKNKLE
MYOJ_DICDI      --------------KEKENISKLQQQLETSNQQLHQLKEELNSMKQSNQLESTEQSKXKSVTNEISKQLD
MYO3_CAEBR      ERHEDLTRQKK---KTEQELSDTKKHVQDLELTLRKAEQEKQSRDHQIRSLQDEMANQDESVAKEKKHQE
MYO2_SACBA      SVHHLKEVSYKLENKVIELTQNLASKVKENKEMTERIK-ELQVQVEESAKLQETLENMKK--EHLVNIDN
MYO1_YEAST      IKLVTLEKNCNIAMSRLQSLVTENSDLRSKNENFKKEKAALNNQ---LKNKESELLKMKKIDNHKKKQRD
MYH9_MOUSE      STAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVE-------ELADQLEQTKRVKATLE
MYH9_HUMAN      AMKAQFERDQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRD
MYH6_MESAU      ---------------------KMEADLTQLQTEVEEAVQECRNAEEKAKKAITDMAEELKKEQDTSAHLE
MYH3_RAT        AVNAKCASLEKTKQRLQGEVEDLMVDVERKQRNFDKVLAEWKTKCEALKESRSLSTELFKLKNAYEEALD
MYH3_MOUSE      AVNAKCASLEKTKQRLQGEVEDLMVDVERKQRNFDKVLAEWKTKCEALKESRSLSTELFKLKNAYEEALD
MFP1_TOBAC      FLEAQITREKESRERATESLDEMNRNAFALAKELELANSHISSLEDEREVLQKSVSEQKQISQESRENLE
LRRF2_RAT       ---------------------EMQRDANRQISEYSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIED
LRRF2_MOUSE     ---------------------EMQRDANRQISEYSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIED
BRE1_USTMA      LTQSKLQRAQDALAQTSQKLSKVEHEYVRYQSNLLRATEGVSASEPAPATEQTADTAVKKETAHTSETLQ
BAP29_HUMAN     ----KLKRILKSHGKDEECV--LEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYD
ANC1_CAEEL      KLKAQLTKLAESSDKIDPQVAKDIKDSKTKAKELLQALEKAIPQEDAIRREQAEINDR----------LN
ZC3H1_HUMAN     KHRILLMKDEQQEAKKKESVRNAEAKITKLTEQLQATEKILNVNRMFLKKLQEQIHRVQQRVTIKKALTL
UACA_CANFA      SVQDNSAEILANYRKGQEEIVTLHAEIEAQKKELDTIQECIKLKERKFKATEKELKEQQMQKYHVKQEND
TSG10_RAT       DTQRHLAKDEKIDNFTRQNIAQLAKEKECLQTCLDKKSENIASLGESLAMKEKTISGMKNIIAEMEQASR
TAXB1_XENTR     KLQICLADKEKMNKELKEDIAFLKQQLRKLEDQHQASRQEVSLMSRELSE-----AVNKRDKTMADLHSA
SYS_STAHJ       ----KLFREQADTVKSKIELRGDDPKVVDEVLELDNERRQLIGKTEEMKARRNKVSEEIAEKKRNKENAD
SMC1B_HUMAN     ----KGSEDIDHLKKAEENCLQTVNELMAKQ---QQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVG
SDPR_HUMAN      KLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKSKYQASTSNTVSKL----LEKSRKVSAHTRAVKE
PNP_THEAB       ---------------------------------HDAIKQIIEFEEEILSQQKMEIEEPKPNETLIGKFEE
OPTN_DANRE      SLQAAIKLEQKKTQDEKNNLNQLKDAYTKLFEDYSELQEEKKKRESCVSKDQTRFATAEKALADKQQKID
MYSP_SARSC      RLTAELAQVRHDYEK---RLAQKEEEIEALRKQYQIEIEQLNMRAEAEAKLKTEIARKKKYQAQITELLD
MYH8_HUMAN      DLELTLAKVEK-EKHATENKVK---NLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKVNILT
MYH7_HORSE      AEEDKVNTLTKAKVKLEQHVDDLEGSLKKVRMDLERAKRKL---EGDLKLTQESIMDLENDKQQLDERLK
MYH7B_HUMAN     -------EDRKNLARMQDLVDKLQSKVKSYKRQFEEAEQQANTNLAKYRKAQHELDD-------AEERAD
MYH3_HUMAN      DLELTLAKVEKEKHATENKVKNLTEELSGLDETIAKLTREKKALQEAHQQALDDLAEEDKV--------N
MYH11_MOUSE     EQLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQQSKCSDGERARAELSDKVH
MAD1_SCHPO      ELQRKLAEEHEQKNSLQLRLTLVEKQLEEQSTSYQKEIEEVRNEKEALDAKWKEIAELKTQIEKNDQALS
LMNB1_HUMAN     --QVRLYKEELEQTHAKLENARLSSEMNTSTVN--SAREELMESRMRIESLSSQLSNQKESRACLERIQD
LAMC1_XENTR     NIRDMIRDTDKQAQEARDRVENTEFIIDSARVQLEKAKMAIANAEEARKLAERHMQEARDIEKAAKEAND
KIF15_MOUSE     VLQVKLDEEERKNLKLQQNVDKLEHHFSSERSDWTKQQQELSDLEKQLQDAQTK-NEFLKCEVHLRIVLN
KI21A_HUMAN     -IKQKLIDELENSQKRLQTLKKLQHKIRDTQLERDQVLQNLGSVESYSEE------KAKKVRSEYEKKLQ
K2C7_BOVIN      TLQAQAGKHGDDLQNTRNEIADMNRAVQRLQAEIDSVKNQRSKLEAAIAD-----AEQRGELA-VKDARA
IMH1_ASHGO      TVRGMLKTVGNELVHARDELKQLNCEVERLKSELQELRTENSTQIATLKEQLQLLNDQKKVEQHKRKMED
HOOK3_XENLA     ---------------ANNELQKKRAIIEDLEPRYNNSSMKIEELQDALRKKEEDM---KQMEERYKKYLE
HMW2_MYCGA      LQRILLIERKKNDERQQE-LLQYERDIKRQQTDFENT---VNWEQKKLSQREKELKEQLQLKSEVQEKID
GOGC3_ARATH     RHPSTLDKEKPESFPGKESLQRLEMDLKETQRERDKARQELKRLKQHLLXXXXXXXXXXXXXXRLIEELR
FIL1L_HUMAN     KLALAEARVQEEEQKATRLEKELQTQIMAKLTNEDSQNRQLQQKLAALSRQIDELEETNRSLRKAEEELQ
FBP1L_XENTR     NSKRKFERECREAEKAQQTYERLDNDSNATKSDVEKAKQQLHLRTHMADESKNEYAAQ------------
EP15R_MOUSE     DVRQKCQDETQTISSLKTQIQSQESDLKSQEDDLNRAKSELN----RLQQEETQL--EQSIQA-GRAQLE
DYHC_EMENI      EQQRHLNVGLEKLRDTVEKVSDLRGSLAQKKMQLEKKDAEANEKLQRMVADQREAEQRKAVSLEVQAALE
CYTSA_TAKRU     HLQETFSKLDREREQAQRQLSEQERALEKQRMDLQEKETEIADMKETIFELEDEVEQHRALKLHDNLIIT
CYTSA_DANRE     EAEAKASKLQDDLGHARSEVACLQDTLNKLDAEYAEQKRAIEKQREDLQEKETEIGDMKETIFELEDEVE
CP110_HUMAN     MEQSNLEKLELNVRKLQQELDQLNRDKLSLHNDISAMQQQLQEKREAVNSLQEELA---NVQDH----LN
