[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99736.1

[Show Plain Result]


## Summary of Sequence Search
    1::252
    4::258     2e-12  24%  261 aa  YDFB_BACSU RecName: Full=Uncharacterized N-acetyltransferase ydfB; 
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKPNLNLITTAVD
YDFB_BACSU      LQELTKKKYSSLKTMFDDTFVYSILDQTIGAVYADDQTFPKSFF--IGTESGIYFIAGDQGAGYYEEQVK


                         .         .         *         .         .         .         .:140
query           ACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIEKLPPEFQIHSIDANLYDQCL
YDFB_BACSU      SSKRFTLFSSSDTWDSVLKPILKDDLNQMRRAAFSYQPKSFKKTLQLPLKRIDEDIISHS---TAFNSAY


                         +         .         .         .         .         *         .:210
query           QKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQL
YDFB_BACSU      YEEY-------WNSVSQFASKGFGFAVLHGNHVVSECTSIFLGHNRAEMDIYTLEEYRGLGLAYCVANRF


                         .         .         .         +         .         .         .:280
query           IITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYxxxx
YDFB_BACSU      IAFCMENGIVPSWDCDNNSSIALAAKLGFKTVTEYTIY----