[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99739.1

[Show Plain Result]


## Summary of Sequence Search
    1::578
    1::578       0.0 100%  578 aa  ADEC_LACS1 RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::575     e-167  53%  576 aa  ADEC2_DESPS RecName: Full=Adenine deaminase 2;       
    1::572     e-145  47%  580 aa  ADEC2_LACSS RecName: Full=Adenine deaminase 2;       
    7::560     e-130  44%  570 aa  ADEC2_CARHZ RecName: Full=Adenine deaminase 2;       
   10::572     e-124  40%  575 aa  ADEC_DESVH RecName: Full=Adenine deaminase;         Short=Adenase; 
   10::572     e-124  40%  575 aa  ADEC_DESVV RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::570     e-122  41%  581 aa  ADEC_CLOBB RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::573     e-122  41%  581 aa  ADEC_CLOBA RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::570     e-119  41%  570 aa  ADEC_CLOAB RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::564     e-119  41%  571 aa  ADEC_DEHE1 RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::579     e-119  40%  585 aa  ADEC_BACHD RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::566     e-117  40%  576 aa  ADEC_BACP2 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::563     e-117  42%  563 aa  ADEC_OCHA4 RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::570     e-115  41%  577 aa  ADEC_KOSOT RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::581     e-115  43%  581 aa  ADEC_BRUSU RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::580     e-115  40%  582 aa  ADEC_OCEIH RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::581     e-115  43%  581 aa  ADEC_BRUAB RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::581     e-115  43%  581 aa  ADEC_BRUA2 RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::581     e-114  43%  581 aa  ADEC_BRUME RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::566     e-113  40%  570 aa  ADEC_PETMO RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::570     e-112  39%  571 aa  ADEC_DEHSB RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::564     e-112  39%  573 aa  ADEC_BACLD RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::570     e-111  38%  571 aa  ADEC_DEHSC RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::579     e-110  39%  579 aa  ADEC_LISW6 RecName: Full=Adenine deaminase;         Short=Adenase; 
    9::565     e-110  40%  565 aa  ADEC_CLOD6 RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::569     e-110  39%  577 aa  ADEC_BACA2 RecName: Full=Adenine deaminase;         Short=Adenase; 
   10::574     e-110  38%  576 aa  ADEC1_BACSK RecName: Full=Adenine deaminase 1;       
    6::580     e-110  40%  580 aa  ADEC_LISMO RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::571     e-109  38%  581 aa  ADEC_LYSSC RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::579     e-109  39%  579 aa  ADEC_LISMF RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::560     e-109  40%  565 aa  ADEC1_RHIME RecName: Full=Adenine deaminase 1;       
    5::579     e-108  38%  579 aa  ADEC_LISIN RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::568     e-108  40%  574 aa  ADEC_THEAB RecName: Full=Adenine deaminase;         Short=Adenase; 
    9::575     e-107  40%  577 aa  ADEC_GEOKA RecName: Full=Adenine deaminase;         Short=Adenase; 
    9::556     e-107  41%  556 aa  ADEC_ARCFU RecName: Full=Adenine deaminase;         Short=Adenase; 
    5::566     e-105  40%  569 aa  ADEC_DESAA RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::568     e-105  38%  574 aa  ADEC_THEM4 RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::564     e-104  40%  565 aa  ADEC_RHISN RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::564     e-104  39%  565 aa  ADEC1_RHIEC RecName: Full=Adenine deaminase 1;       
    1::575     e-103  37%  577 aa  ADEC_BACSU RecName: Full=Adenine deaminase;         Short=Adenase; 
   20::575     e-103  39%  575 aa  ADEC1_AGRT5 RecName: Full=Adenine deaminase 1;       
    8::568     e-102  39%  569 aa  ADEC1_RHIL3 RecName: Full=Adenine deaminase 1;       
   10::547     e-102  40%  558 aa  ADEC_METB6 RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::565     e-101  38%  569 aa  ADEC_DESHY RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::565     e-100  38%  566 aa  ADEC_DESHD RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::594     e-100  39%  599 aa  ADEC_CLOBL RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::594     e-100  39%  599 aa  ADEC_CLOB1 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::565     2e-99  37%  565 aa  ADEC_GLUOX RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::594     2e-99  39%  599 aa  ADEC_CLOB6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::594     6e-99  39%  599 aa  ADEC_CLOBM RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::507     3e-97  40%  518 aa  ADEC_METMJ RecName: Full=Adenine deaminase;         Short=Adenase; 
    7::571     3e-96  36%  576 aa  ADEC_SYNFM RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::560     2e-95  38%  565 aa  ADEC_RHOSK RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::560     3e-95  37%  565 aa  ADEC_RHOS1 RecName: Full=Adenine deaminase;         Short=Adenase; 
   24::558     3e-93  38%  567 aa  ADEC_METTP RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::561     3e-93  38%  570 aa  ADEC_DESDG RecName: Full=Adenine deaminase;         Short=Adenase; 
    9::548     2e-91  38%  551 aa  ADEC_LEUMM RecName: Full=Adenine deaminase;         Short=Adenase; 
   14::577     6e-91  35%  584 aa  ADEC_METBU RecName: Full=Adenine deaminase;         Short=Adenase; 
   14::584     7e-90  37%  596 aa  ADEC_MOOTA RecName: Full=Adenine deaminase;         Short=Adenase; 
   11::592     9e-90  38%  595 aa  ADEC3_RHIME RecName: Full=Adenine deaminase 3;       
    3::560     3e-89  36%  565 aa  ADEC_RHOS4 RecName: Full=Adenine deaminase;         Short=Adenase; 
   12::581     4e-89  37%  591 aa  ADEC_EDWI9 RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::545     6e-89  37%  551 aa  ADEC_METBF RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::585     6e-89  37%  586 aa  ADEC_BDEBA RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::549     8e-88  35%  553 aa  ADEC1_OENOB RecName: Full=Adenine deaminase 1;       
    2::560     1e-87  37%  565 aa  ADEC_RHOS5 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::559     1e-87  36%  564 aa  ADEC_METS4 RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::549     2e-87  37%  555 aa  ADEC_METMA RecName: Full=Adenine deaminase;         Short=Adenase; 
   12::586     2e-87  36%  588 aa  ADEC_ESCF3 RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::587     7e-87  39%  601 aa  ADEC_SILST RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::596     9e-87  36%  605 aa  ADEC_STAMF RecName: Full=Adenine deaminase;         Short=Adenase; 
   11::548     9e-87  36%  551 aa  ADEC_LEUCK RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::529     1e-86  39%  538 aa  ADEC_METTH RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::551     2e-86  33%  563 aa  ADEC_LACPL RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     2e-86  36%  588 aa  ADEC_SHISS RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     3e-86  36%  588 aa  ADEC_ECO7I RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     4e-86  36%  588 aa  ADEC_ECOLU RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     4e-86  36%  588 aa  ADEC_ECOL5 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     4e-86  36%  588 aa  ADEC_ECO81 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::585     6e-86  36%  588 aa  ADEC_ECOUT RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     6e-86  36%  588 aa  ADEC_ECOL6 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::585     6e-86  36%  588 aa  ADEC_ECOK1 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::585     6e-86  36%  588 aa  ADEC_ECO45 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECOLI RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECOLC RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECODH RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECOBW RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECO8A RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     8e-86  36%  588 aa  ADEC_ECO55 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-85  36%  588 aa  ADEC_ECOSE RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-85  36%  588 aa  ADEC_ECOHS RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-85  36%  588 aa  ADEC_ECO5E RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-85  36%  588 aa  ADEC_ECO57 RecName: Full=Adenine deaminase;         Short=Adenase; 
   14::599     2e-85  37%  603 aa  ADEC1_CARHZ RecName: Full=Adenine deaminase 1;       
   19::586     5e-85  36%  588 aa  ADEC_SHIF8 RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::582     5e-85  37%  584 aa  ADEC_SHIDS RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::595     5e-85  37%  605 aa  ADEC_RHILO RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::546     6e-85  37%  556 aa  ADEC_METJA RecName: Full=Adenine deaminase;         Short=Adenase; 
   16::584     6e-85  39%  594 aa  ADEC1_JANSC RecName: Full=Adenine deaminase 1;       
   19::586     8e-85  36%  588 aa  ADEC_SHIFL RecName: Full=Adenine deaminase;         Short=Adenase; 
   16::593     1e-84  38%  600 aa  ADEC_ROSDO RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-84  36%  588 aa  ADEC_ECOSM RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     1e-84  36%  588 aa  ADEC_ECO24 RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::581     4e-84  34%  588 aa  ADEC_DESRM RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::547     5e-84  36%  553 aa  ADEC_METAC RecName: Full=Adenine deaminase;         Short=Adenase; 
   19::586     2e-83  36%  588 aa  ADEC_SHIBS RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::566     2e-83  38%  571 aa  ADEC_METS3 RecName: Full=Adenine deaminase;         Short=Adenase; 
    6::535     3e-83  36%  540 aa  ADEC_FLAPJ RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::560     4e-83  36%  565 aa  ADEC_METNO RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::579     3e-81  35%  592 aa  ADEC_SILPO RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::530     3e-80  37%  533 aa  ADEC_SULNB RecName: Full=Adenine deaminase;         Short=Adenase; 
    1::535     4e-80  35%  542 aa  ADEC_METST RecName: Full=Adenine deaminase;         Short=Adenase; 
   12::586     2e-79  33%  587 aa  ADEC_SHEHH RecName: Full=Adenine deaminase;         Short=Adenase; 
   10::545     2e-78  33%  545 aa  ADEC_SALRD RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::589     3e-78  35%  597 aa  ADEC_PARDP RecName: Full=Adenine deaminase;         Short=Adenase; 
   22::547     4e-77  38%  564 aa  ADEC_DEIGD RecName: Full=Adenine deaminase;         Short=Adenase; 
   15::550     4e-77  38%  558 aa  ADEC_DEIDV RecName: Full=Adenine deaminase;         Short=Adenase; 
    8::546     6e-75  33%  548 aa  ADEC_BORAP RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::542     5e-74  34%  545 aa  ADEC_PARD8 RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::565     5e-74  33%  573 aa  ADEC2_BACSK RecName: Full=Adenine deaminase 2;       