CNPD_BACHK      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CNPD_BACCZ      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CNPD_BACCN      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CNPD_BACAN      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CNPD_BACAH      -----------------------------------EAELEIRDRRSELQKQENRLMQKEENLDRKDETLD
CACO1_DANRE     EKRALLAQKEANEQRIRE----LEEDIKILTQRGLERETDLERMRERAKKSAAQKREDEDEHKNLKLKME
BI2L1_MOUSE     ENFKKFHKDIIHELEKKT-----ELDVKYMNATLKRYQAEHRNKLDSLEKSQAELKKIRRKSQGGRNALK


                         .         .         .         .         *         .         .:420
query           KANKELIKVQATVQDKQAKLKELQDQFGNYVGDDDELADTKKSLTEAQTKLTxxxxxxxxxxxxxxxxxx
MRP4_STRPY      SAKRELTDLQAKLDAANAEKEKLQSQAATL---EKQLEATKKELADLQAKL-------------------
SMC2_XENLA      TKSSEAGKLRENNNDLQLKIKELE----------------------------------------------
CL190_DROME     KVNKEYAESRAEASDLQDKVKEITDTL------HAELQAERSSSSALHTKLS------------------
SAS6_MOUSE      KERKESQDAGQFLRAKEQEVCRLQEQLETTV---QKLEESKQLLKNNEKLIT------------------
CLIP1_CHICK     TAQKAEQSQQETLKTHQEELKKMQDQ----------LTDMKKQMETSQNQ--------------------
CGNL1_HUMAN     KNLEELFQVKMEREQHQTEIRDLQDQLSEM---HDELDSAKRS---------------------------
Y066_NPVAC      RSNKELNDTVQKLRDENARLSEIQLQ----KGDLDEYKNMNRQLNEDIYKL-------------------
HMW2_MYCGE      QASLEYEHQRESSQLLKDKQNEVKQHFQNLEYAKKEL-DKERNLLDQQKKV-------------------
SMC2_MOUSE      DKCAEVAKHNLQNNESQLKIKELDHSISKHKREDDAAAKVSKMLSD------------------------
NPHP3_XENLA     TKEKEIQDLLRAKRDLEAKLQRLQAQ-GIQVFDPGE-SDSDDNGTEVTVPST------------------
SMC2_HUMAN      AKYAEVAKHKEQNNDSQLKIKELDHNISKHKREEDGAAKVSKMLKD------------------------
ICR3_ARATH      KSSKKAVRVTEQLEATQASNSEMETE--------------------------------------------
ATPF_ELUMP      TA-KEEIEAQKNQALKEVK-KEIAD---------------------------------------------
SMC6_XENLA      KLKEHLDRIQKRKEEVAAKEQELE----------------------------------------------
NUF1_YEAST      ESKDKLIKILKVAQEKYSKMKELKEREFNYKISESKLEDEKTTLNEKISNL-------------------
EEA1_MOUSE      KLNEEL------KSHKQESIKEI-----------------------------------------------
SMC1A_RAT       ETMAQLLAKKSEVNDKNHEMEEIRKKLG---GANKEMTHLQKEVTAIETKL-------------------
SMC1A_MOUSE     ETMAQLLAKKSEVNDKNHEMEEIRKKLG---GANKEMTHLQKEVTAIETKL-------------------
SMC1A_HUMAN     ETMAQLLAKKSEVNDKNHEMEEIRKKLG---GANKEMTHLQKEVTAIETKL-------------------
SMC1A_BOVIN     ETMAQLLAKKSEVNDKNHEMEEIRKKLG---GANKEMTHLQKEVTAIETKL-------------------
RAD50_PYRHO     KAKKELSEIEKTIDELSGRIRELEKFHNKYINAEKELRDILESLKDEREEL-------------------
MY18A_MOUSE     RDE----EVEEARQSCQKKLKQMEVQL------EEEYEDKQKALRE------------------------
MOEH_CULQU      DEQEEVHKIQEEVSVKDSETKRLQEE--------------------------------------------
CYTSA_CHICK     DLENTVKKLQDQKHDMEREIKNL-----------------------------------------------
CP135_MOUSE     RALSELRRITAEKEALREKLKNIQER--NAVGKSD-LEKTIEHLT-------------------------
CCD18_HUMAN     EMEQKIIKLEGTLEKSELELKECNKQIESL---NDKLQNAKEQLREKE----------------------
KINH_DROME      EMLTNLLR--------------------------------------------------------------
GOGA3_MOUSE     EVKKELQAKEHLVQTLQAEVDELQIQDGKH---SQEIAQFQTELAEART---------------------
FKBP5_DICDI     EKNARKSDIE--------KINSLED----------ELKDAQDSLTQAE----------------------
CYTSA_PANTR     DLENTVKKLQDQKHDMEREIKTL-----------------------------------------------
CYTSA_HUMAN     DLENTVKKLQDQKHDMEREIKTL-----------------------------------------------
TPM_CHLNI       KLQKEVDRLEDELLAEKERYKAISDE--------------------------------------------
MYSP_OPIFE      -SNLEKIKAKLTIE-----IKDLQNEVDSLSAENAELARRAKA---------------------------
MYO2_CAEEL      DEQAAVAKLQKGIQQDEARVKDLHDQLAD-----------------------------------------
USO1_YEAST      LQIKELKKKNETVESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSK--------------------
ATPF_CLOPH      RANKEIELNKSKMKDKQEMIAVASVMAGKIIAGNIDETKQKQLIDEALNEM-------------------
YJNB_SCHPO      KGLRSRTEQQESIGKLQDAIRELEEENANYV---------------------------------------
VATE_METM5      AKKKLLEEREKTIQLTLEKLEE------------------------------------------------
SEC2_YEAST      KLNKEVEDLTASLFDE------------------------------------------------------
