[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99691.1

[Show Plain Result]


## Summary of Sequence Search
    1::402
  189::362     2e-25  35%  419 aa  YHAP_BACSU RecName: Full=Uncharacterized protein yhaP;
  192::347     6e-07  26%  403 aa  Y1024_METJA RecName: Full=Uncharacterized protein MJ1024;
   86::149     1e-04  39%  510 aa  YJY5_YEAST RecName: Full=Uncharacterized endoplasmic reticulum
  124::230     3e-04  33%  451 aa  MEPA_STAS1 RecName: Full=Multidrug export protein mepA;
   14::124     9e-04  33%  270 aa  CDSA_THEMA RecName: Full=Phosphatidate cytidylyltransferase;       
    1::402

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHAP_BACSU      ----------------------------------------------------------------------
Y1024_METJA     ----------------------------------------------------------------------
YJY5_YEAST      ----------------------------------------------------------------------
MEPA_STAS1      ----------------------------------------------------------------------
CDSA_THEMA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHAP_BACSU      ----------------------------------------------------------------------
Y1024_METJA     ----------------------------------------------------------------------
YJY5_YEAST      ----------------------------------------------------------------------
MEPA_STAS1      ----------------------------------------------------------------------
CDSA_THEMA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILSFLMYIVILTYAATTAQEIAAEKGTKIMEVIFS
YHAP_BACSU      -----------------------------------IMLFVIYFSVIMYASMIAMEVATEKSSRVMEILIS
Y1024_METJA     --------------------------------------FLLYMAXXXXXXXXXXXXXEEKQNRIMELLLC
YJY5_YEAST      ----------------------------------------------------------------------
MEPA_STAS1      ----------------------------------------------------------------------
CDSA_THEMA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SMSATKYFYGKILGILGVILTHTGIYLLGGIAIYPFIINLDMVSKFKDMIGDILLNLVSVNLIYVVLGII
YHAP_BACSU      SMPPIQQMFAKLLGIGLVGITQLAIIIGAG----SLSLKLNQKSETASSVGGFL-NLTDVSVIFFLLGYF
Y1024_METJA     YSSAENLMFGKILGISAVGLLQIGIWVLFAL---PIIITYAV---------KVSLYLAIFALIYFVXXXX
YJY5_YEAST      ----------------------------------------------------VLLKFVFTNCL---LAII
MEPA_STAS1      -----------LLGARGETLGFTSAYLKVMFLSAPFVILFFILEQFARSIGAPIISMIGM-LASVVLNII
CDSA_THEMA      --------------------------------VAPFVV-LCFVS-YESLIGLVSAILILAGYELITLEMF


                         .         *         .         .         .         .         +:350
query           IYTILAAFFGALVVRVEDTSKAIQPITILIIASFLSSMVFINNPSSMIVKVLSYVPFLSSFFMPIRVxxx
YHAP_BACSU      LYATLAAFLGSVVSRIEDVQQTITPMTLLVVAGFMIAMFGLNAPDAGFITVTSFIPFFTPMIMFLRV---
Y1024_METJA     XXXXXXXXXXXXXXHPKDAXXXXXXXXXXXXXXXMFMNTIMVNPNHYMAKILSYVPFTAPYAVVLR----
YJY5_YEAST      CFTMFVLFWGALY----DTSKYLHKVKLLVVIQ-EPPVVILDNNSSMVVPSISY----------------
MEPA_STAS1      LDTILIFGFDLNVV-----GAALGTAISNVVASLFFIIYFLRK-SDIITMSLSYV---------------
CDSA_THEMA      FYVILLALYPVLYGLVFE--EPTQPLSILFITGVVFSLITDKDPSQVFKTVLIYVTFFLSFFLPI-----


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHAP_BACSU      ----------------------------------------------------
Y1024_METJA     ----------------------------------------------------
YJY5_YEAST      ----------------------------------------------------
MEPA_STAS1      ----------------------------------------------------
CDSA_THEMA      ----------------------------------------------------