    2::546     2e-72  33%  548 aa  ADEC_BORBU RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::589     1e-71  35%  596 aa  ADEC_META3 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::565     7e-71  31%  568 aa  ADEC_CLOP1 RecName: Full=Adenine deaminase;         Short=Adenase; 
    2::565     1e-69  31%  572 aa  ADEC_CLOPE RecName: Full=Adenine deaminase;         Short=Adenase; 
    4::562     2e-67  30%  579 aa  ADEC_ENTFA RecName: Full=Adenine deaminase;         Short=Adenase; 
   17::530     2e-66  32%  603 aa  ADEC_KLEP3 RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::555     9e-66  32%  565 aa  ADEC_LACDA RecName: Full=Adenine deaminase;         Short=Adenase; 
   27::369     9e-66  39%  536 aa  ADEC_DEIRA RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::577     9e-66  32%  594 aa  ADEC1_DESPS RecName: Full=Adenine deaminase 1;       
   12::580     2e-65  31%  594 aa  ADEC1_LACSS RecName: Full=Adenine deaminase 1;       
   17::530     7e-65  32%  603 aa  ADEC_KLEP7 RecName: Full=Adenine deaminase;         Short=Adenase; 
    3::554     3e-64  32%  567 aa  ADEC2_OENOB RecName: Full=Adenine deaminase 2;       
   10::533     6e-62  30%  595 aa  ADEC_SERP5 RecName: Full=Adenine deaminase;         Short=Adenase; 
   20::525     1e-58  30%  595 aa  ADEC2_RHIL3 RecName: Full=Adenine deaminase 2;       
    6::530     2e-58  27%  609 aa  ADEC_CENSY RecName: Full=Adenine deaminase;         Short=Adenase; 
   59::582     5e-58  30%  599 aa  ADEC_METKA RecName: Full=Adenine deaminase;         Short=Adenase; 
   16::597     1e-56  32%  606 aa  ADEC_RUBXD RecName: Full=Adenine deaminase;         Short=Adenase; 
   18::586     4e-56  34%  600 aa  ADEC3_RHIL3 RecName: Full=Adenine deaminase 3;       
   32::525     1e-55  31%  595 aa  ADEC2_RHIEC RecName: Full=Adenine deaminase 2;       
   21::545     3e-54  30%  597 aa  ADEC2_AGRT5 RecName: Full=Adenine deaminase 2;       
   12::576     8e-54  29%  600 aa  ADEC4_RHIME RecName: Full=Adenine deaminase 4;       
   19::594     6e-52  33%  600 aa  ADEC_MESSB RecName: Full=Adenine deaminase;         Short=Adenase; 
   23::558     4e-51  31%  623 aa  ADEC2_JANSC RecName: Full=Adenine deaminase 2;       
   18::588     3e-49  30%  600 aa  ADEC1_BRAJA RecName: Full=Adenine deaminase 1;       
   26::560     8e-48  31%  625 aa  ADEC2_BRAJA RecName: Full=Adenine deaminase 2;       
   18::588     6e-46  29%  600 aa  ADEC_BRASB RecName: Full=Adenine deaminase;         Short=Adenase; 
   50::527     1e-45  28%  593 aa  ADEC2_RHIME RecName: Full=Adenine deaminase 2;       
   25::559     5e-43  28%  624 aa  ADEC1_BRASO RecName: Full=Adenine deaminase 1;       
   18::588     7e-42  29%  600 aa  ADEC2_BRASO RecName: Full=Adenine deaminase 2;       
   28::565     1e-35  30%  573 aa  Y1085_PICTO RecName: Full=Putative adenine deaminase PTO1085;      
   10::571     3e-35  26%  581 aa  Y637_BACHD RecName: Full=Putative adenine deaminase BH0637;        
   17::570     7e-31  25%  580 aa  YERA_BACSU RecName: Full=Putative adenine deaminase yerA;       
   11::568     1e-28  25%  579 aa  Y751_OCEIH RecName: Full=Putative adenine deaminase OB0751;        
   16::580     1e-28  22%  589 aa  Y3012_BACCR RecName: Full=Putative adenine deaminase BC_3012;      
   11::579     8e-25  22%  584 aa  Y3032_BACAN RecName: Full=Putative adenine deaminase
  228::374     1e-08  36%  399 aa  HUTI_DEIDV RecName: Full=Imidazolonepropionase;       
    2::114     9e-07  26%  425 aa  PYRC_GEOLS RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::92      9e-07  38%  453 aa  ALLB_ECOUT RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECOL6 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECOL5 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECOK1 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECO81 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECO45 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      9e-07  38%  453 aa  ALLB_ECO27 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    2::404     1e-06  23%  424 aa  PYRC_GEOBB RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::92      3e-06  37%  453 aa  ALLB_SALTY RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALTI RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALPK RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALPB RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALPA RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALNS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALHS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALEP RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALDC RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      3e-06  37%  453 aa  ALLB_SALA4 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    2::404     4e-06  24%  425 aa  PYRC_GEOSM RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::410     5e-06  26%  421 aa  PYRC_CLOD6 RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::61      5e-06  37%  454 aa  ALLB_ENTFA RecName: Full=Allantoinase;       
   87::180     6e-06  40%  611 aa  URE12_PSYCK RecName: Full=Urease subunit alpha 2;       
    4::92      6e-06  33%  453 aa  ALLB_SALCH RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    3::62      8e-06  42%  431 aa  PYRC_THEPX RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::62      8e-06  42%  431 aa  PYRC_THEP3 RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::95      8e-06  35%  430 aa  PYRC_ANATD RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::62      8e-06  40%  457 aa  HYDA_RHIRD RecName: Full=D-hydantoinase;         EC=3.5.2.-;
    4::92      8e-06  35%  453 aa  ALLB_ECOSE RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECOLU RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECOLI RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECOLC RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECOHS RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECODH RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECOBW RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECO8A RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECO55 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      8e-06  35%  453 aa  ALLB_ECO24 RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    4::92      1e-05  33%  453 aa  ALLB_ECOSM RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
    3::94      2e-05  33%  430 aa  PYRC_SOLUE RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::113     2e-05  30%  428 aa  PYRC_CLOCE RecName: Full=Dihydroorotase;         Short=DHOase;     
   31::376     2e-05  28%  405 aa  HUTI_SILST RecName: Full=Imidazolonepropionase;       
    5::118     2e-05  31%  542 aa  DPYS_SACKL RecName: Full=Dihydropyrimidinase;         Short=DHPase;
    9::95      3e-05  34%  429 aa  PYRC_LACS1 RecName: Full=Dihydroorotase;         Short=DHOase;     
   68::158     4e-05  43%  571 aa  URE1_BACHD RecName: Full=Urease subunit alpha;       
    4::58      4e-05  36%  425 aa  PYRC_LACAC RecName: Full=Dihydroorotase;         Short=DHOase;   
    2::385     4e-05  28%  398 aa  PYRC_CLOBA RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::213     4e-05  31%  458 aa  HYDL_ARTAU RecName: Full=L-hydantoinase;       
    2::62      4e-05  42%  457 aa  HYDA_BURPI RecName: Full=D-hydantoinase;         EC=3.5.2.-;
    4::62      4e-05  40%  446 aa  ALLB_BACSU RecName: Full=Allantoinase;       
   70::146     5e-05  45%  571 aa  URE1_STAAW RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAT RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAS RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAR RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAN RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAM RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAE RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAC RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAAB RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAA9 RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAA8 RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAA3 RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAA2 RecName: Full=Urease subunit alpha;       
   70::146     5e-05  45%  571 aa  URE1_STAA1 RecName: Full=Urease subunit alpha;       
    3::63      5e-05  37%  427 aa  PYRC_PELTS RecName: Full=Dihydroorotase;         Short=DHOase;   
   13::98      5e-05  31%  498 aa  NDDD_ALCXX RecName: Full=N-acyl-D-aspartate deacylase;       
  185::376     5e-05  28%  401 aa  HUTI_SILPO RecName: Full=Imidazolonepropionase;       
    2::385     7e-05  27%  398 aa  PYRC_CLOBB RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::72      7e-05  37%  403 aa  ATZC_PSESD RecName: Full=N-isopropylammelide isopropyl
   67::146     9e-05  42%  571 aa  URE1_STAS1 RecName: Full=Urease subunit alpha;       
   68::157     9e-05  38%  570 aa  URE1_RHOPB RecName: Full=Urease subunit alpha;       
  283::357     9e-05  36%  378 aa  PHNM_ECOLI RecName: Full=Protein phnM;
   70::146     1e-04  45%  571 aa  URE1_STAES RecName: Full=Urease subunit alpha;       
   70::146     1e-04  45%  571 aa  URE1_STAEQ RecName: Full=Urease subunit alpha;       
   37::115     1e-04  30%  447 aa  PYRC_CORGL RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::93      1e-04  33%  428 aa  PYRC_BACHD RecName: Full=Dihydroorotase;         Short=DHOase;     
   16::390     1e-04  29%  424 aa  HUTI_GEOSW RecName: Full=Imidazolonepropionase;       
    6::96      2e-04  34%  387 aa  NAGA_BACSH RecName: Full=N-acetylglucosamine-6-phosphate
  338::399     2e-04  42%  399 aa  HUTI_DEIRA RecName: Full=Imidazolonepropionase;       
   66::195     3e-04  36%  565 aa  URE1_CAMLA RecName: Full=Urease subunit beta;       
    3::74      3e-04  33%  431 aa  PYRC_THETN RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      3e-04  35%  426 aa  PYRC_LISMO RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::58      3e-04  33%  425 aa  PYRC_LACH4 RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::58      3e-04  33%  425 aa  PYRC_LACDB RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::58      3e-04  33%  425 aa  PYRC_LACDA RecName: Full=Dihydroorotase;         Short=DHOase;   
  350::410     3e-04  40%  424 aa  PYRC_CLOAB RecName: Full=Dihydroorotase;         Short=DHOase;     
    4::184     3e-04  31%  471 aa  HYDA_BACST RecName: Full=D-hydantoinase;         EC=3.5.2.-;
   99::166     3e-04  35%  167 aa  AGAA_ECOLI RecName: Full=Putative N-acetylgalactosamine-6-phosphate
    4::93      3e-04  38%  425 aa  PYRC_LYSSC RecName: Full=Dihydroorotase;         Short=DHOase;     
    3::61      3e-04  35%  426 aa  PYRC_LISMH RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      3e-04  35%  426 aa  PYRC_LISMF RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::61      3e-04  35%  426 aa  PYRC_LISMC RecName: Full=Dihydroorotase;         Short=DHOase;   
  246::392     3e-04  29%  447 aa  HUTI_BACSK RecName: Full=Imidazolonepropionase;       
    3::61      4e-04  37%  426 aa  PYRC_LISW6 RecName: Full=Dihydroorotase;         Short=DHOase;   
    3::94      4e-04  30%  430 aa  PYRC_CARHZ RecName: Full=Dihydroorotase;         Short=DHOase;     
   14::201     4e-04  25%  428 aa  PYRC_ANOFW RecName: Full=Dihydroorotase;         Short=DHOase;     