MYH11_CHICK     ELNEKVHKLQIEVENVTSLLNEAESK--------------------------------------------
MY18A_HUMAN     RDE----EVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKREL--------------------------
MUTS2_STAS1     KANQRVKSATKEADDILKELRELRDQKGADV-KEHELIDKKKQLDD------------------------
KLPA_EMENI      TAASNSVTLESTISALKARIEFLE----------------------------------------------
KINH_LOLPE      TVAKELQTLKLFVQDLQNKVKK------------------------------------------------
CGNL1_MOUSE     RLIKQM-------EDKVSQLEELEEERTN-----------------------------------------
SMC1A_XENLA     ETMAQLLAKKSEVNDKNHLMEDIRKKLGS---ANKEVTHLQKEVTAIETKL-------------------
ODF2L_MOUSE     HFTGDIERLASQVRDQEAKLSETVSASSDWKSQFEKIAIEKTEL--------------------------
HMW2_MYCPN      QASLEYEQQRRTNQVLKEKHRQVQQHFQNLVHAKKKLDQKRHYLAE------------------------
CING_XENTR      STKQELLQMXXXXXDRFSLLQSELEQAKKGSVDPGELASVRKELQRVQDQL-------------------
CING_PAPAN      QGEGLRHGLEAQVMELQNKLKQVQ----------------------------------------------
CING_MOUSE      RLNKELEQIG---DDSKLALQQLQAQMEDY----------------------------------------
CCD18_MOUSE     EMEQKIIKLEGTLEKSELELKECNKQVESL---NEKLQNAKEQLREKE----------------------
SMC6_YEAST      QGRKKVDALNKTIAHLE---EELTKEMG---GDKDQMRQELEQLEKANEKL-------------------
SMC4_YEAST      RLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSK-----------------------------
SMC4_DICDI      ENTKEKDENEAALAEILEKYKSLEKE--------------------------------------------
RAD50_METMP     KKNYSL-KVEESIIETTEKLNELTGKINEYSSLNDEIS--------------------------------
MYO4_CAEEL      --EMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKL-------------------
MYO3_SCHPO      RLDDELLLKQRSYDTKVQELRELKDQCRTY---ESQLASLVSKYSETESEL-------------------
MBO1_SCHPO      LKESELVKSNDNKLLLNEQIESLNDQLSQLKTEMESVTTSKESLADYLSNL-------------------
KTN1_CHICK      KAEIERSTYVSEVRELKDLLTELQDSYSEAVRQNEELNLLKMKLSETLSKL-------------------
DYHC2_CHLRE     GLRGEKVRWEITVGTLGEQLKEL-----------------------------------------------
DAPLE_HUMAN     KENKAL---HQTVTEANGKLSQLE----------------------------------------------
CIP4_PONAB      ----------------------------------------------------------------------
CIP4_HUMAN      ----------------------------------------------------------------------
CC150_HUMAN     LNQQRVQKLEAEVDQWQARMLVMEDQHNSEI---------------------------------------
CAGE1_MACFA     QLRKEQEKVTASALDLLKREKE------------------------------------------------
SYS_MACCJ       RIDTELNEVSQTLKDKLVRLPNLVSDETPFGKDEDENVEVKK----------------------------
NUMA1_HUMAN     TASRELVKEPARAGDRQPEWLEEQ----------------------------------------------
NUF2_ASPFU      NLLRE--KAQIDAMEKRARALQTSSDTFTVVGND------------------------------------
MYSN_ACACA      EANRELKKV---VLDRERQSLESLSKFNSALESDDEIGDLHEKNKQLQAKI-------------------
MLP1_YEAST      ETRKELEKSKINLTDAYSQIKEYKDL---YETTSQSLQQTNSKLDES-----------------------
MIX1_CAEEL      KARREVMLLQATVEEMEKTIKK------------------------------------------------
KINH_STRPU      -SEDELDSCRMTIQQHEAKMKSLSENIRETEGKKRHLEDSLDMLNEEIVKL-------------------
IMH1_YEAST      LKNTEKEKEQTTSQNKVAKLNE------------------------------------------------
CENPE_HUMAN     EKTDKLSNMQKDLENSNAK---LQEKIQELKANEHQLITLKKDVNETQKKVS------------------
CE57R_XENTR     VLEKMCTRLSATHKSAETKIQHLEEKLSNRKALQDKAAQVQTSL--------------------------
Y864_MYCCT      YFNKEIKNIQS-----------------------------------------------------------
TACC2_MOUSE     RANAEIAQVRGKAQQEQA----------------------------------------------------
SAS6_CHICK      ATQEQKVILEENTEKKQSHIEKLE----------------------------------------------
RAD50_DROME     --NREL----KQLEDKEAKLRELDKQLGNL--DFHSVSKEKVNLTKQRDKAT------------------
MYSA_DROME      RKDKELSSITAKLEDEQVVVLKHQRQ--------------------------------------------
MNS1_RAT        EEHKRLLKEENVKQEKRDK-----ERAQYYVDLEKQLEDQERRKQEAYEQL-------------------
K1C1_CARAU      SELSKKRSLEGTLADTQARVTSLEEQIVHLRGDMDRQSQEYQMLLDIKTRL-------------------
HIP1_MOUSE      REKKELADSFARTQEQQDVLENLKHE--------------------------------------------
CIP4_RAT        ----------------------------------------------------------------------
CIP4_MOUSE      ----------------------------------------------------------------------
CEP63_MACFA     QILQGEQSYSSALEGMKMEISHLTQELHQ---RDISIASTKGSSSDMEKRL-------------------