  340::382     4e-04  42%  414 aa  HUTI_RHORT RecName: Full=Imidazolonepropionase;       
  285::366     4e-04  37%  391 aa  HUTI_NOCSJ RecName: Full=Imidazolonepropionase;       
   17::102     6e-04  29%  611 aa  Y2937_MYCBO RecName: Full=Uncharacterized protein Mb2937c;
   17::102     6e-04  29%  611 aa  Y2913_MYCTU RecName: Full=Uncharacterized protein Rv2913c/MT2981;
   67::156     6e-04  39%  557 aa  URE1_SULTO RecName: Full=Urease subunit alpha;       
   61::144     6e-04  45%  569 aa  URE1_GEOKA RecName: Full=Urease subunit alpha;       
   66::136     6e-04  43%  567 aa  URE1_ECO5E RecName: Full=Urease subunit alpha;       
   67::137     6e-04  43%  568 aa  URE1_ECO57 RecName: Full=Urease subunit alpha;       
   70::146     6e-04  47%  571 aa  URE1_CORU7 RecName: Full=Urease subunit alpha;       
    3::61      6e-04  35%  426 aa  PYRC_LISIN RecName: Full=Dihydroorotase;         Short=DHOase;   
  332::370     6e-04  44%  395 aa  HUTI_RHOS4 RecName: Full=Imidazolonepropionase;       
  332::370     6e-04  44%  395 aa  HUTI_RHOS1 RecName: Full=Imidazolonepropionase;       
   70::141     7e-04  46%  572 aa  URE1_SYNJB RecName: Full=Urease subunit alpha;       
    3::91      7e-04  33%  422 aa  PYRC_UNCTG RecName: Full=Dihydroorotase;         Short=DHOase;     
    2::61      7e-04  31%  422 aa  PYRC_STRPN RecName: Full=Dihydroorotase;         Short=DHOase;   
    4::114     7e-04  26%  427 aa  PYRC_DESRM RecName: Full=Dihydroorotase;         Short=DHOase;     
 3044::3183    7e-04  28% 4538 aa  PKSL_BACSU RecName: Full=Polyketide synthase pksL;         Short=PKS;
  149::314     7e-04  27%  429 aa  ENO_ANAVT RecName: Full=Enolase;         EC=4.2.1.11;AltName:
  402::454     7e-04  47%  510 aa  ALN2_DICDI RecName: Full=Probable allantoinase 2;       
    3::92      7e-04  35%  448 aa  ALLB_BACSK RecName: Full=Allantoinase;         EC=3.5.2.5;AltName:
   67::199     0.001  30%  567 aa  URE1_PROVU RecName: Full=Urease subunit alpha;       
   67::155     0.001  38%  567 aa  URE1_PROMH RecName: Full=Urease subunit alpha;       
   69::158     0.001  36%  572 aa  URE1_BRAJA RecName: Full=Urease subunit alpha;       
    2::61      0.001  31%  422 aa  PYRC_STRR6 RecName: Full=Dihydroorotase;         Short=DHOase;   
  332::370     0.001  44%  395 aa  HUTI_RHOSK RecName: Full=Imidazolonepropionase;       
  149::314     0.001  27%  429 aa  ENO_ANASP RecName: Full=Enolase;         EC=4.2.1.11;AltName:
    1::578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
ADEC_LACS1      MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
ADEC2_DESPS     MNKEALKRLIAVAAGREEPDLVIKNAKVVDVFNARVIQGDIAIVDGLIAGVG-DYSCKNELDAEGQYAAP
ADEC2_LACSS     MDKSTLKQLIDQAAGRKPADTIIKNAKIVDVYNARIIEGTLAIADSRFLGIDAAYTADNVINAHGQYVVP
ADEC2_CARHZ     --------LVEVALGKKPADLVLKNAQVFNSFTGEFVTGDVAVVAGYIAGTG-EYEGKTTYDLQGAYVTP
ADEC_DESVH      --------LVDMAAGRAPVDLVVRNARIVDVFSQRIVEAPLAIGGGRFLGFFEA-EAHATLDAEGRYLLP
ADEC_DESVV      --------LVDMAAGRAPVDLVVRNARIVDVFSQSIVEAPLAIGGGRFLGFFEA-EAHATLDAEGRYLLP
ADEC_CLOBB      -----LKRRIKVANKEVKADTVVKNGKILNVFTGDIMRGDIAIVDGFIAGIG-QYEGEQIIYAQNKVIVP
ADEC_CLOBA      -----LKRRIKVANKEVKADTVVKNGKILNVFTGDITRGDIAIVDGFIAGIG-KYDGEQIIDAQDKVIVP
ADEC_CLOAB      ---------IEKALGIKEASLVLKNCNIVNVFSSEIIRGDLAIDGDTIIGIG-KYKGKTEIDLSNKYVAP
ADEC_DEHE1      -----LSQLIKVARGEAKADLVLLNARVVNVFNAEIEPANVAVFGGQIAGVGDYTLGNRVLDLKGAYLLP
ADEC_BACHD      ----RLERKLAIAANQDKADLLIKNGQIVDVFQLETFEGDVVIADGEIVAISGTYEAHEEVDAKGAFIAP
ADEC_BACP2      MDKELFRHQIEVAAKRKKAALVIKHAKVMDVFNQEWIDADVAVENGQIVGIG-EYEGEQELDAVGQMLVP
ADEC_OCHA4      -----LERMIDQGAGREPADIVLKGGRFFDLVTGELVESDIAICGDRIVGTFGNYQGKHEIDISGRIVVP
ADEC_KOSOT      -----IIDIIPVARGKQPADLLLKNARIVNVFSGEIERANIAIFRKRIAGIGDYSEGKQVIDLHGAYVVP
ADEC_BRUSU      --------MIDQGAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
ADEC_OCEIH      ---EQLKHRIAVASKRKPAELVIKNAEVLNVFTGDWKKTDVAIADGYIAGLG-NYEGLQTVDATGKKIVP
ADEC_BRUAB      --------MIDQGAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
ADEC_BRUA2      --------MIDQGAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
ADEC_BRUME      --------MIDQGAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
ADEC_PETMO      --------LLPIALGKEKADLVFKNGKIIDVFNEKVIEEDLAISNGVIIGFG-KYEGKEEVDLEGKFISP
ADEC_DEHSB      -----LSQLIKVARGETEADLVLLNARVINVFNAEIEQTNVAVFDGKIAGVGDYRHGKEVIDLKGAYLLP
ADEC_BACLD      MDKEMFIRRLGAASHRKKAETVIKNGKIMDVFNQEWLETDIAITDGAIVGLG-EYEGGNIIDAEGQMIVP
ADEC_DEHSC      -----LSQLIKVARGETEADLVLLNARVINVFNAEIEQANVAVFDGKIAGVGDYRHGKEVIDLKGAYLLP
ADEC_LISW6      ---KQLQERVAVSDGREKADLVIKNGRIVNVFSGEIMEGDIAIKNGYIAGIGDFSEAEQIMDAAGEFIVP
ADEC_CLOD6      ----------DVSSGREKADIVLKNGTIINVFTEELITGDVAIVGDTIVGIG-DYKGNVEIDCSNKYISP
ADEC_BACA2      MNKETLAERLNASAGRQKADTVIKNGKIMDVFNQEWISADIAITGGVIVGLG-EYEGEEVIDAEGQMIVP
ADEC1_BACSK     -------KRLAAASKQEPADILVINGKLIDVYTLTIYEASIAITDGYIVGIGDYTEGKTVIDAQGKYVCP
ADEC_LISMO      ---KQLQERVAVSDGRAKADLVIKNGRIINVFSGEIMDGDIAIKNGYIAGIGSFPDAEKIIDAAGAFIAP
ADEC_LYSSC      ---QQLTQNILSSQGKLEADFILKNAQVADVYTLTWRKADIVVKNGTIVALDHSHAKEVE-DAAGSYVIP
ADEC_LISMF      ---EQLQERVAVSDGRAKADLVIKNGRIINVFSGEIMDGDIAIKNGYIAGIGNFPDAEKIIDAAGAFIAP
ADEC1_RHIME     ---EALERLIDQGVGREPADIVLKGGRFFDLVTGELVASDIAISGERIVGTCGDYEGREEIDVTGRIVVP
ADEC_LISIN      ---KQLQERVAVSDGRAKADLVIKNGRIVNVFSGEIMEGDIAIKNGYIAGIGHFPDADQIIDAAGEFISP
ADEC_THEAB      ----KIYEIVPVALGKKMPDVLIKNVNLVNVFTGKIEKTNIALYKKRIAGIGDDYKGKEVIDAKGLFAIP
ADEC_GEOKA      ---------IAAAAKQTKADLVIQNGKIVNVFTREIIEGDLAIVEGMIVGIG-RYEGEKTIDAEGRYICP
ADEC_ARCFU      ---EKLRRIIEVARGDRRADFVVKNAQIVDLVNEEIFEGDIAVAEGFIAGIG-SYSGVEECEASNLVAVP
ADEC_DESAA      -------QVIAAARGDIPCDLVLKNAQIVNVFSGEIQKGDVAVQGGKVAALD-SRDAKITVDLEGRFLTP
ADEC_THEM4      ----KIKEIIPVALGEKTPDLLIKNVKLLNVYTGNIEKTNIAILKKRIAGIGNEYNGKEIFNAKNLYAIP
ADEC_RHISN      ---EALERFIDQGIGRKPADIVLKGGRFFDLVTGELVASDIAISGDRIVGTCGDYEGREEIDVSGRIVVP
ADEC1_RHIEC     ----KLERLIDQGVGRIPADIVLKGGSFFDLVTGEIVRSDIAIGADRIVGTSGDYRGETEIDISGRTVVP
ADEC_BACSU      MNKEALVNRLNASAKRQKADIVIKNGKIMDVYNQEWIYEDIAITDGVIVGLG-EYEGENIIDAEGQMIVP
ADEC1_AGRT5     ---------IDQGTGREPADMVLKGGRFFDLVTGELVASDIAICGDTVVGTCGDYKGRHEIDISGKIVVP
ADEC1_RHIL3     ----KLERFIDQGVGRVPADIVLKGGCFFDLVTGELVQSDIAIGADRIVGTSGNYEGETEIDISGRIVVP
ADEC_METB6      --------LIPAARGTEPADLVLKNAMLFDAFSCSWEEGDLAIKDGIIVGTGRSYRGIRERDLGGALVVP
ADEC_DESHY      MNDKDLKKLTAKSLGREKAELVLKNAQVINVFSEEILVRDVAVGDGMIVGVG-QYQGREEVDLSGKYLCP
ADEC_DESHD      MNDRNLKKLAPKSLGREKAQLVLKNAQVINVFSEEILVRDVAVEDGVIVGVG-QYQGREEVDLSGKYLCP
ADEC_CLOBL      --------LSSVAQGFEPADMVIINSRLINVCTREVIENDVAVSCGRIALVGDAKHCIGEIDAKGQYIAP
ADEC_CLOB1      --------LSSVAQGLEPADMVIINSRLINVCTREVIENDVAISCGRIALVGDAKHCIGEIDAKGQYIAP
ADEC_GLUOX      --QKTIMRRVAQGQGHEPVDLVIKNVRLFDLVTGDLIPTDIAICGDRIVGTYGEYEGVQAIDGAGRIAVP
ADEC_CLOB6      --------LSSVAQGFEPADMVIINSRLINVCTREVIENDVAISCGRIALVGDAKHCIGESTEVGQYIAP
ADEC_CLOBM      --------LSSVAQGFEPADMVIINSRLINVCTREVIENDVAISCGRIALVGDAKHCIGESTEVGQYIAP
ADEC_METMJ      ---------------------------------------DFGVKDGRIIGFG-EYRGTREYDLSGAYVVP
ADEC_SYNFM      ----RMARIIEAAQGKRVVDLCIRRCRLVNVLSGSIDTVDLAIHEGFVAG-WGSYRAAREIDADGMYVCP
ADEC_RHOSK      ---RSLSECIDQGRGLVPADLVLKHGRVFDLVTGELVQTDVAICGDRIVGTFGTYTGRREIDCRGRILVP
ADEC_RHOS1      ---RSLSECIDQGRGLVPADLVLKHGRVFDLVTGELVQTDVAICGDRIVGTFGTYAGRREIDCRGRILVP
ADEC_METTP      --------------------------KLVNVFSGEIHRADISIYGGFVAGFDPSARRVISVE--DHLIAP
ADEC_DESDG      MKNNTMNTLIGAAQDESPVDXXXXXXXXXXXXSGEIHDAHIAVKDGIVVGFE-EYEALHVVEGNGRHCIP
ADEC_LEUMM      ----------------------IKNAKILDVFNLKFDDTELWINDNQILYRGKRSDLTAENTFDGGYIVP
ADEC_METBU      ------------ATGKVKADTIFFGGLLINVNTKEMLYRDIAVKEGYIVGIGSSLKGTEMIDVTGKHLCP
ADEC_MOOTA      -------ELVAVATGKLPADTVIKGGKVVNVFTGEILPWDIAIKNGRIASVGGPETEVIDAS--GYYLCP
ADEC3_RHIME     -------RLVDVAMGRKPADLVVRNGRWVNVYSGEIVPGDIAIVGGRFAYVGPDAEGTKIVDAAGRYLVP
ADEC_RHOS4      ---RSLSECIDQGRGLVPADLVLKHGRVFDLVTGELVQTDVAICGDRIVGTFGTYTGRREIDCRGRILVP
ADEC_EDWI9      VSRSDMLRLLAVSRGDQPADLIIDNVFLLDLINGGTLPGPILISGDSIAGVGPAYAGTARIDAGGAIAVP
ADEC_METBF      ---------------------------IVDAIYRRKFKGEIAVEHGKIISIEEKEHDIEQ------YILP
ADEC_BDEBA      ------------ARGDGTLDLLITNVQMLDVITGDIYPTCIAIGGEHIVGVGMEYQTQSAWNALGAFVTP
ADEC1_OENOB     ----------------KQVYLHIFNAKILDVFNQRFEDTELWIDNGSIYFRGKSKDLTAKNNFNGNYIVP
ADEC_RHOS5      --RRSLSDLIDQGRGKAPADLVLKNGRIFDLVTGELVQTDVAICGDRIVGTFGTYEGRREIDCRGRILVP
ADEC_METS4      -------------------DLVIRDARXXXXXXXXXXXXXIAVCGDGIVGTYGEYAGTRVIEAEGRVAVP
ADEC_METMA      ---------------------------IVDAISRRQFKGEITVENGKIIRVEEKEHD------NEQYILP
ADEC_ESCF3      ISRQQRQEILAIARGEAVADYLIENVVILDLINGGEIAGPIAIKGRYIAGIGSEYNDLQRIDAHGAIAVP
ADEC_SILST      -------QLIETAAGRSPADTVIRNGKWVNVHTREVLEGDIAIKAGRIAYVGGPETEVIDAE--GRYMMP
ADEC_STAMF      ------INLIQTITGKKPADIVISNVNLVLTPTGEILNASIIISGKRIAGAGKYSENTLVIDGENNYAMP
ADEC_LEUCK      ------------------------NAKILDVFNLTFETSELWIDHDKIVGRRSDLQAQHTFDAQGQYIVP
ADEC_METTH      ------------------------SGNILNVFTGDIYPAEIEVAGGRVRSISGNFSDII---------IP
ADEC_LACPL      ----------------KTVEMVITGAQVLNVYTREFEATSLWIDHGRIISNDEPYIAAQHVDATGQWIVP
ADEC_SHISS      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECO7I      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOLU      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_ECOL5      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECO81      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOUT      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOL6      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOK1      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECO45      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOLI      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_ECOLC      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECODH      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_ECOBW      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_ECO8A      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECO55      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOSE      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECOHS      -------ELLAVSRGDAVADYLIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ECO5E      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDAHGATAVP
ADEC_ECO57      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDAHGATAVP
ADEC1_CARHZ     -------RLVDVLMNPEKATLVLKNGLVINVVTREIYPADVAVYDEYILKVGGPETEVVDLQ--GKYVSP
ADEC_SHIF8      -------ELLAVSRGDAVADYIIDNVSILDLINAGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_SHIDS      -------ELLAVSRGDVVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_RHILO      --------LVDVAMGRKPADLVIRNGRWVNVHSXXXXXXXXXXXXXXYCGPNASHQGTKVVDAGGRYLVP
ADEC_METJA      --------------------IVFKNTKIIDVYTGEVVKGNVAVERDKISFVDXXXXXXXXXXLKGKYLSP
ADEC1_JANSC     --------LVATAAGRAPADLVIRGAKVVLVQTREVMDGDVAIKHGRFAYVGGEDTQVEELS--GHYLIP
ADEC_SHIFL      -------ELLAVSRGDAVADYIIDNVSILDLINAGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_ROSDO      --------LIAVATGRMAADMLIRGGKWVNVHTREVLDGDVAIIRGRIACVTGPDTHMIRAN--GRYMIP
ADEC_ECOSM      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYTALQRIDARGATAVP
ADEC_ECO24      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_DESRM      -----LAEELRVAAGQEPADLYIKNIQIVDVYTETIFSGSLVIKNGKIVAVNPGWEVEAKEVFDGKFAVP
ADEC_METAC      ---------------------------IVDAVSRRQFKGEITVENGKILRVEEKEHD------HERYILP
ADEC_SHIBS      -------ELLAVSRGDAVADYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEYAALQRIDARGATAVP
ADEC_METS3      ------------------------SAYMLDVITDSIYPARISVEGGFFKEIVPIVNDDSELDISG-IILP
ADEC_FLAPJ      --------------------------QIVDIENKRIYSGEITIQNGKIISI-------IEKNHEVKYILP
ADEC_METNO      ----EIARRIAQGAGREPADLVIRGARLLDLVTGELVPTDIAVCGEVVVGTYGEYEGARVIEAASRIAVP
ADEC_SILPO      -------RLVAVAAGREPADMIIRNGTWINVHTREALPGSIAIAEGRIAFVGGPDTRIIEAN--GRYMIP
ADEC_SULNB      ----------------------------VDIFKREIFPAKVRVEKGKIASIE---RIDTPCD---TYILP
ADEC_METST      ---------------------MLIKGNILNVFTDEIYPGEIKIEHGII-------ESIKEVNADNDIIVP
ADEC_SHEHH      IDPQSLQHMLSVLRLEQLGDLKLTNVSLLDLINGEVIPGPILIDKGHIIAVGQEVDRVVDCH--GQIAVP
ADEC_SALRD      --------------------------RLVDLHARAIRPATVHVQDGVIARIEPA-ETVPE-----RHLLP
ADEC_PARDP      -------RLVEVAAGRAPADLVIRGGQWVNVHTREVIPGDVAVADGRVAYVGGPGTQVIEAD--GRFMVP
ADEC_DEIGD      --------------GLEAGDLLVRGAQVVQPATGEVFGADVLVAEGRVAALVGPGLGVRAARTVGAYLAP
ADEC_DEIDV      -------RLVRVARGLEEGDLLVRGARVAQPVTREILEADVLIADGRVAVLGGTGDGVVEAR--GAFLAP
ADEC_BORAP      -------------------------ANYIDIFNKEIYPASITIENGYIVSIEKIDATLDE------YVLP
ADEC_PARD8      -----------------EAKTLVIRGNLVDIINRRTFGAEISILNGHIGKVIPTGQD------EGSYLLP
ADEC2_BACSK     -------------------DTLVKNVRVYNAYTQQFIASDVAIDEGRFVAIGHSIQANTIIDGQGQQMIP
ADEC_BORBU      -------------------DLFKIEANYIDIFNKEIYPASIAIANGHIASIE-------KINATDEYVLP
ADEC_META3      --------------------IILKNANIVGVRNGTIVNGSIGINGDKIAFVXXSEAPVKIIDLKGKFVCP
ADEC_CLOP1      -----------------QVELIIKNLNVYNSYFKKFIKGDILINKGKFLHIGKGYEDRLWSENVGKYIIP
ADEC_CLOPE      -----------------QVELIIKNLKVYNSYFKKFIKSDVLINEGKFLHIGKGYEDRLWSENIDKYIIP
ADEC_ENTFA      -------------------DVLLKNVWLYQTVTQTFVQRNVAIKNDKFYYINVNLQPQKTINAENQWMIP
ADEC_KLEP3      --------------GESPFDLLLVEAQIVDMATGEIRPADVGIVGEMIASVHGSRTDAHEVSLAGGYLSP
ADEC_LACDA      -----------------KIDLLVKNAHVFNVYLRKFEDVNITIKDGKFYWINKELPGIEAADLQGKYVIP
ADEC_DEIRA      -------RLVRVALGQEDGDLLVRGAQVVQPVTREVYXXXXXXXXXXXXXXXPDLPARARVQARGAYLAP
ADEC1_DESPS     VSKDALKQLIRAGRGVIPASKVLEGGYLVNVMSNEVYLADVAIYEERIVAIGKEYKGTEVIDVTGLYLLP
ADEC1_LACSS     -------ELIQAGGAKRPADLIIKNGQLVNVMTAEIYPAEVAIYQGKIVAVDSAYQGTETRVIDAKYIVP
ADEC_KLEP7      --------------GESPFDLLLIDAQIVDMATGEIRPADVGIVGEMIASVHGSREDAHEVSLAGGYLSP
ADEC2_OENOB     -----------------KADLKIINGQIYNTFTRQFTAKEVAIVDGKFFQIADKFEDILDLK--GSYVIP
ADEC_SERP5      -ERQRAVK---AALGQLPFDLLLTNAALIDMATGEVRNVDVGIVGALIASVGTLTEALQTQDLAGAYLSP
ADEC2_RHIL3     -------RAVTAARGDAPFDMLITGGRLLDTVTGLIRQADIGLVGALISSVHASRTDAVEIDAAGSILTP
ADEC_CENSY      ---RSISRLAAVAMGDRKADLIIQNCSLVSVYTGEVIEGEIAVSGDRIAYVGPDASGTVIHNAQGRYAAP
ADEC_METKA      --------------------------RFVDPWFSGIRTGYVIWDGGRLLGVTRNEPEHADVIDVDGIICP
ADEC_RUBXD      -------ELAATARGDLPATLVIRDGTLVSVTSGEVLPGSVAVRGPRIAYVGGPQTTVIDA--AGRYIAP
ADEC3_RHIL3     -------RLADVASARREPDLVIQGARVLSTYSERFLDGEVWISGGRIAAVAGSYRGGSAKLYDGGIIAP
ADEC2_RHIEC     -------------------DMLITGGRLLDAVTGLIREADIGLVGALIASVHASRTDAVEIDATGGILTP
ADEC2_AGRT5     -------RAVAAARGDQRFDVLITGGTLVDVVTGELRPADIGIVGALIASVASRRDAAQVIDAGGAYVSP
ADEC4_RHIME     ------------SGGESKATVAVCGGRLVNVVSEEIYQADVAIYRDRIIAVGGPQTEIIDA--ADRYLTP
ADEC_MESSB      --------LADVASGRAEPDLVIKGARVLSTYSERILPDEVWISGGRIAAVAGSYRGSAATIYAGGLIAP
ADEC2_JANSC     -------RLVRVALGHVAGDTRLRVGKLLDVHSRMWLSDEIILSGRRIAYVGGSYPGGVEVHEPDLMAVP
ADEC1_BRAJA     -------RLADVASARVAPDLVVTGARVLSTYSERIHANEVWITGGRVAAVKPAWSGVALYDAAGAIIAP
ADEC2_BRAJA     --------LVLTALGHRPADRSLRVGRLLDVHSRTWSEDEIVIKGRRIAWVGGSYPGEVRERVHRPDVAP
ADEC_BRASB      -------RLADVASGRVAPEFVITGARVLSTYSERILPNELWITGGRVAAVAGAHKGFAIYDAADGIIAP
ADEC2_RHIME     ---------------------------------------DVGIVGALIASVGSRSDADTVIDAAGAYISP
ADEC1_BRASO     --------LVLTALGHRPADRALRVGRLLDVHSRTWSEDEIVFKGRRIAWVGGSYRGEVRERVQRPDLAP
ADEC2_BRASO     -------RLADVASGRVAPDLVITGARVLSTYSERILRDELWITGGRVAAVAGAHKGFTIYDAAGGIIAP
Y1085_PICTO     -----IYKIIKVSKFDEPADLIIEDASYIDIYTKRISSGNIAIASGRIAYIGDEMPRIIKNDFL---IAP
Y637_BACHD      --KKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAVVDCGQ--QVIVP
YERA_BACSU      ---------VDVVDSKLLPTLLLRNALVLNPYVKQWLKKNIWIYQDRIVYVGHELPNRAEEIHTGKYIVP
Y751_OCEIH      -ELRQHVKVID---GTVSPTLLLKNATYLNVHTKQWLEANIWIYKDRIIYVGEKLPNVYDCE--GRFVVP
Y3012_BACCR     ---KQLREHVEVLDGKRSTHILLKNATYLNSYMREWMTANIWIYNDRIVYVGEQLEQLTECEVVGKYVVP
Y3032_BACAN     ---EQLREHVEIIDGTRSPHKLLKNATYLNSYIREWMQANIWIYDDRIIYVGEKLPEVIDCD--GKYVVP
HUTI_DEIDV      ----------------------------------------------------------------------
PYRC_GEOLS      -------------------NLLIKGGRVIDPSQGIDDTLDVVVENGLVKEIGATSAGAETIDASGKYVVP
ALLB_ECOUT      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECOL6      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECOL5      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECOK1      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECO81      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECO45      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
ALLB_ECO27      -------------------DLIIKNGTVILENEARVV--DIAVKDGKIAAIGGDAKDVMDAS--GLVVSP
PYRC_GEOBB      -------------------NLLIKGGRVIDPSQGIDANLDVLIADGVVLELGAAPEGTPAIDASGLIVTP
ALLB_SALTY      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALTI      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALPK      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALPB      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALPA      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALNS      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALHS      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALEP      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALDC      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
ALLB_SALA4      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGGEAKNVLDA--TGLIVSP
PYRC_GEOSM      -------------------NLLIKGGRVIDPSQGIDANLDVLIADGVVLELGAAPEGTPAIDAGGLIVTP
PYRC_CLOD6      --------------------ILIKNGRVIDPKSQRDENIDLIIKENKIYKIGDEYEKIIDAS--GNVVAP
ALLB_ENTFA      -----------------QAELVIKNGLVI-LETGEVIT-DVAVQGGKIVAIGQDLSGERVIDATGLVVSP
URE12_PSYCK     --------------GEQVADTIITNALIVDY--SGIYKADIAIKEGRISGIGKAGNPDIQPNVTGKILTA
ALLB_SALCH      -------------------DLIIKNGTVILENEARVI--DIAVQGGKIAAIGENLEEAKNVDATGLIVSP
PYRC_THEPX      --------------------MIIKNGTVIDGFGSEA-TADILIDYGIIKAIDKNIQGIV-IDATGKYVLP
PYRC_THEP3      --------------------MIIKNGTVIDGFGSEA-TADILIDYGIIKAIDKNIQGIV-IDATGKYVLP
PYRC_ANATD      --------------------ILIKNAQIVNSIDNKLEKADILIVDDKIEKIGKNIEEMIIIDTSGKYVMP
HYDA_RHIRD      -------------------DIIIKNGTIVTA--DGISPADLGIKDGKIAQIGGTFGPAGRTDASGRYVFP
ALLB_ECOSE      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOLU      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOLI      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOLC      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOHS      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECODH      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOBW      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECO8A      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECO55      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECO24      -------------------DLIIKNGTVILENEARVV--DIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
ALLB_ECOSM      -------------------DLIIKNGTVILENEARVV--DVAVKGGKIAAIGQDLGDAKEVDASGLVVSP
PYRC_SOLUE      --------------------IVIRNGRVIDPASNTDRVADVFIVDGRIAGVAPNLSSAEVFDATGMIVAP
PYRC_CLOCE      --------------------LLIKNGHVLDVKTGLDRVTDILAVDGIIHEVGSKIDGCEVIDATGLYVTP
HUTI_SILST      ------------------------------------IQGDEILWCGARGALPDTYAACPSTDLNGRLVTP
DPYS_SACKL      -------------------DLIIKNGIICTA--SDIYAAEIAVNNGKVQLIAASIDGSEVIDAEGAFITP
PYRC_LACS1      -----------------------------NLYQARIYQADVLIEDGKIKAIGKNLSDVVEIDATNKLVAP
URE1_BACHD      -------------------DLIITNATIIDY--TGIVKADIGIKDGHIVGIGGGNPDIMDIAGEGLIVTA
PYRC_LACAC      ---------------------VIKNGTVYQ--NGRLIHADVLIEDQKIKVIGTNLTGDKEFDATGKLVAP
PYRC_CLOBA      -------------------ELLIKNARIIDAIQD--FKGDIYIKDGVINEIAKNKDNVEVLNCEEKILMP
HYDL_ARTAU      -------------------DVIVKNCRLVS--SDGITEADILVKDGKVAAISADTSDV-EASRTGKFVMP
HYDA_BURPI      -------------------DIIIKNGTIVTA--DGISRADLGIKDGKITQIGGAL-GPAEIDAAGRYVFP
ALLB_BACSU      -------------------DMVIKGAKAVT--PDGVIEADIVVQNGVIAEIGSDIEGTEIIQADGKYVFP
URE1_STAAW      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAT      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAS      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAR      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAN      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAM      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAE      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAC      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAAB      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAA9      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAA8      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAA3      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAA2      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
URE1_STAA1      ------------------ADLVISNAVIID--YDKVVKADIGIKNGYIFAIGGSTTDIIAAE--GKIVTA
PYRC_PELTS      --------------------LLIKGGTVVDPVAGKIEEKDVFIVDGKIARAGAHVNGAEVLDASGKLVVP
NDDD_ALCXX      -----------------QADFIIAGATLIDGGGGPARQGDLAVRGGRIVALGAHAPGVPVIDARGLALAP
HUTI_SILPO      ----------------------------------------------------------------------
PYRC_CLOBB      -------------------ELLIKNARIIDAIQD--FKGDIYIKDGVINEIAQEIKNVEVLNCEEKILMP
ATZC_PSESD      ----------------KDFDLIIRNAYLSE----KDSVYDIGIVGDRIIKIEAKIEGTVEIDAKGNLVSP
URE1_STAS1      ---------------KQVADLVITNAMIID--YDKIVKADIGVKNGYIMKIGGATTDIISAE--GKIVTA
URE1_RHOPB      ------------------ADTVITNALIVDHWG--IVKADVALKDGYIAAIGKAGNPDIQPGVTGKILTA
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      ------------------ADLVLTNALIID--YDKIVKADIGIKNGYIFKIGKAGNPDIMDNXEGKIVTA
URE1_STAEQ      ------------------ADLVLTNALIID--YDKIVKADIGIKNGYIFKIGKAGNPDIMDNXEGKIVTA
PYRC_CORGL      ---------------------------------------NVFVKDGVIAAIGGTHEADRTIDGNGGVLLP
PYRC_BACHD      ---------------------LIKNGSIVTK-EGTVKTQDVLLHDGVISAIGLNLEEVIEAN--GKLVTP
HUTI_GEOSW      -------------AGSSTAPLVKEKMNELHIIE----NGSVWVEDGKIAAVGTDQERIAEAEITGKTVTP
NAGA_BACSH      --------------------LIIRNITVVNA-SGRDEQMDVWMKDGKIAQIAQHIQGVDQLEGSGKFLLP
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      -------------------DLVLTNALIVDY--TGIYKADIGIKNGYIVGIGKAGNPDIQIGAEGLIVTA
PYRC_THETN      --------------------IVIKNGIVIDGFGGEE-KADILINYGIIKGIDKNIDDAIVIDAEGKYVLP
PYRC_LISMO      ---------------------VLKNGQVLNA-SGKLESKDVLIQNGKVNLIADSIEVTSEFDATGKLITP
PYRC_LACH4      ---------------------VIKNGTVYQ--NGRLIHADVLIEDQKIKAIGTDLTGDKVIDATGKLVSP
PYRC_LACDB      ---------------------VIKNGTVYQ--NGRLIHADVLIEDQKIKAIGTDLTGDKVIDATGKLVSP
PYRC_LACDA      ---------------------VIKNGTVYQ--NGRLIHADVLIEDQKIKAIGTDLTGDKVIDATGKLVSP
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      ---------------------LIKNGTIVDIYEA-----DLLIQDGKIAVIGRNLDGAEVIDATGCYVFP
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      ---------------------VLRNVQMLNE-QGELQTVNIAMADGKITAIGQEVTEVIEGN--GLIVAP
PYRC_LISMH      ---------------------VLKNGQVLNA-SGELENKDVLIQNGKVNLIADSIEVTSEFDATGKLIAP
PYRC_LISMF      ---------------------VLKNGQVLNA-SGELENKDVLIQNGKVNLIADSIEVTSEFDATGKLIAP
PYRC_LISMC      ---------------------VLKNGQVLNA-SGELENKDVLIQNGKVNLIADSIEVTSEFDATGKLIAP
HUTI_BACSK      ----------------------------------------------------------------------