BAP31_HUMAN     RLLEEHAKLQAAVDGPMDKKEE------------------------------------------------
SSP5_STRGN      KAVKENTAKNTAIQAENEAIKQ------------------------------------------------
ROCK2_BOVIN     KQNAELRKER---QDADGQMKELQDQ--------------------------------------------
MFP1_SOLLC      KLEREVSKLQMELEETRASLQRNIDE--------------------------------------------
LMNB2_MOUSE     VAKKQLEKETLMRVDLENRCQSLQEE--------------------------------------------
KINH_RAT        KLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNND-----------------------------------
KINH_HUMAN      KLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNND-----------------------------------
EEA1_HUMAN      KLNEELKSHKLESIKEITNLKDAXXXXXXXXXXXXXXADSLKAAVEQEKR--------------------
CING_CALJA      QGESLRHGLETQVVELQNKLKQVQ----------------------------------------------
BAP31_PONAB     RLLEEHAKLQAAVDGPTDKKEE------------------------------------------------
ANT1_ONCVO      ----ELEKLESDKDDLEKRIIGLQDELNEKDRDTDEIDDLKRKL--------------------------
ROCK2_RAT       KQNAELRKER---QDADGQMKELQDQ--------------------------------------------
ROCK2_MOUSE     KQNTELRKER---QDADGQMKELQDQ--------------------------------------------
ROCK2_HUMAN     KQNAELRKER---QDADGQMKELQDQ--------------------------------------------
ROCK1_BOVIN     KAENRVVQIEKQCSMLDVDLKQSQQKLEHLIENKDRMEDEVKNLT-------------------------
MNS1_MACFA      EEHKRIIKEENAAEDKRNKVK-------------------------------------------------
KI20B_MOUSE     AKSEEADWLATELDKWKEKFKDLETRSNQRLGTMDDLDVLTRKFSKLQDEL-------------------
FIL1L_DANRE     KRLKE---EEAKSSHLTREVEALKEKIHEYMGTEESICRLKTDHTTLQRKLT------------------
CING_HUMAN      QGEDLRHGLETQVMELQNKLKHVQ----------------------------------------------
CING_DANRE      KKQEELKSATRASEKRETELKAEIDRLINQLKKEKEIEKTQQPLVSDQTK--------------------
TPM2_SCHMA      ETDKRATEAEAEVASLQKRIRQL----------EDELESTETRLQEATVKL-------------------
TG278_CAEEL     QIKDELVKKNEEIKTISAKTAQLLE--SNTVESETKLAEREKEIQSFQTQIS------------------
TACC2_HUMAN     RANAEIAQVRGKAQQEQA----------------------------------------------------
RPOC_TROWT      EAENKMANIRREYDDKIEHLERVWDSFGGLYAEDDVFRDVQ-----------------------------
RPOC_TROW8      EAENKMANIRREYDDKIEHLERVWDSFGGLYAEDDVFRDVQ-----------------------------
MYS_AEQIR       RKEAEISSLNSKLEDEQNLVSQLQ----------------------------------------------
MYSS_CYPCA      EALDHLETLKRENKNLQQEISDLTEQLGETGKSIHELEKAKKTVESEKSEI-------------------
MYSP_BOOMI      KVESIKKSLEVEVRNLQVRLEEVE----------------------------------------------
MYH13_HUMAN     RMKKNL---EQTVKDLQHRLDEAE----------------------------------------------
MNS1_BOVIN      EEHERLIKEESAAEDKRNQAK-------------------------------------------------
CYTSA_MOUSE     DLENTVKKLQDQKHDMEREIKTL-----------------------------------------------
COS_DROPS       KES----KLRDQLETELAKLKESRD---------------------------------------------
CLPB_NEIMB      DASKKRLEIDEEINGLQKEYADLDEIWKAEKAISDGAANIKKQIDEVKIKI-------------------
CLPB_NEIMA      DASKKRLEIDEEINGLQKEYADLDEIWKAEKAISDGAANIKKQIDEVKIKI-------------------
CING_SORAR      RLNKELEQIG---EDSKQALHQLQSQLEDYKEKSREVADAQRQAKE------------------------
CEP63_PONAB     QILQGEQSYSSALEGMKMEISHLTQELHQ---RDITIASTKGSSSDMEKRL-------------------
ANR26_HUMAN     VTSRYRINLEDETQDLKKKLQEAQDRHTEAVRCAEKMQDHKQKLEKDNAKL-------------------
AKAP9_HUMAN     QTKLEL---ETTLKAQHKHLKEL-EAFRLEVKDNDTLASEQKKSRELQWAL-------------------
ZN318_MOUSE     SIMKDIAELHKETEEAEKKQSEL-DKVAQILGID------------------------------------
TSG10_MOUSE     QSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKV-------------------
TPM_PERVI       KLQKEVDRLEDELLTEKEKYKAISDE--------------------------------------------
TPM_MYTGA       KLQKEVDRLEDELLTEKEKYKAISDE--------------------------------------------
TPM_MYTED       KLRKEVDRLEDELLTEKEKYKAISDE--------------------------------------------
SYS_LACGA       EVGKEIKDLDKEVEDLTQKQKYILLRLPNFPADSDPI---------------------------------
SMC2_CHICK      KLQDEMKKLKYEEAEQEAHLAK-KKQLSSEISSLRELCES------------------------------
MNS1_HUMAN      EEHKRIIKEENAAEDKRNKAK-------------------------------------------------
M6B_STRP6       ETVKDKIREQKSKQDIGALKQELKKDEGNKVSE-------------------------------------