PYRC_LISW6      ---------------------VLKNGQILNE-SGELENKDVLIQNGKVNLIADSIEVTSEFDATGKLIAP
PYRC_CARHZ      --------------------MLIKNGNVVMVEDGKIRKMDVLIDKGIIVEISPEINDVEVIDIEGKFLIP
PYRC_ANOFW      --------------------------------QGELIQTDIKVAGGRIVQIAHDLHAEADIDVDGQFVAP
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     -------------------DVIIRDGLWFDGTGNAPLTRTLGIRDGVVATVAAGALDETGCDAAGKWVVP
Y2913_MYCTU     -------------------DVIIRDGLWFDGTGNAPLTRTLGIRDGVVATVAAGALDETGCDAAGKWVVP
URE1_SULTO      -------------------DLIITNVVILDPLLG-VIKADIGIKDGLIVGIGGSSTEII--SGEGLIATP
URE1_GEOKA      -----------LATRDEAVDLVLTNAVIVDY--TGIYKADIGIKDGNIAAIGGASTEVIAAE--GKIVTA
URE1_ECO5E      ------------------ADLVLTNALIIDYW--GIVKADIGVKDGRIFAIGKAGNPDIQPNVTGRIVTA
URE1_ECO57      ------------------ADLVLTNALIIDYW--GIVKADIGVKDGRIFAIGKAGNPDIQPNVTGRIVTA
URE1_CORU7      -------------------DTVITNAIIVD--HTGIYKADIGIRDGLIEGIGRAGNGVNTEAYAGEHVTA
PYRC_LISIN      ---------------------VLKNGQVLNE-SGELENKDVLIQNGKVNLIADSIEVTSEFDATGKLIAP
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      -------------------DLVITNALILDWWG--IVKADVGIRDGYIVGIGKAGNPNIQAGVTGMVVGP
PYRC_UNCTG      --------------------LQIKDIKIIDPLQNRDLIGDIFVENGRIVSFLGDADKVVDGR--GKIAVP
PYRC_STRPN      --------------------LLIKNGRVMDPKSGLDQVCDVLVQDGKIIKIASEIEGAETIDATGLVVAP
PYRC_DESRM      ---------------------LIKGGIVVDPVADTLTCTDILVEEGMIKEIGQLSDSEAEVIAAGNYVCP
PKSL_BACSU      ----------------------------------------------------------------------
ENO_ANAVT       ----------------------------------------------------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      -------------------DLCITGGRVV--LPSGVEETDVGIQAGKIARIGPINKKEARCNANGQYVFP
URE1_PROVU      -------------------DVLITNAIIIDHWG--IVKADIGIKDGRITGIGKAGNPDVQPNVEGKIITA
URE1_PROMH      -------------------DVLITNAIILDYWG--IVKADIGIKDGRIVGIGKAGNPDVQPNVEGKIVTA
URE1_BRAJA      ------------------ADTVITNALIVDHWG--IVKADVAIKDGMISAIGKAGNPDIQPGVTGKILTA
PYRC_STRR6      --------------------LLIKNGRVMDPKSGLDQVCDVLVQDGKIIKIAPEIEGAETIDATGHVVAP
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
ADEC_LACS1      GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
ADEC2_DESPS     GFIDSHIHIESSYVSPEELGRLLVPHGTTTIIADPHEIANVCGLKGLDYMIEAAKRTALDVQMMLPSCVP
ADEC2_LACSS     GLIDPHIHIESANVSPAVFGSLVTPHGTTTILADPHEIVNVAGMRGLEYMVASAKNTALDIKYTMPSCVP
ADEC2_CARHZ     GFIDGHVHIESSMVAPAEFARALVPAGTLTAVVDPHEIANVSGTAGIRYMLEASSNLPINIYLMLPSCVP
ADEC_DESVH      GLIDGHVHIESSLVSPAQFARLVLARGTTAVIADPHEIANVCGLAGLRYMLDATRDLPLDVRLALPSCVP
ADEC_DESVV      GLIDGHVHIESSLVSPAQFARLVLARGTTAVIADPHEIANVCGLAGLRYMLDATRDLPLDVRLALPSCVP
ADEC_CLOBB      GFIDGHMHIESTMLTPNELSKVLIQHGVTTVMADPHEIGNVAGIDGINFMLNASEELPIDVFIMLPSCVP
ADEC_CLOBA      GFIDGHMHIESTMLTPNELSKVLIQHGVTTVMADPHEIGNVAGIDGINFMLNASEKLPIDVFIMLPSCVP
ADEC_CLOAB      GFIDSHVHIESSMVSPKEFARAVISRGTTTIIVDPHEIANVCGMDGIKYMMEETKNMPLDVFFMLSSCVP
ADEC_DEHE1      GLINGHTHVESSMLDISQYARAVIAHGTSALITDLHEISNVCGKEGIDYVLSASADLPLNIFLQVPSCVP
ADEC_BACHD      AFIDGHVHIESSMVAPEQFAKVVVPHGVTTVIADPHEIANVAGVQGVEYMLDASEGIPLDVKMMVPSCVP
ADEC_BACP2      GFIDGHVHIESSMVTPAEFSKAVVPHGVTTVVTDPHEIANVSGITGIRFMLEEAKKAALHIYFMLPSCVP
ADEC_OCHA4      GFIDTHLHIESSHVTPHEFDRCVLPQGVTTVICDPHEIANVLGAEGIKFFLDSALETVMDIRVQLSSCVP
ADEC_KOSOT      GLIDAHLHIESSMVSPVEFAKTVLPRGTTTVIADPHEIANVLGLDGVEYLIKSTEGVPLNLYIMLPSSVP
ADEC_BRUSU      GFIDTHLHIESSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETVMDIRVQLSSCVP
ADEC_OCEIH      GLINGHIHIESTMLTPREFSKVMLKHGVTTAITDPHEIANVAGTDGLEYMLNASDALPMNIFVNMPSSVP
ADEC_BRUAB      GFIDTHLHIASSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETVMDIRVQLSSCVP
ADEC_BRUA2      GFIDTHLHIASSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETVMDIRVQLSSCVP
ADEC_BRUME      GFIDTHLHIASSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETVMDIRVQLSSCVP
ADEC_PETMO      GFIDAHLHLESAMVTIEEFAKTVIPLGTLTLVADPHEIANVAGKVGIKYFLTIGNNIPWNFNLMVPSCVP
ADEC_DEHSB      GLINGHTHVESSMLDIAQYARAVVSNGTLALITDLHEISNVCGKEGIDYVLDASADLPLSIFLQVPSCVP
ADEC_BACLD      GFIDGHVHIESSMVTPPEFAKAVIPHGVTTVVTDPHEIANVSGVKGLEFMLEQAEMTRLNIYFMLPSCVP
ADEC_DEHSC      GLINGHTHVESSMLDIAQYARAVVSHGTLALITDLHEISNVCGKEGIDYVLDASADLPLSIFLQVPSCVP
ADEC_LISW6      GFIDAHVHVESAMVTPAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLPSSVP
ADEC_CLOD6      GFIDAHMHIESTMVMPIELSKKLLKSGTTTIIADPHELVNVKGVSAIDFLLESTKDIPLNVYIMVPSSVP
ADEC_BACA2      GFIDGHVHIESSMVTPIEFAKAVLPHGVTTVITDPHEIANVSGAKGISFMIEQAKKAPLNIRFMLPSCVP
ADEC1_BACSK     PLIDGHVHIESAMVRPEDFAGVLVPKGVLTAIADPHELANVAGVEAVTYMVEAAKDLPLDIKMAVPSSVP
ADEC_LISMO      GFIDAHVHVESAMVTPAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLPSSVP
ADEC_LYSSC      GLIDGHIHIESSMLTPGEFSRVLIPHGITTVITDPHEIANVAGAEGIQFMLDDAQKADMDIFVMLPSSVP
ADEC_LISMF      GFIDAHVHVESAMVTPAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGVPIDMFVMLPSSVP
ADEC1_RHIME     GFIDTHLHIESSLVTPHEFDRCVLPLGITTVVCDPHEIANVLGTEGIQYFLDSAMETVMDIRVQLSSCVP
ADEC_LISIN      GFIDAHVHVESAMVTPSEFARVLLPNGVTTIITDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLPSSVP
ADEC_THEAB      GLIDAHVHIESSMLSPTEFAKLILPFGTTTIIADPHEIANVLGVEGIEYMIKSTEGIPLNVYFAIPSAVP
ADEC_GEOKA      GLIDGHVHIESSMVPPSEFARVVLPHGVTTVIADPHEIANVAGVCGIQFMLDEAKRTPLDVYMMLPSCVP
ADEC_ARCFU      GLIDAHTHIEMSMLTVSEFARLVVPRGTTGVVADPHEIANVLGKDGVMLMLEEARSTPLRFYCMVPSCVP
ADEC_DESAA      GLIDAHVHIESSMVSPYQYARTVILHGTTAVIADPHEIANVMGVDGVSYMIQAAEGAPVGIFYAVPSCVP
ADEC_THEM4      GLIDAHVHIESSMLSPIEFAKMILPNGTTTIIADPHEIANVLGVEGINYMIKATEGIPLNVYFAIPSAVP
ADEC_RHISN      GFIDTHLHIESSLVTPHEFDRCVLPLGITTAICDPHEIANVLGTEGIQFFLDSAMETIMDIRVQLSSCVP
ADEC1_RHIEC     GFIDTHLHIESSLVTPHEFDRCVLPYGVTTAICDPHEIANVLGTEGIEFFLESALETIMDIRVQLSSCVP
ADEC_BACSU      GFIDGHVHIESSMVTPIEFAKAVLPHGVTTVVTDPHEIANVSGEKGIEFMLEQARHTPLNIHFMLPSSVP
ADEC1_AGRT5     GFIDTHLHIESSLVTPHEFDRCVLPYGVTTAICDPHEIANVLGAEGLQFFLDSAMETIMDIRVQLSSCVP
ADEC1_RHIL3     GFIDTHLHIESSLVTPHEFDRCVLPYGVTTAICDPHEIANVLGAAGIEFFLESALETIMDIRVQLSSCVP
ADEC_METB6      GLIDAHVHIESSLLVPQEYAHLVAAHGTTTVIADPHEIANIAGKEGIEYMLACRAGLPVDILYMLPSCVP
ADEC_DESHY      GFIDAHLHLESTLVAPPELIHSALQWGTTTFIIDPHEVVNVAGEEGLDYMLEQTEGLAANVFVMLPSCVP
ADEC_DESHD      GFIDAHLHLESTLVAPPELIHSALQWGTTTFIIDPHEVVNVAGEEGLDYMLEQTEGLAANVFLMLPSCVP
ADEC_CLOBL      GFLDGHIHVESSMLSVSEYARSVVPHGTVGIYMDPHEICNVLGLNGVRYMIEDGKGTPLKNMVTTPSCVP
ADEC_CLOB1      GFLDGHIHVESSMLSVSEYARSVVPHGTVGIYMDPHEICNVLGLNGVRYMIEDGKGTPLKNMVTTPSCVP
ADEC_GLUOX      GFIDTHLHVESSLVTPFEFDRCVLPHGVTTAICDPHEMANVLGRAAFDYFLAAAERTIMDLRVNLSSCVP
ADEC_CLOB6      GFLDGHIHVESSMLSVSEYARSVVPHGTVGIYMDPHEICNVLGLNGVRYMIEDGKGTPLKNMVTTPSCVP
ADEC_CLOBM      GFLDGHIHVESSMLSVSEYARSVVPHGTVGIYMDPHEICNVLGLNGVRYMIEDGKGTPLKNMVTTPSCVP
ADEC_METMJ      GLIDAHVHIESSLLAPAEYARLVLAHGTTTVIADPHEIANVCGAPGIDYMLAQGARTPLDILVMLPSCVP
ADEC_SYNFM      GFIDGHIHIESTLLAPAQFCAAAVPQGTAAVVADPHEIANVLGLSGIRYFLEASEGLPLDFFFNLPSCVP
ADEC_RHOSK      GFIDTHLHVESSLVTPFEFDRCVTPRGITTAICDPHEIANVCGLEGIRYFLEASAHLVMDLRVQLSSCVP
ADEC_RHOS1      GFIDTHLHVESSLVTPFEFDRCVTPRGITTAICDPHEIANVCGLEGIRYFLEASAHLVMDLRVQLSSCVP
ADEC_METTP      GSIDAHVHIESSMLMPSEYARAVVPRGTLTVIADPHEIANVLGVDGISYLLRCAEGIPMRFLVTAPSCVP
ADEC_DESDG      GLIDGHIHIESTLLSPXXXXXXXXXXXXXXVMCDPHEIANVMGAEGIEYMLHASAGLPLSVYVMMPSCVP
ADEC_LEUMM      GLIDSHLHIESSLLTPSEFGKLVIPHGITRIFADPHEIASVAGVSGIQYMLEDAKQTPLNIHYMLPSSVP
ADEC_METBU      GLMDGHVHFESSMVTLSQFAVPALAHGTTSVVIDPHEIANVLGRGGIELVLDEAATLPLNAFVAVSSCVP
ADEC_MOOTA      GFMDGHVHVESSMVTVTQFARAVLPGGTTAIFMDPHEIANVLGMDGVKLMVDEGRELPLKVFATMPSCVP
ADEC3_RHIME     GLCDGHMHVESGLVTVTEFARAVIPHGTTTMFVDPHEIANVLGIAGVKLMNDEAQTLPVNIFVQVPSCVP
ADEC_RHOS4      GFIDTHLHVESSLVTPFEFDRCVTPRGITTAICDPHEIANVCGLEGIRYFLEASAHLVMDLRVQLSSCVP
ADEC_EDWI9      GFIDAHLHIESSMMTPIAFESVTLPLGVTTIVCDPHEIVNVMGEKGLTWFLRCAEGAQQNQFIQISSCVP
ADEC_METBF      GLVDAHVHIESSMTVPSVFARMAVARGTVAVVSDPHEIANVMGEEGIDYMLEDARKAPLKVFFGVPSCVP
ADEC_BDEBA      GFIDGHLHIESSMMSPFEFEKATLPLGTTTAICDPHEITNVLGGRGFSWFLRSSELMHQNLFVQMSSCVP
ADEC1_OENOB     GLIDAHLHIESSLLAPSELAKLELRHGVTSIFADPHEIGSVSGVSGLFYMIQEARNTPLHIHYMLPSSVP
ADEC_RHOS5      GFIDTHLHVESSLVTPFEFDRCVTPRGITTAICDPHEIANVCGLEGIRYFLEAAEHLVMDLRVQLSSCVP
ADEC_METS4      GFIDTHLHVESSLITPHEFDRCVLPHGVTTAIWDPHELANVLGTAAFDYALQAARETVMDIRVQLSSCVP
ADEC_METMA      GLVDAHVHIESSMTVPSVFARMAVAKGTVAVVSDPHEIANVMGEEGIEFMLEDSKKSPLKVYFGVPSCVP
ADEC_ESCF3      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_SILST      GLCDGHMHIESGMLTPAEFARAVIPHGTTTMFTDPHEIANVLGLEGVRLMHDEALLQPVNIYTQMPSCAP
ADEC_STAMF      GFIDPHIHIESSLLTPHGFAKLALRHGTTTVVADPHEIGNVLGSRGVEIFMDAARNLPLKILIDIPSCVP
ADEC_LEUCK      GLIDAHMHIESSLLAPSEFSKLVVPHGITRVIADPHEIASVAGVSGIQYMLEEARQSQLHIHYMLPSSVP
ADEC_METTH      GFIDAHLHIESSMLIPSSFAAAAIPHGTVSAISDPHEIANVMGVDGVRFMIDDAAATPMKFYFTAPSCVP
ADEC_LACPL      GMIDAHVHMESSMVAPSELGKVLLQHGVTTIATDPHELANVAGIAGIQYLIDDARQTPLDVCFMLPSSVP
ADEC_SHISS      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO7I      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOLU      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOL5      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO81      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOUT      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOL6      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOK1      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO45      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOLI      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOLC      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECODH      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOBW      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO8A      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO55      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOSE      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECOHS      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO5E      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO57      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC1_CARHZ     GFIDSHMHFESSMLTISEFSRLSIPSGTTTLVADPHEIGNALGPVGIKAMAEETKVVPNRVYLVVPALTP
ADEC_SHIF8      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_SHIDS      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAKQARQNQYLQVSSCVP
ADEC_RHILO      GLCDAHMHVESGMVTVTEFCRAVIPHGTTSMFIDPHEIANVLGLPGVRLMHDEAVAMPINVHVQMPSCVP
ADEC_METJA      TFIDGHIHIESSHLIPSEFEKFVLKSGVSKVVIDPHEIANIAGKEGILFMLNDAKI--LDVYVMLPSCVP
ADEC1_JANSC     GLCDGHMHIESGMLTPAEFTRAVIPHGTTSMFTDPHEIANVFGLRGVRLMHDEALLQPINVFTQMPSCAP
ADEC_SHIFL      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ROSDO      GLCDGHMHIESGMLTPAEFARAVIPHGTTSMFTDPHEIANVLGLEGVRMMHDEALMQPVNIFTQMPSCAP
ADEC_ECOSM      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_ECO24      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_DESRM      GFMDAHIHIEPTLLSPEALASVIVPWGTTTLFADPMEIANVAGLKGVEALLNNTENLPYQIYIEVPSRVP
ADEC_METAC      GLVDAHVHIESSMTVPSVFARMAVAKGTVAVVSDPHEIANVMGEEGIDFMLGDSKRSPLKVFFGVPSCVP
ADEC_SHIBS      GFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVP
ADEC_METS3      GFIDSHIHIESTMLTPAQFAKLAVRFGTTSVVCDPHEIANVAGTDGIDFMIENSKSVPFNFYFSIPSCVP
ADEC_FLAPJ      GFIDAHIHIESSMLVPSEFAKIAVLHGTVATISDPHEIANVLGKKGVYYMIENGKQVPLKFHFGAPSCVP
ADEC_METNO      GFIDTHLHIESSLITPHEFDRCVLPHGVTTAIWDPHELANVLGTAAFDYALQASTETAMDIRVQLSSCVP
ADEC_SILPO      GLCDGHMHIESGMLTPAEFAAAVIPHGTTTMFTDPHEIANVLGLAGVRMMHDEALMQPVNIFTQMPSCAP
ADEC_SULNB      GFVDAHIHIESSMLPPSEFARLAVCHGTVATVSDPHEIANVLGIPGVGYMLDNSEMTPFKFYFGASPCVP
ADEC_METST      GFIDAHIHIESSMLTPSRFAEIALRHGTTSVIADPHEIANVXXXXXXXXXXXXAKKTPLKYYFTAPSCVP
ADEC_SHEHH      GFIDAHMHVESSTMTPFEFERTTLPLGTTSIVCDPHELVNVMGRQGIDWFLRCSETMHQNMFVQISSCVP
ADEC_SALRD      GFIDAHVHVESAMLPPSEFARAAVRHGTVGTVSDPHEIANVLGVEGVEYMIADGRPVPFHFAFGAPSCVP
ADEC_PARDP      GLIDAHMHVESGMLTPAGFAAAVIPHGTTTIFHDPHEIANVLGLEGVRLMRDESLLQPISMFTQMPSCAP
ADEC_DEIGD      GFLDAHIHIESSLLTPARFAAAVLPRGTTAVVAEPHETVNVMGLSGLRWMLEAGKGSGLRVFGSVPSSVP
ADEC_DEIDV      GFIDGHVHIESSLLTPAGFARAVLLRGTTGVVAEPHEVVNVLGPQGLEWMLEAGRRSGLRVWASAPSCAP
ADEC_BORAP      GFIDAHIHIESSFLIPSNFAHLVVQHGTVATISDPHEIANVNGIDGINFMINNSKKTEFKIFFGAPSCVP
ADEC_PARD8      GFIDAHVHIESSMVTPAAFIHAAVRHGSIGAVADPHEIANVMGTEGVEYMLDNAKGIPFYTWFGVPSCVP
ADEC2_BACSK     GLIDIHLHIESSMVTPETFSWALLRNGVTTIVAEPHEMANVFGIEGIKAMIEASAACTVDMKYAIPSSVP
ADEC_BORBU      GFIDAHIHIESSFLVPSNFAHLVVAHGTVATISDPHEIANVNGIDGINFMINNSKKTEFKFFFGAPSCVP
ADEC_META3      TFIDAHIHIESSHITPSEFEKYALKYGVSKVIIDPHEIANVVGVNGIKFMLNDAK--LLDVYCMVPSCVP
ADEC_CLOP1      GLIDIHMHIESSMTIPREFSKAAIKHGVTTVVADPHEIANVFGIRGIEEFIKFKGNLDIFYGIXXXXXXX
ADEC_CLOPE      GLIDIHMHIESSMTIPREFSKAAIKHGVTTVVADPHEIANVFGVRGIEEFIKFKGNLDIFYGIXXXXXXX
ADEC_ENTFA      GLIDAHMHIESSMTTPTIFSKAVVRYGVTTVIADAHEMANVFGLEGLKAFM--AAETELDIFHAIPSSVP
ADEC_KLEP3      GLMDTHVHLESSHLPPERYAEIVLTQGTTAVFWDPHELANVLGVEGVRYAVDASRHLPLQVMVAAPSSVP
ADEC_LACDA      GFVDAHMHIDSSMTTPKVMGQTIGKYGTTTIIADDHEITNVAGVKGLKDFID--EKAPIDIFFGIPSSVP
ADEC_DEIRA      GFIDGHIHIESSLLTPASFAAAVLPHGTTAVVAEPHEIVNVLGPAGLNWMLGAGRTSGLRVYASAPSCVP
ADEC1_DESPS     GLIDGHLHSECSKLSITSFAKAVVPCGTTSIVSGLDEYISVSGLEGLQEVFKEVKKSPLKVFWGAPYKTP
ADEC1_LACSS     GLIDGHIHVECSKLSMTSFAEAVVPHGTTSIISGLDEYISVIGVDGLSEIFKEVDQLPMRVFWGAPFKTP
ADEC_KLEP7      GLMDTHVHLESSHLPPERYAEIVLTQGTTAVFWDPHELANVLGVAGVRYAVDASRHLPLQVMVAAPSSVP
ADEC2_OENOB     GLIDSHMHIESSMATPTNFSETAIRFGTTTVIADAHEIANTSGIKGLKRFMD--QPSLIDTFFAIPSSVP
ADEC_SERP5      GLIDTHVHVESSHLPPERYAEIVVAQGTTTIFWDPHELANVLGVAGVRYAVDASRGLPLRVICAAPSSVP
ADEC2_RHIL3     GLIDTHMHIESSMVTPAEYASAVLPRGVTTIVWDPHEFGNVHGLDGVRWAIEAARSLPLRMILLAPSCVP
ADEC_CENSY      GFADPHIHVDQ-FVTPAELAAQSVLHGTTSLFSDPIDMVGVAGYRGFRTLMNMSKDLPARFFHVVPGGLP
ADEC_METKA      GFVDAHVHVESSGLRPARYAEIVVREGTTAVVWDPHEVVNVSGELGLEWAVKTAEEALPFKFYILPSCVP
ADEC_RUBXD      GFLDGHCHIESSQITVTQFARAVLPLGTTGGFFDAHEITNVLGLRGLRLMLDEARSTPLAAYLEVASCVP
ADEC3_RHIL3     GLVDPHIHIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDVAGVEAMLEDARQAPLSIFLTVPSTVP
ADEC2_RHIEC     GLIDMHMHVESSMVTPAEYASAVLPHGVTTVVWDPHEFGNVQGLDGVRWAIEAARTLPLRMILLAPSCVP
ADEC2_AGRT5     GLIDTHMHIESSMITPXXXXXXXXXRGVTTIVWDPHEFGNVHGVDGVRWAAKAIENLPLRAILLAPSCVP
ADEC4_RHIME     GMIDGHLHVECSKLSLTSFAKAVLPLGTTSIVSGLDQIIVVGGPDAAREFLDEVRQTPLKVFWGAPCKTP
ADEC_MESSB      GLVDPHIHIESSMVTACSYAEAALLNGTTTIFCDSHEIGNVMDVAGVEAMLEDARQAPSSIFLTVPSTVP
ADEC2_JANSC     GFGEVHKHIESSHVTPEWEAALVLPHGNTWTCEASHEFSNVNGPHNLEFWLTARLAGSPQKIFPLPSAVP
ADEC1_BRAJA     GLVDPHIHIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDVAGVEAMLEDARQAPLSIFLTVPSTVP
ADEC2_BRAJA     GFGEVHKHIESSHLTPEWEAALVLPHGNTWTCEASHEFSNVNGARNLEFWFEARRRGSPLKIFPQPSAVP
ADEC_BRASB      GLVDPHIHIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDVAGVEAMLEDARQAPLSIFLTVPSTVP
ADEC2_RHIME     GLIDTHMHVESSMXXXXXXXXXXXXRGVTTVVWDPHEFGNVSGLAGVRWAVDAMGGLPLRAVVLAPSCVP
ADEC1_BRASO     GFGEVHKHIESSHLTPEWEAALVLPRGNTWTCEASHEFSNVNGARNLEFWFEARRRGSPQPGSAVPPTXX
ADEC2_BRASO     GLVDPHIHIESSMVTACAYAEAALLNGTTTIFCDSHEIGNVMDTAGVEAMLEDARQAPLSIFLTVPSTVP
Y1085_PICTO     GYIEGHAHPFQIY-NPVTFNEIMIRHGTSMVISDDLPIYIKMGLK----------NIKRFMRFMGR--LP
Y637_BACHD      GYIEHHAHPFQLY-NPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSM-YWWCRYDP
YERA_BACSU      GYIEPHAHPFQIY-NPQTLAEYVSQYGTTTFVNDNLFLLLQSGKKKALTILNELK--KQPVQYFWWSRYD
Y751_OCEIH      GYIEPHAH-PFQLANPEITAMHAAKTGTTTLVNDNLTWYLLTNKKKAFSIIDQFNKLPISM-FWWSRYDS
Y3012_BACCR     GYIEPHAHPYQLY-NPETLANHAMQFGTTTFINDNLTLFFTLKREEAFRLLDEFNKIPASM-YWWCRFDG
Y3032_BACAN     SYIEPHAHPYQLY-NPETLANHAMQFGTTTFINDNLTLFFTLKREESFHLLDEFTKIPASM-YWWCRFDG
HUTI_DEIDV      ----------------------------------------------------------------------
PYRC_GEOLS      GLIDMHVHLRDPGLEYKEGTRAAVAGGFTSVCCMPNTKPAIDNKAIASYIINKAK---------------
ALLB_ECOUT      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOL6      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOL5      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOK1      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO81      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO45      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO27      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
PYRC_GEOBB      GLIDMHVHLRDPGLEYKEGSRSAAAGGFTSVACMPNTSPVIDSKAIASYIINKAKSEAL-VNVFPIGCIE
ALLB_SALTY      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALTI      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALPK      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALPB      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALPA      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALNS      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALHS      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALEP      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALDC      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_SALA4      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
PYRC_GEOSM      GLIDMHVHLRDPGLEYKEGSRSAAAGGFTSVACMPNTSPVIDSKAIASYIINKAKSEAL-VNVFPIGCIT
PYRC_CLOD6      GLVDVHVHFRDTYKEDIESGAKSAARGTTVIIVDNEDTFNYVKEKSKNACINVLQAAAITKGFEGKELVD
ALLB_ENTFA      GMVDAHVHI-------------------------------------------------------------
URE12_PSYCK     GGIDSHIH----FIAPQQCETALM-SGVTTML--------------------------------------
ALLB_SALCH      GMVDAHTHIRTHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
PYRC_THEPX      GFVDMHTHL-------------------------------------------------------------
PYRC_THEP3      GFVDMHTHL-------------------------------------------------------------
PYRC_ANATD      SFTDIHCHLEPGFEYKEDISRAALAGGFTTICCMPN----------------------------------
HYDA_RHIRD      GGIDVHTHVET-----------------------------------------------------------
ALLB_ECOSE      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOLU      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOLI      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOLC      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOHS      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECODH      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOBW      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO8A      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO55      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECO24      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
ALLB_ECOSM      GMVDAHTHIRSHWEGYETGTRAAAKGGITTMIEMP-----------------------------------
PYRC_SOLUE      GFIDMHVHLEPGFEHAETISRAAAAGGFTSICCMPN----------------------------------
PYRC_CLOCE      GLVDAHCHLDPGYEYKEDITRSAAKGGFTSVACMPNTNPVLDNEAMVKYVINKAK---------------
HUTI_SILST      AFIDCHTHIVFGGDRAGEFSTVTATRAASALIAEGVSTVEVKSGYGLDRMLRAARDVTVKTTFLGAHAVP
DPYS_SACKL      GGIDAHVHVDEPLKTMEHATRSAVAGGTTTVVAFSTQDVSKKGPSAL------AESVKLDV---------
PYRC_LACS1      GLVDVHVHYRDPGFTYKETSLAAAHGGYTTVCAMPN----------------------------------
URE1_BACHD      GGIDAHIH----FISPQQID-VAIASGITTML--------------------------------------
PYRC_LACAC      GLVDVHVH--------------------------------------------------------------
PYRC_CLOBA      AFIDTHAHFRDPGLTLESGSKAALKGGYTGVCLMANTKPICSSKEVVQYVRDKSKELDLDIH----QCIS
HYDL_ARTAU      GVVDEHVHIKNRYGRFELDSESAAVGGITTIIEMPITFPPTTTLDALEKKKQAGQRLKVDFALYVPGNLP
HYDA_BURPI      GGIDVHTHVET-----------------------------------------------------------
ALLB_BACSU      GVIDCHVH--------------------------------------------------------------
URE1_STAAW      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAT      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAS      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAR      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAN      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAM      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAE      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAC      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAAB      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAA9      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAA8      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAA3      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAA2      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAA1      GGIDTHVH----FINPEQ----------------------------------------------------
PYRC_PELTS      GLIDMHVHL-------------------------------------------------------------
NDDD_ALCXX      GFIDSHTHDDGYLLAPEMLPKV--SQGITTVV--------------------------------------
HUTI_SILPO      ----------------------------------------------------------------------
PYRC_CLOBB      AFIDTHAHFRDPGLTCKEGSKAALRGGYTGVCLMANTKPICSSKEVVQYVRDKSKELDLDIH----QCIS
ATZC_PSESD      GFVDAHTHMDKSFTSTGE----------------------------------------------------
URE1_STAS1      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_RHOPB      GGFDSHIH----FICPQQIEHALM-SGVTSML--------------------------------------
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      GGIDTHVH----FINPEQ----------------------------------------------------
URE1_STAEQ      GGIDTHVH----FINPEQ----------------------------------------------------
PYRC_CORGL      GFVDMHVHLRSAAAAKGGFTAVFTMANTTPVMDQP-----------------------------------
PYRC_BACHD      GLVDLHVHLREAKETIETGTKAAAKGGFTTVAAMPN----------------------------------
HUTI_GEOSW      GLVDPHTHFETLYEESKRRLDQFLLHGVTTVLSIEHEVKQLTVAKQLD------ETHPVDVTFMGAHAVP
NAGA_BACSH      GFIDMHIHMDASDEGLHIHGPITIKEGTTSFLA-------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      GGIDTHIH----FISPTQI-ECALYSGVTTMIGGPSEGTNTSGAYHIHSMLKATQNYPMNFGFL------
PYRC_THETN      GFVDMHTHLRQPGFEEKETIR-------------------------------------------------
PYRC_LISMO      GFIDVHVHL-------------------------------------------------------------
PYRC_LACH4      GLVDVHVH--------------------------------------------------------------
PYRC_LACDB      GLVDVHVH--------------------------------------------------------------
PYRC_LACDA      GLVDVHVH--------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      GGIDPHTHLDMPFVTKDDFESXXXXXXXXXXXXXXDFCLTNKGKKAIETWHNKA-TGKAVIDY-------
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      GFVDVHTHLREPGFEHKETSASAAKGGFTTICAMPN----------------------------------
PYRC_LISMH      GFIDVHVHL-------------------------------------------------------------
PYRC_LISMF      GFIDVHVHL-------------------------------------------------------------
PYRC_LISMC      GFIDVHVHL-------------------------------------------------------------
HUTI_BACSK      ----------------------------------------------------------------------
PYRC_LISW6      GFIDVHVHL-------------------------------------------------------------
PYRC_CARHZ      GLIDMHVHFDPGYTHKEDISNAALAGGFTGVLMMPN----------------------------------
PYRC_ANOFW      GFVDVHVHLREPGGEHKETTLAAAKGGFTTIAAMPNTKPVPDTKQHMEWLVNRIREASITVRQAGKQLVD
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     GFIDVHTHYDAE-VLLDPGLRESVRHGVTTVL--------------------------------------
Y2913_MYCTU     GFIDVHTHYDAE-VLLDPGLRESVRHGVTTVL--------------------------------------
URE1_SULTO      GFIDTHIH----WVAPQQVFDA-LSAGFTTLI--------------------------------------
URE1_GEOKA      GGVDAHIH----FICPQQ----------------------------------------------------
URE1_ECO5E      GGVDTHIH--------------------------------------------------------------