LMN1_CAEEL      QS--------------QAKQKTLQARNDKLVVENDDL--KKQNITLRDT---------------------
GOGB1_HUMAN     VELCEMKQKPEEIGEESRAKQQIQRKLQAALISRKEALKENKSLQE------------------------
GOGA5_HUMAN     TLQERLHEADATLKREQESYKQMQSEF-------------------------------------------
FKB15_HUMAN     QAEEEIDEIRKSYQEELDKLRQL-----------------------------------------------
FBP1L_RAT       ----------------------------------------------------------------------
FBP1L_MOUSE     ----------------------------------------------------------------------
FBP1L_HUMAN     ----------------------------------------------------------------------
CNPD_BACCR      KREQQLEKKEESLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CN145_HUMAN     HLEEEIAELKKSQAQDKAKLLEMQE---------------------------------------------
CK5P2_MACFA     SENYE-----AALSGKEALLTELRSQNLTKSAENHRLRRSIKKITQELSDL-------------------
CE120_BOVIN     RALKELARLKQREQESQARLKKQQEE--------------------------------------------
APSB_EMENI      EANSKVQRLTVQIESSQAFLREEQDGDKIKIGDESELKTYRMSLQSEKDK--------------------
Y9I8_ENCCU      LSRNELLKLSKMIDDQRSKLALLEDE--------------------------------------------
SMC_BACSU       SDYFELLNSQASIRN---ELQLLDDQMSQSAVTLQRLADNNE----------------------------
PU92_SCICO      ELNCTITQLQEKLERCRGRERDLQCQ--------------------------------------------
MYSN_DROME      ELESQLAEIQEDLEELEALKNELLDSLDTTAAQEQELATLKKSLEE------------------------
MYSC_CHICK      TLSKAKVKLEQQVDDLEGSLEQ------------------------------------------------
MYO3_CAEEL      ESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENIDREK----------------------------
MYH9_CANFA      EAIKQLRKLQAQMKD---CVRELDD---------------------------------------------
MASK_XENLA      RANEEITRLQATLRKEQMKIQSLERSLEQKSKENDEL---------------------------------
KIF4_DICDI      KFNKQAIQDKQTIQEKQSLEREIKDLKRSHTSTETELDKLKKTHLAADVK--------------------
KIF15_HUMAN     SADKELSSVKKTNQEKENKLSEVQLQLDNLRLENEKLLESKACLQDSYDNL-------------------
K2C7_RAT        EA-----ALQKAKQDVARQLREYQELLNTKLALDIEIATYRKLLEGEESRLS------------------
K2C7_MOUSE      EA-----ALQKAKQDVARQLREYQELLNTKLALDIEIATYRKLLEGEESRLS------------------
FNBP1_XENLA     KFNRE-----------------------------------------------------------------
FNBP1_HUMAN     KFNHEQHEYYHTIPNIFQKIQEMEER--------------------------------------------
FBF1_HUMAN      RAELERAKSALLEEQKSVMLK-------------------------------------------------
EVI5_MOUSE      QLEKELVQARLSEAESQCALKEMQDKVNNSFPDENNIARLQEEL--------------------------
EVI5_HUMAN      QLEKELVQARLSEAESQCALKEMQDKVNNSLPDENNIARLQEEL--------------------------
DESP_HUMAN      ELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQ----------------------------
CP135_DANRE     ---ETLLEVRLTVTDLENSLNQLQAVLSS---REREIASLRRQLDQSQEEL-------------------
CNPD_BACC1      KREQQLEKKEDSLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CING_XENLA      RSRDQMEQQRAELNQERSRGQDLE----------------------------------------------
CEP63_HUMAN     QILQGEQSYSSALEGMKMEISHLTQELHQ---RDITIASTKGSSSDMEKRL-------------------
CENPJ_MOUSE     ----------------------------------------------------------------------
CC150_MOUSE     EANFRSVEVSRANRELRHKATELE----------------------------------------------
WDR87_HUMAN     KASRKLIKKRESLSKEPAKLNKILKALQKLTRDERKLTQEEIKMTKMKRAL-------------------
TPR_HUMAN       KAESQLLECKASWEERERMLKD------------------------------------------------
SMC6_MOUSE      KQKEHLDTLNKKRRELDMKEKELQEKMSQARQICPERIEVKKS---------------------------
P54_ENTFC       DLQERIEKREATIQ-KQARETQVKNTSSNYIDNADSLAD-------------------------------
OPTN_CHICK      SVQAEVKLEQAKTQDEKTRYSSLQDAYNKLLA---ELTEAMKTISEMKVK--------------------
MYH9_RAT        RAEKKLKDVLLQVEDERRNAEQFKDQ--------------------------------------------
MYH7_PIG        RMKKNM---EQTIKDLQHRLDEAE----------------------------------------------
MYH7_BOVIN      RMKKNM---EQTIKDLQHRLDEAE----------------------------------------------
MYH7B_MOUSE     PKHKE-----------------------------------------------------------------
MYH6_HUMAN      EAQKQVKSLQSLLKDTQIQLDD------------------------------------------------
MYH13_CANFA     RMKKNL---EQTVKDLQHRLDEAE----------------------------------------------
MYH11_HUMAN     KLQNEVESVTGMLNEAEGKAIKL-----------------------------------------------