URE1_ECO57      GGVDTHIH--------------------------------------------------------------
URE1_CORU7      GAIDTHIH----FISPDQF---------------------------------------------------
PYRC_LISIN      GFIDVHVHL-------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      GGIDAHVH--------------------------------------------------------------
PYRC_UNCTG      GLIDIHSHLREPGEERKETTRSAAKGGITTVFCMPN----------------------------------
PYRC_STRPN      GLVDIHVH--------------------------------------------------------------
PYRC_DESRM      GFMDMHVHLEPGYEYKEDITRAAAMGGFTSVACMPNTNPVADNAAIISHVLAKARNA-------------
PKSL_BACSU      ----------------------------------------------------------------------
ENO_ANAVT       ----------------------------------------------------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      GAVDTHVHFEPGRTEWEGFSRSLAAGGTTTYVEMP-----------------------------------
URE1_PROVU      GGVDTHIH----FICPQQAEEGLISGVTTFIVAGTNATTVTPGIWNMHRMLEAVDELPINVGLFGKGCV-
URE1_PROMH      GGIDTHIH----FICPQQAQEGLVSGVTTFI---------------------------------------
URE1_BRAJA      GGFDSHIH----FICPQQIEHALM-SGVTSML--------------------------------------
PYRC_STRR6      GLVDIHVH--------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
ADEC_LACS1      ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
ADEC2_DESPS     ATPFEHSGANIDAREMEKPITYDEVLGLGEFMDFPGVINGVDATIEKLLVAKRAGKPIDGHSPGVSGNAL
ADEC2_LACSS     AANLETSGAVITADEIKQSYDQGLTYGLAEFMNYPGVVNADDGVLDELLVSLNARKMIDGHSPALHGQGL
ADEC2_CARHZ     ATSLETAGAVLTARELSEFINHPRVLGLGELMDYPGVLNTHEEMLKKLAVTE--GKLIDGHAPGISGKEL
ADEC_DESVH      ATPFENXXXXXXXXXXXXXXXXPRVAGLGEMMNFPGVLAGDADVLDKIALALDRGKTVDGHSPGLAGRDL
ADEC_DESVV      ATPFENXXXXXXXXXXXXXXXXPRVAGLGEMMNFPGVLAGDADVLDKIALALDRGKTVDGHSPGLAGRDL
ADEC_CLOBB      ATSFENSGAKLDAEDLQPFYTHPRVLGLAEFMDFSSIVNLNEKMLQKIINANLNGSIVDGHAPGLSKEEL
ADEC_CLOBA      ATSFENSGAKLDAEDLQPFYKHPRVLGLAEFMDFSSIVNLNEEMLQKIINAHLNGSIVDGHAPGLSKEEL
ADEC_CLOAB      ATSFETSGAVLKAEDLKELIDSDRVLGLGEMMNYPGVLSREEEVLNKLKLAGSYNKIVDGHAPSVRGNEL
ADEC_DEHE1      ATHLETAGAEINSNDVTELLRLPNVTGLGEMMNFPGVLFGIPSVLDKIEAAS--GKVLDGHAPGLSGKDL
ADEC_BACHD      ATPFEHSGARLTAEEVAELFRDPRIFGLGEVMDYPAVLTRDQEMMAKLKAAHSEGRIVDGHGAGLDSVAL
ADEC_BACP2      AVSFERSGATLKAKDLKPLYQEKEVLGLAEVMDYVGVEQAEEDMLQKLLDAQHENKLIDGHLAGLTDRLI
ADEC_OCHA4      ATHMETSGAELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLKAFQ--GRHIDGHAPLLRGLDL
ADEC_KOSOT      ATNLENNGARISVMDMIGFVKHPRVLGLGEVMNYPDIINGDHDSIAKIELLRHKYKKIDGHIPGISGKDL
ADEC_BRUSU      ATHMETSGVELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLRAFQ--GRHIDGHAPLLRGLDL
ADEC_OCEIH      ATQFEHNGAQLDAKDISSYFQNPNVLGLAEVMDFPSVANADQKMLEKIVSTIQHGGIIDGHAAGLSKEDL
ADEC_BRUAB      ATHMETSGAELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLRAFQ--GRHIDGHAPLLRGLDL
ADEC_BRUA2      ATHMETSGAELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLRAFQ--GRHIDGHAPLLRGLDL
ADEC_BRUME      ATHMETSGAELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMAKLRAFQ--GRHIDGHAPLLRGLDL
ADEC_PETMO      VTTFDKSGSVLNAEKIKELITEENFFGLGEVMDYEGVITGQDYIWDKIELMKDYF--IDGHAPKLQGKIL
ADEC_DEHSB      ATHLETAGAEINSQDVADLLRLPNVTGLGEMMNFPGVLFGVPSVLDKIIAAT--GKVMDGHAPGLSGKDL
ADEC_BACLD      AAPFEKSGAILNAADLHPFYSREEVLGLAEVMDYVAVEAGEPDMVQKLIDADKAGKRIDGHLAGLSAGFV
ADEC_DEHSC      ATHLETAGAEINSQDVADLLRLPNVTGLGEMMNFPGVLFGVPSVLDKIIAAA--GKVLDGHAPGLSGKDL
ADEC_LISW6      ATEGEHNGETLHAKKLHPLYKHEKVIGLAEVMDFPSVAKGSSDILTKIIDAKKEGGRIDGHGAGLTSADL
ADEC_CLOD6      ATSFETNGVGKFAKDMESYVNNPRILGLGEVMCFNDVINSENEILDKLELFK--NKVVDGHAPNINGKSL
ADEC_BACA2      AASFERSGAVLKAEDLKPFYQEKEVLGLAEVMDYVSVAEGEEDMLQKLLDAKRHGKRIDGHLAGLSSDII
ADEC1_BACSK     AASFEENGASLSAEDVRLLFANEGVYGLGEVMDYPAVLNGDDDMLEKIAMAKAKGRPIDGHAAGLNSDAL
ADEC_LISMO      ATEGEHNGETLHAEKLHPLYRHEKVIGLAEVMDFPSVAKGSDDILRKIIDAKKEGGRIDGHGAGLTSADL
ADEC_LYSSC      GTQFENAGATLTAQDLEPFLHHEQVRGLAEVMDFPAVLNGEEGMLQKILLSKEANLVIDGHCAGLQSEQI
ADEC_LISMF      ATEGEHNGETLHAEKLHPLYRHEKVIGLAEVMDFPSVAKGSSDILTKIIDAKKEGGRIDGHGAGLTSADL
ADEC1_RHIME     ATHLETSGADLPVGRLTPFRHHPKVIGLAEFMNFPGVVNKDPVCLAKLDAFQ--DGHIDGHAPLLRGKEL
ADEC_LISIN      ATEGEHNGETLHAKQLHPLYKHEKVIGLAEVMDFPSVAKGSADILTKIIDAKQEGGRIDGHGAGLTSADL
ADEC_THEAB      ATNLETSGATLGAEDMVSLVEKYRIIALGEVMNYPGVLDCDRDLITKIEILRHKYKKIDGHAPGLTGKEL
ADEC_GEOKA      AASFERAGAVLSAAELAPFFNDERVLGLAEVMDYPSLREQHPSMLDKLALAANANRLIDGHLAGLDADAV
ADEC_ARCFU      SSPLETSGAXXXXXXXXXXXXXXXXXXXAEMMNFPGVVSADREVLEKIVLA----GIVDGHAPGLRGKKL
ADEC_DESAA      ATHLETAGASLETKDILPFLEHPKIVGLAEMMNFPGVIYRDPEVLAKMNAAKSHRKTVDGHAPGLSXXXX
ADEC_THEM4      ATFLETSGAILGAEDMVSLLEKYRLIALGEVMNYPGVLNCDRELITKIEILRHKYKKIDGHAPGLSGKQL
ADEC_RHISN      ATHLETAGADLPIERLTPFRHHPKVIGLAEFMNFPGVIHK-----DPICLAKLQGGHIDGHAPLLRGKEL
ADEC1_RHIEC     ATHLETAGADLPIERLLPFRDHPKVIGLAEFMNFPGVIHK-----DSVCMAKLQGGHIDGHAPLLSGNDL
ADEC_BACSU      AASFERSGAILKAADLKPFYEEEEVLGLAEVMDYVSVQQAEKDMVQKLLDARVAGKRIDGHLAGLSTDLI
ADEC1_AGRT5     ATHLETSGADLPIEKLLPFRNHPKVIGLAEFMNFPGVIHK-----DPVCMAKLQGQHIDGHAPLLSGAAL
ADEC1_RHIL3     ATHLETSGADLPIESLLPYRHHPKVIGLAEFMNFPGVIHK-----DPICMAKLQGGHIDGHAPLLSGNDL
ADEC_METB6      ATPXXXXXXXXXXXXXXXFPGRDGILGLGEMMNXXXXXXXXXXXXAKLVLSRIR----DGHAPHLSGPDL
ADEC_DESHY      AVPFEENGGVFTAEKMEPYLANPRVLGLGEVMDYVSVIGAEEEMVKKLRLFRE---RIDGHAPYLQDKQL
ADEC_DESHD      AVPFEENGGVFSAEKMEPYLANPRVLGLGEVMDYVSVIEAEEGMVKKLRLFRE---RIDGHAPYLQDKQL
ADEC_CLOBL      AVGFEDTGAAVGPEDVRETMKWDEIVGLGEMMNFPGILYSTDHVVGETLKASK---TVTGHLPET-GKGL
ADEC_CLOB1      AVGFEDTGAAVGPEDVRETMKWDEIVGLGEMMNFPGILYSTDHVVGETLKASK---TVTGHLPET-GKGL
ADEC_GLUOX      ATSMETSGAVLNVDDLVAYRHHPKVIGLAEFMNIPGVLNGDPGCVDK--LAAFADGHIDGHAPLMCGKAL
ADEC_CLOB6      AVGFEDTGAAVGPEDVRETMKWDEIVGLGEMMNFPGILYSTDHVVGETLKASK---TVTGHLPET-GKGL
ADEC_CLOBM      AVGFEDTGAAVGPEDVRETMKWDEIVGLGEMMNFPGILYSTDHVVGETLKASK---TVTGHLPET-GKGL
ADEC_METMJ      ATPFDAGGAVLTAADLARFRGREGVVGLAEVMNVPGVLFGDEDLRAKMDLFEV----VDGHAPFLSGKDL
ADEC_SYNFM      ATPLETSGXXXXXXXXXXXXXHERLIGLAEMMNFPGVLSGFPDVIDKLLLFQ--ARRIDGHAPQLGDLGL
ADEC_RHOSK      STHMETAGAALEAKDLAPLLDHPRVIGLAEFMNFPGVLMKDPGCMAKLEAFR--GRHIDGHAPLLRGKDL
ADEC_RHOS1      STHMETAGAALEAKDLAPLMDHPRVIGLAEFMNFPGVLMKDPGCMAKLEAFR--GRHIDGHAPLLRGKDL
ADEC_METTP      ATHLETSGAALGVSEIASLLDDHRVVGLGEMMNYPGVIHRDKPVLAKLKVAASKNKTICGHAPGLGGRDL
ADEC_DESDG      ATHMETAGATLRAEDVQDFLSPDRMPGLAEMMNYPGVLFRDDEVMAKLEAAASH--VIDGHAPLLRGKAL
ADEC_LEUMM      ATPFEHAGATLHADALKPFYSVPEVNGLAEVMDFPAVANLDPDMLQKIKDAEDAGRHVDGHAAGLTPEQL
ADEC_METBU      ATSFETAGASIDVDDIVSLIANENVVGLGEMMDYPGVVFCDETKLSMIRTALKERLVVDGHCPALSREQL
ADEC_MOOTA      AAGFEDAGASFGPEEVAAAMQWPGICGLGEMMNFPGVLAGDPAVHGELRATLAAGKPITGHAMPADFQGL
ADEC3_RHIME     APGLENAGATLSAADVREALAWPNIIGLGEMMNFPGVAANDSKMVAEIAATRAAGLTVGGHASPDLGRAF
ADEC_RHOS4      STHMETAGAALEAKDLAPLMDHPRVIGLAEFMNFPGVLMKDPGCMAKLEAFR--GRHIDGHAPLLRGKDL
ADEC_EDWI9      AAGTDINGAEFPLTAMLPYREHPHVLGLAEMMNFPGVIAGDEPTLDKLDAFRHL--TLDGHSPMLSGKAL
ADEC_METBF      ATPFESAGAVLDAEAVDRLLAREDLHYLSEMMNFPGVVMEFPEVIAKLESAKKYGKNIDGHAPGLNGTDL
ADEC_BDEBA      ALGFETTGSDFPLEEMKSFKDHPSVLGLAEMMNFPGVIHADEEVLAKIEAFDDLN--MDGHAPLLRGKAL
ADEC1_OENOB     ATNFEHAGAVLHADALKPFYGFPEINGLAEVMDFPAVANGDPDMLEKIRDAQXXXXXXXXXXXXLTREQL
ADEC_RHOS5      STHMETAGATLEAADLVPLMDHPRVIGLAEFMNFPGVLAKDAGCLAKLEAFR--GRHIDGHAPLLRGKDL
ADEC_METS4      ATDLESSGARIEAEALRPYRDHPGSLGLAEFMNFPGIVAGDPACLAKLALFA--GRHVDGHAPLLSGRDL
ADEC_METMA      ATPFESSGAVLDINAVDRLLAKDDLHYLSEMMNFPGVILEFPDVMAKLESARKHGKVIDGHAPGLRGADL
ADEC_ESCF3      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_SILST      APGLETTGYEISAEDVAEAMTWPGIIGLGEMMNFPGVAHGDPKMLAEIAATQRSGKTVGGHASPDLGPDF
ADEC_STAMF      ATDLETTANIIGADEVEKLAALEGTIGLGEVMDFVSVLNSNKSVLEKIRVAHRYRLIVNGHAPLLRGAEL
ADEC_LEUCK      ATPFEHAGATLHADALKPFYSVPEVNGLAEVMDFPAVFNEDEDMHQKISDSQAAGKHVDGHASGLSREQL
ADEC_METTH      ATPFETAGAEITARGIEELLRMDSVVALGEMMNFPAVIAGDDGVMAKIKAARDLNMPVDGHAPLLSGDEL
ADEC_LACPL      CVPFDDNGATLHAADLRPLYQQSEVRGLAEVMDYGAVARGDTDTLAKISXXXXXXXXXXXXXXXLNAHQL
ADEC_SHISS      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO7I      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOLU      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOL5      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO81      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOUT      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOL6      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGIISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOK1      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO45      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOLI      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOLC      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECODH      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOBW      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO8A      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO55      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOSE      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECOHS      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO5E      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO57      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC1_CARHZ     CPGLETAGYDITSRDMPEILNYPNVIGIGELQGFSNVYKYTPEIITDLIAAKSIGKIVDGNAPELFGSEL
ADEC_SHIF8      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVINGQNALLDK-LDAFRY-LTLDGHCPGLGGKEL
ADEC_SHIDS      AMECDVNGASFTLEWRDHP----QVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_RHILO      APGLEHAGAELTVADVAEAMTWENIIGLGEVMNFPGVAANDPVMSGEIAATVRAGKTVGGHASRDLGLPF
ADEC_METJA      ATNLETSGAEITAENIEELILLDNVLGLGEVMNYPAVINEDEEMLKKIEVAKKYNKLIDGHCPKLKGWEL
ADEC1_JANSC     APGLETTGFEIGPDDVSEAMAWPGIVGLGEMMNFPGVVNGSQQMLAEIAATQAAGKTVGGHASPDLGPAF
ADEC_SHIFL      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVINGQNALLDK-LDAFRY-LTLDGHCPGLGGKEL
ADEC_ROSDO      APGLETTGFEITAADVADAMAWPGIVGLGEMMNFPGVSNADPKMLAEIAATQRAGKTVGGHASPDLGPAF
ADEC_ECOSM      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_ECO24      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYSGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_DESRM      APGLETTGGVLGVKEVDQLLQSNISASLGEL-DPSKILSIKEEYLAKIVSARANGKVANGHAIGLNWDQL
ADEC_METAC      ATPFESAGSVLDAEAVDRLLAREDLYYLSEMMNFPGVVLGFPDVMAKLESAKKCGKVIDGHAPGLRGADL
ADEC_SHIBS      ALECDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHL--TLDGHCPGLGGKEL
ADEC_METS3      ATCFETSGAILDSETIGELLKKDEAVALGEMMNFPGVINGDGEVXXXXXXXXXXGKPIDGHAPLLSGKDL
ADEC_FLAPJ      ATAFETAGAIIDSEEIKELMASPDIYYLSEMMNYPGVLFDDDEVLKKIAWAKHFNKPIDGHAPGLRGEPI
ADEC_METNO      ATDLESAGARIEAADLLPYRDHPRSLGIAEFMNFPGVVQADPGCLAK--LAAFAGRHVDGHAPLLSGSGL
ADEC_SILPO      APGLETTGYEITPEDVAEAMTWPGIIGLGEMMNFPGVTNADPKMLAEIAATQRAGKTVGGHASPDLGPAF
ADEC_SULNB      ATTFETSGATLGPDEIESLLKMPQIKYLSEVMNFPGVINGDPDMXXXXXXXXXXXXRIDGHAPGLRGDEL
ADEC_METST      ATKFEKSGATISPNIIDNLLSRPEFVALGEVMDYNAVISNEKSILEKIKIAKKYHKPIDGHAPLLSGKNL
ADEC_SHEHH      AAGLDINGSDFSLDEMAAYREHKHVLGLAEVMDYPAVINGEQAMQDKLTTFN--NLNLDGHXXXXXXXXX
ADEC_SALRD      ATPFETSGAELGPDAVSALLDRDDVPYLSEMMDYPGAIDGAPNVLAKIRAAQVRDKPVDGHAPGLRGDDV
ADEC_PARDP      APGLETTGQPITEGEVAQAMGWDGIVGLGEMMNFPGVASGDRQMLTEIAATRAAGKTVGGHASPDLGRPF
ADEC_DEIGD      ASPFECXXXXXXXXXXXXXXRLPGVLGLAEMMNYPGVLNL-ERGAWEVLDA-GYGGRIDGHAAGVAGRDL
ADEC_DEIDV      ASGFEAGGARVGTAEVRQMLGQPGVLGLAEMMNYPGVLGGDEEVWAVIQAGRATGRRLDGHAAGVRGRDL
ADEC_BORAP      ASKFETSGHVLDDQDVDKLMESNDIYYLSEVMDFKGVINKDVEVINKINSALKRNKVVDGHAPGLSPHLT
ADEC_PARD8      ATIMETSGAIIDADETARLLEREDLHFLAEMMNYPGVLNKDPEVMRKIEAAKNAGKPIDGHYPLATGPKL
ADEC2_BACSK     ATSLETTGGAIGIAEMDELMDTEDIQCLGEIMNYVDVLSKPDSKTNQILFRRSYPAPIEGHVPKLTGLDL