MYH10_RAT       EVIKQLRKLQAQMKDYQRELEE------------------------------------------------
MYH10_MOUSE     EVIKQLRKLQAQMKDYQRELEE------------------------------------------------
MYH10_HUMAN     EVIKQLRKLQAQMKDYQRELEE------------------------------------------------
MYH10_BOVIN     EVIKQLRKLQAQMKDYQRELEE------------------------------------------------
MOEH_DROME      AKNMEAVKLEEEIMAKQMEVQRIQDEVN---AKDEETKRLQDEVEDARRK--------------------
KINH_MOUSE      KLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNND-----------------------------------
HIP1_HUMAN      REKKELEDSLERISDQGQ--RKTQEQLEVLESLKQELATSQRELQVLQGSL-------------------
FBP1L_XENLA     ----------------------------------------------------------------------
CNPD_CAMHC      EGT-SLKKTYETKVEESLKLLE------------------------------------------------
YOMI_BACSU      KTDDEA-KFQKELKERQDSIQKLTDQINQYSLDDSEFGKSKKELTEQLQK--------------------
Y4393_ANASP     NRNLEIAQREEVIAKRESRLKELETQ--------------------------------------------
U634C_HUMAN     ASSRHCIYLENGMQDSRKKLDQMRSQF-------------------------------------------
TPM2_DROME      RLQKEVDRLEDRLFNEKEKYKAICD---------------------------------------------
NDC80_EMENI     RMNTERDRLQRSLDDAVSRLEE------------------------------------------------
MYSP_DERFA      EVTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTD------------------------
MYOJ_DICDI      DAVFENQKINNTIKEQEIKSKRMSVELQQHIDEGKQQEIQQLQSTIAQLK--------------------
MYO3_CAEBR      ESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEETIDREK----------------------------
MYO2_SACBA      QKNKDM-ELQKTIEDNQLELEEMVKQHNELKEESDELDETKKALVEHQT---------------------
MYO1_YEAST      DAVSEHGKITAELKETRIQLTEYK---SNYQKIKEEYSNFQRETKEQEQK--------------------
MYH9_MOUSE      KAKQTLNEVKALLQGKEAQLQELQVKFSEGERVRTELAD---KVTKLQVEL-------------------
MYH9_HUMAN      EAIKQLRKLQAQMKDCMRELDD------------------------------------------------
MYH6_MESAU      RMKKNM---EQTIKDLQHRLDEAE----------------------------------------------
MYH3_RAT        ----QLETVKRENKNLEQEIADLTEQIAENGKSIHELEKSRKQM--------------------------
MYH3_MOUSE      ----QLETVKRENKNLEQEIADLTEQIAENGKSIHELEKSRKQM--------------------------
MFP1_TOBAC      DAHSLVMKLGKERESLEKRAKKLEDEMASAKGE-------------------------------------
LRRF2_RAT       ELKAEKRKLQRELRTAQDKIEEME----------------------------------------------
LRRF2_MOUSE     ELKAERRKLQRELRTAQDKIEEME----------------------------------------------
BRE1_USTMA      KAVDEL---ESARQDVELTRRESDSRYAEIQTLNEEVRTLKCKLHETQTKLT------------------
BAP29_HUMAN     ----QLLKEHSELQDR------------------------------------------------------
ANC1_CAEEL      KLEKELTKV-------------------------------------------------------------
ZC3H1_HUMAN     KYGEELARAKAVASKEIGKRKLEQDRFG------------------------------------------
UACA_CANFA      KLKKEIFTLQKDLKDKNVLIENSHDMERALNRKAEELNKQLKDLLQKYSEI-------------------
TSG10_RAT       QSTEALIMCEQDISRMRRQLDETNDELGQIARERDILAHENDNLQEQFAKV-------------------
TAXB1_XENTR     RLDTDSVRMQLADALAQLSMRDEQQQKSNPFAKKDQGADNNR----------------------------
SYS_STAHJ       DVIKEMRELGDEIKENDAKLNEVDNK--------------------------------------------
SMC1B_HUMAN     KLQKEVVSIQTSLEQKRLEKHNL-----------------------------------------------
SDPR_HUMAN      RMDRQCAQVK------------------------------------------------------------
PNP_THEAB       MISEEELRDKLLIKEKSAKLKEYRDQILEKIFEDVEMEDDEKILQESLLK--------------------
OPTN_DANRE      EMKMELFQKEKDLE--------------------------------------------------------
MYSP_SARSC      AANKANIDLQKTIKKQALQITELQAHY-------------------------------------------
MYH8_HUMAN      KAK---TKLEQQVDDLEGSLEQ------------------------------------------------
MYH7_HORSE      KKDFELNALNARIEDEQALGSQLQ----------------------------------------------
MYH7B_HUMAN     MAETQANKLRARTRD-------------------------------------------------------
MYH3_HUMAN      SLNKTKSKLEQQVEDLESSLEQ------------------------------------------------
MYH11_MOUSE     KLQNEVESVTGMLNEAEGKAIKL-----------------------------------------------
MAD1_SCHPO      EKNHEVMVSNQALQMKDTNLTNLEKLF----ADSREQLETK-----------------------------
LMNB1_HUMAN     LLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLAL--------------------------
LAMC1_XENTR     TANEALRLLQKTLASENQTALDIEELNRKYAQAKDIARELEKQASKVHAE--------------------
KIF15_MOUSE     SADKELVKLEYSTENHEKELSQLSEQLDNARLENEKLLESQACLQDSYDNL-------------------
KI21A_HUMAN     AMNKELQRLQA-AQKEHARLLKNQSQY-------------------------------------------
K2C7_BOVIN      KQEDLEAALQKAKQDMTRQLREYQELMNVKLALDIEIATYRKLLEGEESRLT------------------
IMH1_ASHGO      -LESELLKSQENVSKFRNQNNDLSEKLRDYIVLKKSEATTRMSLSQKE----------------------
HOOK3_XENLA     KA-KSVIRTQGTGPEIQALKNQLQERDKMFVSLEKEFEKTK-----------------------------
HMW2_MYCGA      ELNEEINRAQKSKQNSLVLEQKLKSDLEHLNLSKNYLDKQQEELNQKSDKM-------------------
GOGC3_ARATH     QTN-EYQRSQISHLEKSLK-QAISNQEDNRLSNDNQIRKLKDTVDDLNQKLT------------------
FIL1L_HUMAN     DIKEKISKGEYGNAGIMAEVEELRKRVLDMEGKDEELIKMEEQCRDLNKRL-------------------
FBP1L_XENTR     ----------------------------------------------------------------------
EP15R_MOUSE     TILRSLKCTQDDINQARSKLSQLQE---------------------------------------------
DYHC_EMENI      KQEKEV----------------------------------------------------------------
CYTSA_TAKRU     DLENSVKKLQDQKHDMEREIKIL-----------------------------------------------
CYTSA_DANRE     QHRAVKLHDNLIISDLENSMKKLQDQ--------------------------------------------
CP110_HUMAN     LAKQDLLKHQDVLLSEQTRLQKDISEWANRFED-------------------------------------
CNPD_BACHK      KRELQLEKKEDSLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CNPD_BACCZ      KRELQLEKKEDSLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CNPD_BACCN      KREQMLEKKEESLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CNPD_BACAN      KRELQLEKKEDSLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CNPD_BACAH      KRELQLEKKEDSLVARQQQIEELESKVGELVQKQQTELERISNLTREQAK--------------------
CACO1_DANRE     QTEKELHSLSAEFQSLRSSLAQ------------------------------------------------
BI2L1_MOUSE     YEHKEIEYVE-TVTSRQSEIQK------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxx
MRP4_STRPY      ---------
SMC2_XENLA      ---------
CL190_DROME     ---------
SAS6_MOUSE      ---------
CLIP1_CHICK     ---------
CGNL1_HUMAN     ---------
Y066_NPVAC      ---------
HMW2_MYCGE      ---------
SMC2_MOUSE      ---------
NPHP3_XENLA     ---------
SMC2_HUMAN      ---------
ICR3_ARATH      ---------
ATPF_ELUMP      ---------
SMC6_XENLA      ---------
NUF1_YEAST      ---------
EEA1_MOUSE      ---------
SMC1A_RAT       ---------
SMC1A_MOUSE     ---------
SMC1A_HUMAN     ---------
SMC1A_BOVIN     ---------
RAD50_PYRHO     ---------
MY18A_MOUSE     ---------
MOEH_CULQU      ---------
CYTSA_CHICK     ---------
CP135_MOUSE     ---------
CCD18_HUMAN     ---------
KINH_DROME      ---------
GOGA3_MOUSE     ---------
FKBP5_DICDI     ---------
CYTSA_PANTR     ---------
CYTSA_HUMAN     ---------
TPM_CHLNI       ---------
MYSP_OPIFE      ---------
MYO2_CAEEL      ---------
USO1_YEAST      ---------
ATPF_CLOPH      ---------
YJNB_SCHPO      ---------
VATE_METM5      ---------
SEC2_YEAST      ---------
MYH11_CHICK     ---------
MY18A_HUMAN     ---------
MUTS2_STAS1     ---------
KLPA_EMENI      ---------
KINH_LOLPE      ---------
CGNL1_MOUSE     ---------
SMC1A_XENLA     ---------
ODF2L_MOUSE     ---------
HMW2_MYCPN      ---------
CING_XENTR      ---------
CING_PAPAN      ---------
CING_MOUSE      ---------
CCD18_MOUSE     ---------
SMC6_YEAST      ---------
SMC4_YEAST      ---------
SMC4_DICDI      ---------
RAD50_METMP     ---------
MYO4_CAEEL      ---------
MYO3_SCHPO      ---------
MBO1_SCHPO      ---------
KTN1_CHICK      ---------
DYHC2_CHLRE     ---------
DAPLE_HUMAN     ---------
CIP4_PONAB      ---------
CIP4_HUMAN      ---------
CC150_HUMAN     ---------
CAGE1_MACFA     ---------
SYS_MACCJ       ---------
NUMA1_HUMAN     ---------
NUF2_ASPFU      ---------
MYSN_ACACA      ---------
MLP1_YEAST      ---------
MIX1_CAEEL      ---------
KINH_STRPU      ---------
IMH1_YEAST      ---------
CENPE_HUMAN     ---------
CE57R_XENTR     ---------
Y864_MYCCT      ---------
TACC2_MOUSE     ---------
SAS6_CHICK      ---------
RAD50_DROME     ---------
MYSA_DROME      ---------
MNS1_RAT        ---------
K1C1_CARAU      ---------
HIP1_MOUSE      ---------
CIP4_RAT        ---------
CIP4_MOUSE      ---------
CEP63_MACFA     ---------
BAP31_HUMAN     ---------
SSP5_STRGN      ---------
ROCK2_BOVIN     ---------
MFP1_SOLLC      ---------
LMNB2_MOUSE     ---------
KINH_RAT        ---------
KINH_HUMAN      ---------
EEA1_HUMAN      ---------
CING_CALJA      ---------
BAP31_PONAB     ---------
ANT1_ONCVO      ---------
ROCK2_RAT       ---------
ROCK2_MOUSE     ---------
ROCK2_HUMAN     ---------
ROCK1_BOVIN     ---------
MNS1_MACFA      ---------
KI20B_MOUSE     ---------
FIL1L_DANRE     ---------
CING_HUMAN      ---------
CING_DANRE      ---------
TPM2_SCHMA      ---------
TG278_CAEEL     ---------
TACC2_HUMAN     ---------
RPOC_TROWT      ---------
RPOC_TROW8      ---------
MYS_AEQIR       ---------
MYSS_CYPCA      ---------
MYSP_BOOMI      ---------
MYH13_HUMAN     ---------
MNS1_BOVIN      ---------
CYTSA_MOUSE     ---------
COS_DROPS       ---------
CLPB_NEIMB      ---------
CLPB_NEIMA      ---------
CING_SORAR      ---------
CEP63_PONAB     ---------
ANR26_HUMAN     ---------
AKAP9_HUMAN     ---------
ZN318_MOUSE     ---------
TSG10_MOUSE     ---------
TPM_PERVI       ---------
TPM_MYTGA       ---------
TPM_MYTED       ---------
SYS_LACGA       ---------
SMC2_CHICK      ---------
MNS1_HUMAN      ---------
M6B_STRP6       ---------
LMN1_CAEEL      ---------
GOGB1_HUMAN     ---------
GOGA5_HUMAN     ---------
FKB15_HUMAN     ---------
FBP1L_RAT       ---------
FBP1L_MOUSE     ---------
FBP1L_HUMAN     ---------
CNPD_BACCR      ---------
CN145_HUMAN     ---------
CK5P2_MACFA     ---------
CE120_BOVIN     ---------
APSB_EMENI      ---------
Y9I8_ENCCU      ---------
SMC_BACSU       ---------
PU92_SCICO      ---------
MYSN_DROME      ---------
MYSC_CHICK      ---------
MYO3_CAEEL      ---------
MYH9_CANFA      ---------
MASK_XENLA      ---------
KIF4_DICDI      ---------
KIF15_HUMAN     ---------
K2C7_RAT        ---------
K2C7_MOUSE      ---------
FNBP1_XENLA     ---------
FNBP1_HUMAN     ---------
FBF1_HUMAN      ---------
EVI5_MOUSE      ---------
EVI5_HUMAN      ---------
DESP_HUMAN      ---------
CP135_DANRE     ---------
CNPD_BACC1      ---------
CING_XENLA      ---------
CEP63_HUMAN     ---------
CENPJ_MOUSE     ---------
CC150_MOUSE     ---------
WDR87_HUMAN     ---------
TPR_HUMAN       ---------
SMC6_MOUSE      ---------
P54_ENTFC       ---------
OPTN_CHICK      ---------
MYH9_RAT        ---------
MYH7_PIG        ---------
MYH7_BOVIN      ---------
MYH7B_MOUSE     ---------
MYH6_HUMAN      ---------
MYH13_CANFA     ---------
MYH11_HUMAN     ---------
MYH10_RAT       ---------
MYH10_MOUSE     ---------
MYH10_HUMAN     ---------
MYH10_BOVIN     ---------
MOEH_DROME      ---------
KINH_MOUSE      ---------
HIP1_HUMAN      ---------
FBP1L_XENLA     ---------
CNPD_CAMHC      ---------
YOMI_BACSU      ---------
Y4393_ANASP     ---------
U634C_HUMAN     ---------
TPM2_DROME      ---------
NDC80_EMENI     ---------
MYSP_DERFA      ---------
MYOJ_DICDI      ---------
MYO3_CAEBR      ---------
MYO2_SACBA      ---------
MYO1_YEAST      ---------
MYH9_MOUSE      ---------
MYH9_HUMAN      ---------
MYH6_MESAU      ---------
MYH3_RAT        ---------
MYH3_MOUSE      ---------
MFP1_TOBAC      ---------
LRRF2_RAT       ---------
LRRF2_MOUSE     ---------
BRE1_USTMA      ---------
BAP29_HUMAN     ---------
ANC1_CAEEL      ---------
ZC3H1_HUMAN     ---------
UACA_CANFA      ---------
TSG10_RAT       ---------
TAXB1_XENTR     ---------
SYS_STAHJ       ---------
SMC1B_HUMAN     ---------
SDPR_HUMAN      ---------
PNP_THEAB       ---------
OPTN_DANRE      ---------
MYSP_SARSC      ---------
MYH8_HUMAN      ---------
MYH7_HORSE      ---------
MYH7B_HUMAN     ---------
MYH3_HUMAN      ---------
MYH11_MOUSE     ---------
MAD1_SCHPO      ---------
LMNB1_HUMAN     ---------
LAMC1_XENTR     ---------
KIF15_MOUSE     ---------
KI21A_HUMAN     ---------
K2C7_BOVIN      ---------
IMH1_ASHGO      ---------
HOOK3_XENLA     ---------
HMW2_MYCGA      ---------
GOGC3_ARATH     ---------
FIL1L_HUMAN     ---------
FBP1L_XENTR     ---------
EP15R_MOUSE     ---------
DYHC_EMENI      ---------
CYTSA_TAKRU     ---------
CYTSA_DANRE     ---------
CP110_HUMAN     ---------
CNPD_BACHK      ---------
CNPD_BACCZ      ---------
CNPD_BACCN      ---------
CNPD_BACAN      ---------
CNPD_BACAH      ---------
CACO1_DANRE     ---------
BI2L1_MOUSE     ---------