ADEC_BORBU      ALSFETSGYVLNDKDIDELMKLDDIYYLAEVMDFKGVXXXXXXXXXXXXSALKRNKVVDGHAPGLSPNLT
ADEC_META3      ATELETNGAPITSKDIEELFKQNNILGLGEVMNYIGVXXXXXXXXXXXXMAKKYNKLIDGHAPQLTREDL
ADEC_CLOP1      XXXLETTGEKITHNEVKRLLEYDNIICLGEVMNFKDLXXXXXXXXXXXXXXXXXXXXLEGHCPKIQGVDL
ADEC_CLOPE      XXXLETTGEKITHNEVKRLLEYDNIICLGEVMNFKDLXXXXXXXXXXXXXXXXXXXXLEGHCPKIQGVDL
ADEC_ENTFA      STTLETTGGIIGLAEVAELLKEPKVICLGEAMNFKGISYEPDSLIRQIIQKQRPTMPLEGHCPKIEDQEL
ADEC_KLEP3      STGLEMSGADFAGAEMETMLGWPEVRGVAEVMDMHGVLHGSERMQEIVQAGLNSGKLIEGHARGLSGADL
ADEC_LACDA      STNMETTGGLIGVKETEELLKDPRFVCLGEVMNFKDMTSDHDTLIKKIIAACRKAMPLEGHVPAYHSEDL
ADEC_DEIRA      ASEFEQGGARVDAAQVAEMLARPGVLGLAEMMNYPGVLGGDAGVWDILNAGRRSGKRLDGHAAGLGGREL
ADEC1_DESPS     YTFPKSTVAFNFTEEVQEVQQWPECFGVWETVR-EAVQEEDEDTLGALATAQNNRLPIFGCAPMARGKEL
ADEC1_LACSS     YTIPASTIADNIDSTVQAQLKRSDVYGVWETVR-EAVXXXXXXXXXXXXNAQDNHVPVWGCAPMATGTKL
ADEC_KLEP7      STGLEMSGADFAGAEMETMLGWPEVRGVAEVMDMHGVLHGSERMQEIVQAGLNSGKLIEGHARGLSGADL
ADEC2_OENOB     STNLETTGGIIDLEEVKELLADPRIICLGEAMNFKGITSEPNSLIRKIIQKKRPRMPLEGHVPNISKEDL
ADEC_SERP5      STGLEMSGADFAGQEMETMLAWPEVGGVAEVMDMHGVLNGSERMLEILNAGLNSGKLIEGHARGLSGADL
ADEC2_RHIL3     APGLELAGADFDASMITEMLHSSAVGGVAEVMNMRGVIDGDPRMTDIVNAGLAAGKLVCGHARGLEGADL
ADEC_CENSY      VDGRFSHSNTLSPEEERSAIGLPDVLGMGEVFSWTKVTSRDPGTMRSIGTMLDGGCIINGHTAGASGKKL
ADEC_METKA      ALGYETVEGEITVDVARKFASHPMVVSVGELMDVAGVMEGEK---DEFIELKSYGLTVDGHAPGLTGFEA
ADEC_RUBXD      STSLETPGAVIGPEEVAEALSWGEVIALGEVMNFPGVVFGDERMHAEISAALRAGKIADGHPPD--DHRL
ADEC3_RHIL3     ATDLETAGGDLTPDKIAALFKWPEAVALGEKMDFVPVAMGDERSHAILAAALGRGRPVSGH---VYGREV
ADEC2_RHIEC     APGLELAGADFDAAVIAEMLRSPAVGGVAEVMNMRGVIDGDPRMSAIVNSGLASGKLVCGHARGLTGADL
ADEC2_AGRT5     APGLERGGXXXXXXXXXXXXSWPEIGGIAEIMNMRGVIERDPRMSGIVQAGLAAEKLVCGHARGLKNADL
ADEC4_RHIME     YTMRSTVGHYFSPKDHRDTHHWPECVGIWETVR-EFIQEEDEDVLQAIEIGQANRLPVLGCCPMTRGARL
ADEC_MESSB      ATSLETAGGDLTAEKIAALFKWPEAVALGEKMDFVQVAMGDERSHAILAAALERGRPVSGH---VYGREV
ADEC2_JANSC     PTAYEWGGGHFGYDEQAGFLNESMVAGLDEVMDWPAVWNPENPSYDRLMIEATFEKRIEGHAAGIRDATI
ADEC1_BRAJA     ATSLETAGGDLTPDKIAGLFRWPEAVALGEKMDFVPVTMGDERSHAILAAALKRGRPVSGH---VYGREV
ADEC2_BRAJA     PTAYEWGGGDEQARFMAESLM---VTGLDEVMDWPAVWNPDNPSYKRLMIEATFAARVEGHASGLRDPSI
ADEC_BRASB      ATSLETAGGDLTPDKIADLFRWPEAVALGEKMDFVPVCMGDERSHAILAAALQRGRPVSGH---VYGREV
ADEC2_RHIME     APGLEXXXXXXXXXXXXEMLSWPEIGGIAEVMNMRGVIDGDPRMTAIVEAGLKAGKPVNGHARGLEGADL
ADEC1_BRASO     XXXXXXXXXXXQASFMRESLM---VTGLDEVMDWPAVWNPDNPSYERLMIGATFAARVEGHASGLREPEI
ADEC2_BRASO     ATSLETAGGDLTPDKIAGLFRWPEAVALGEKMDFVPVCMGDERSHAILAAALQRGRPVSGH---VYGREV
Y1085_PICTO     VKNFWSVRLDSQSMDMEELLNDDYVLQAGEITGWPYIINMEKNMLKNIYNSQFLGKRIETHNPGASKNTL
Y637_BACHD      QTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTL
YERA_BACSU      LTEVLNEDHVLPFDVRKQWIEHPDVIQGGEMTGWPRLVDGDDLMLHCMQATKKQRKRIEGHFPGASDKTL
Y751_OCEIH      QTTLQEENHFINTNDVLDWINHPSVVQGGELTDWPSLLAGDDRLLYWIQETKRNGKPIEGHLPGASLRTL
Y3012_BACCR     QTELQNGESLFNSEEIIEWLQHEAVLQGGELTAWPKLLHGDDEMLTWVQETKRLQKKVEGHFPGASETTL
Y3032_BACAN     QTELQNGESLFNSEEIIKWLQHEAVLQGGELTAWPKLLHGDDEMLTWVQETKRLQKKVEGHFPGASEATL
HUTI_DEIDV      --------------------------------------------------AQQHGLQVKVHADQIGGTEL
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      MGELKEAGCVAVSDDMRRALEYAKGIGIAVISHSEDLALVGEGVMNEGFVSTELGLKGIPWAAEDIAVAR
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      KGGKGESLAEMVSDDMRRALEYAKGIGITVISHSEDLALVGEGVMNEGFVSTELGLKGIPWAAEDIAVAR
PYRC_CLOD6      MEALKKAGVPGFTDDMEAMIKAKELDEDPSLVGNPGVVAEDVMVARDCMLALKTGAKVDGVSVDMVAKYL
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      A---EYAGADAYLDEVLPTLRAAHAEGLVDAVDCEGIAFSAAQIAKVFDVAAELGLPVKLHAEQLSGTKL
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      ----------------------------------------------------------------------
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      VTNFDGKTLDEFKDDMLEAMKIAKENNLMSHAESPEFSKSDMRIIRDVELAKLSGAHV--HMCHVSTKEL
HYDL_ARTAU      AVGFKSMMA-ASVPGMFDAVSDGELFEIFQEIAACGVVHAENETIIQALQKQIKAAG---------GKDM
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      --------ADAYIDTVAPALRTAHAEGLVDAVDCEGIAFQPEQIARVFDVARDLGLPMKLHAEQLSGTKL
PYRC_CLOBB      VTNFDGKTLDEFKDDNEDGVGVSNSNIMLEAMKIPEFSKSDMRIIRDVELAKLSGAHV--HMCHVSTKEL
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      AEWKDNPDGFVRVIVEEMIPKVSEL-GLAEFNDVRGVFTPEQARI--ILEAKAYGLMPKIHADEIYXXXX
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      --GFHLMISEITDDVLEELPKVIEEEGITSFMAYKDVFQADDGTLYRTLVAKELGALVMVHA--------
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      ---------------------------------------------------KKHGLKPKIHADELVGAEL
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      FVALKEAGAFAFTDDVQSARIMYEAMQQAAALDMPIVAHCEDECVHDGSFAKRYG---------------
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      ----------------------------------------------------------------------
ENO_ANAVT       ----------------------------------------------------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
ADEC_LACS1      NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
ADEC2_DESPS     NAYASARIGTDHECATVEEMHERIARGMYVLLRQGSACYNLRTLLKGVTPVNSRRCLFCADDCQPKTILS
ADEC2_LACSS     NAYAAAGVHNDHECTQVDEMLDRISRGMYVYLRYGTVSKNMPTLLKGVTPQNARFCCLCGDDLQSVTLRE
ADEC2_CARHZ     TAYIAAGVNSEHECTTAEEARERLSRGMYLMLREGSATKNLLDLLPAVDRYTASRCFFVTDDRHPEDLIK
ADEC_DESVH      ATYAAARIATDHECTTVDEMHERIALGMYVLLREGSAARDMARLAPGITPGNARRCVFCTDDRQPADILR
ADEC_DESVV      ATYAAARIATDHECTTVEEMHERIALGMYVLLREGSAARDMARLAPGITPGNARRCVFCTDDRQPADILR
ADEC_CLOBB      NVYISTGIYADHECANVREAKERLELGMYLMIREGTAAKELKKLIKVVTPTNSRRCMLVTDDKLPDDLIV
ADEC_CLOBA      NVYISTGIYADHECANVKEAKERLELGMYLMIREGTAAKELKKLIKVVTPTNSRRCMLVTDDKLPDDLIV
ADEC_CLOAB      NAYNLAGIKTDHECSSIEEMNEKIRNGMYIAIREGSAAKNLDILIKGVNAKNERRIMFCADDRHPDDILK
ADEC_DEHE1      NAYISAGIHSDHECIQLDEAKEKLARGMYIMIREGSSEKNLTELLPLVTDKTYKRCIFVVDDRSCADLQR
ADEC_BACHD      NAYTAAGIGNDHEAVTPEEAKARLQRGMYLLIREGTAAKDFDALMKAITPMNSRRALFVTDDKHLDELVE
ADEC_BACP2      NVYRTASVQTDHEVTTAQEALERVKRGMYVMLREGSVAKNVKNVLPAVNEKNARRFFFCTDDKHLDDLMA
ADEC_OCHA4      NGYISAGIRTEHEATSAEEALEKMRKGMHVLVREGSVSKDLKALMPIITERHAQFLALCTDDRNPLDIAD
ADEC_KOSOT      NAYICAFIRSDHECTNVEEAKEKLARGMQILVREGSVARNLDELLPLINEKNYPFISFCTDDKHPNDILN
ADEC_BRUSU      NGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGSVSKDLKALMPIITERHAQFLALCTDDRNPLDIAD
ADEC_OCEIH      NIYMAAGIRNDHESVSAQEGKDRLEAGMYLMIREGTVAKDLEALLPIINDKNARRCIFVTDDMLLDDLVE
ADEC_BRUAB      NGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGSVSKDLKALMPIITERHAQFLALCTDDRNPLDIAD
ADEC_BRUA2      NGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGSVSKDLKALMPIITERHAQFLALCTDDRNPLDIAD
ADEC_BRUME      NGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGSVSKDLKALMPIITERHAQFLALCTDDRNPLDIAD
ADEC_PETMO      NAYLLAGIMADHETTSPNEALEKISKGMYIMVREGSVTRDLQSLLPAINDKNNCNFLFATDDKHPEDLIS
ADEC_DEHSB      NAYISAGIHSDHECIHLAEAKEKLARGMYIMIREGSSEKNLAELLPLVTDKTYKRCLFVVDDRSCADLKS
ADEC_BACLD      NVYRAAGVLTDHEVTTPEEALERVRRGMYVMLREGSAAKNTRHVLPAVNEKNVRRFFFCTDDKHLDELVD
ADEC_DEHSC      NAYISAGIHSDHECIHLAEAKEKLARGMYIMIREGSSEKNLAELLPLVTDQTYKRCLFVVDDRSCADLKS
ADEC_LISW6      NNYLAVGIRTDHESTNAKEAVDRLRAGMFVMLREGTVGRDLLQTISAVSEKNSHRFCFCTDDKLINDLIT
ADEC_CLOD6      QTYVCAGIENDHECITFDEVYEKLRAGLKILIREGSAAKNLKSIVSLKHNLPIEEFMFCTDDKHLDDIEK
ADEC_BACA2      NIYRTAMVSNDHEVTTKEEALDRIRRGMYVMLREGSVAKNTLNVLPAVNEKNARRFFFCTDDKHVDDLLS
ADEC1_BACSK     NAYRTAGIHNDHEAVTAEEAKARVQRGFYVLMREGTAARDIEALLPXXXXXXXXXXXXXXDDKHLDDLLK
ADEC_LISMO      NNYLAVGIRTDHESTTAKEATDRLRAGMFVMLREGTVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLIT
ADEC_LYSSC      TGYRAAGIQTDHECVTAEEAIDRVEQGMYVLIREGSAAKNLRDLLPAIQSHNARRFGFCTDDKYVDELMD
ADEC_LISMF      NNYLAVGIRTDHESTTAKEATDRLRAGMFVMLREGTVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLIT
ADEC1_RHIME     NGYLAAGIRTDHECTSAEEALEKIRKGMHILVREGSVSKDLQALMPILTERLSPYLALCTDDRNPLDIAE
ADEC_LISIN      NNYLAVGIRTDHESTSAKEALDRLRAGMFVMLREGTVGRDLKQTISAVTEKNSHRFCFCTDDKLINDLLT
ADEC_THEAB      NAYIDAFVRSDHECETKEEALEKLSKGMQIFIREGTAARNLNALLPAVNEMNHFFFSFCTDDRDPNDIIE
ADEC_GEOKA      NVYRSARIHTDHECVTPDEALERVRRGMYVLIRQGSVAKDLKKLLPAIHEHNARRFLFCTDDKHLDDLWF
ADEC_ARCFU      NAYIAAGASSDHETTSFEEGKEKLRLGMWVMIREGSAARNLVALKGL--TGNRHTMLVTDGDRSVKDIIE
ADEC_DESAA      XXXXXXXXXSDHECTTPEEALEKLASGMRIMIRQGTGAKNLNDLLPIVTEQNSRRIMFCSDDRHPYDLLE
ADEC_THEM4      NAYIDAFVRSDHECETKSEALEKLSKGMHIFIREGTAARNLRSLIPAVNILNHFFFSFCTDDRDPEDIYK
ADEC_RHISN      NGYLATGIRTDHECTSAEEALEKIRKGMHILVREGSVSKDLQALMPIITERLSPHLALCTDDRNPLDIAE
ADEC1_RHIEC     NGYLSAGIRTEHECTSAAEALEKIRKGMHILVREGSVSKDLAALIPIITERLSPYLALCTDDRNPLDIAE
ADEC_BACSU      NIYRTAFVLNDHEVTSKEEALDRIRRGMYVMMREGSVAKNTLNVLPAVNEKNARRFFFCTDDKHVDDLLS
ADEC1_AGRT5     NGYLAAGIRTEHECTSAAEALEKIRKGMHILVREGSVSKDLHALMPIITERLSPYLALCTDDRNPLDIAE
ADEC1_RHIL3     NGYLAAGIRTEHECTTASEALEKIRKGVHILVREGSVSKDLAALMPIITERLSPFLALCTDDRNPLDIAE
ADEC_METB6      NAYLLSGPDSDHECTTASEAKEKLRCGMYLFVREGSTEKNIAALVPVVTPYTVSRCSFCTDDCHADLLAH
ADEC_DESHY      AAYALAGIKTDHECIDYAYALEEIRNGMQVLIREGSGARNLAAIVRGINNLDTGNFSFCTDDKHINDIQR
ADEC_DESHD      AAYALAGIKTDHECIDYAYALEEVRNGMQVLIREGSGARNLEAIVRGINSMDTGNFSFCTDDKHINDIQR
ADEC_CLOBL      NGYIASGVRCCHESTRAEDALAKMRLGMYAMFREGSAWHDLKEVSKAINKVDSRFAVLISDDTHPHTLLK
ADEC_CLOB1      NGYIASGVRCCHESTRAEDALAKMRLGMYAMFREGSAWHDLKEVSKAINKVDSRFAVLISDDTHPHTLLK
ADEC_GLUOX      NGYLAAGISTDHEATAADEALEKVRKGMTVLIREGSVCKDLEALVPLLNVATSPFFAFCTDDRNPLEIAH
ADEC_CLOB6      NGYIASGVRCCHESTRAEDALAKMRLGMYAMFREGSAWHDLKEVSKAINKVDSRFAVLISDDTHPHTLLK
ADEC_CLOBM      NGYIASGVRCCHESTRAEDALAKMRLGMYTMFREGSAWHDLKEVSKAINKVDSRFAVLISDDTHPHTLLK
ADEC_METMJ      NAYIYAGVQSDHECTALPEAREKLLRGMYVMIREGSTERNLHDLLPLVDACTAPRCCFATDDRHADMLAG
ADEC_SYNFM      NAYVAAGITSDHECTTLEEAREKLAKGMTVMIREGGQSRDLAALLPAVDEHTWPRCCFVSDDVHPDGLLR
ADEC_RHOSK      NGYIAAGIRTEHEATTADEALEKLRKGMRVLIREGSVSKDLHALVSILTERHAPYLCLCTDDRNPLDIAE
ADEC_RHOS1      NGYIAAGIRTEHEATTADEALEKLRKGMRVLIREGSVSKDLHALVSILTERHAPYLCLCTDDRNPLDIAE
ADEC_METTP      HAYAAALIEDDHECTRAEEAMEQLRAGICIMIREGSAARNLDELVKIIREYNTPNIMLCTDDLD-PXXXX
ADEC_DESDG      NAYVLGGPASDHETSDADEAREKLRKGMHLMIREGSQEHNLEELVTVLNEFNTQNVSFVSDDKVVNDLME
ADEC_LEUMM      AVYRNVGIDTDHESENAKEALERLNAGFSIFVREGTVERDEKAILPAITMANQSHFSFATDDKTANDIQS
ADEC_METBU      FGYMCAGISTDHESIEYEEALEKLRLGMKLMIREGSAAKALDKFLPLIGDGVSLENVFFVTDDKHPSDLL
ADEC_MOOTA      AGYTAAGISSCHESTRTEDALNRLRLGMYAMMREGSAWHDIKATIKSLTRVDSRRAMLVSDDTHPETLLS
ADEC3_RHIME     HAYAAGGPADDHEGTTVEDAIARVRQGMRSMLRLGSAWFDVAAQVKAITEIDPRNFVLCTDDSHSGTLVS
ADEC_RHOS4      NGYIAAGIRXXXXXXXXXXXXXKLRKGMRVLIREGSVSKDLHALVSILTERHAPYLCLCTDDRNPLDIAE
ADEC_EDWI9      NAYLAAGVENCHETLALEEGREKLALGMALMIREGSAARNLDTLAPLISEFNSPQCMLCTDDRNPWEIAH
ADEC_METBF      QKYVGAGISTDHESFAYEEAVEKIKLGMNILIREGSSARNFDTLYKLID-EYPESVMLCTDDSHPDTLIY
ADEC_BDEBA      NAYLLAGIQNCHETVTLEEGREKLQKGMGLIIREGSVAKNLRTLAPLVNEFSSPQCLLCTDDRNPFEIAH
ADEC1_OENOB     AVYRAVGIDTDHESTSGKEALERIQAGMKVFIREGTVERDEKSILPVVRKNNQSYFSFCTDDKSAIDIQK
ADEC_RHOS5      NGYIAAGIRXXXXXXXXXXXXXKLRKGMRVLIREGSVSRDLEALVPLLTERHSPYLCLCTDDRNPLDIAE
ADEC_METS4      NAYVAAGIRTDHETTGPAEALEKIRKGMTVLIREGSVSKDLRALAPLLTVATSPFLAFCTDDRNPLDIAE
ADEC_METMA      QKYIGAGISTDHECFEYEEAREKIELGMKILIREGSSARNFETLYPLIDEYPD-HVMLCTDDSHPDTLIY
ADEC_ESCF3      NAYIAAGIENCHESYLLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_SILST      AAYVAGGPADDHEGTCEADAITRMRQGMRAMVRLGSAWYDVEAQITAITELDPRNFILCTDDCHSGTLVN
ADEC_STAMF      DAYIDAGIWSDHESTIYEEALEKARKGMYVFIREGSAWKDLKALLPLIHTIDHRFLSFASDDINVVDLME
ADEC_LEUCK      AIYRKYGIDTDHESENAQQARDRLNAGFSVFVREGTVERDESAILPAISVANQAHFSFATDDKTANDIQH
ADEC_METTH      CTYIGAGISTDHECVSPEEVLEKRRLGMKIMAREGSSARNLRDL------AAAGCDFLVSDDIHPADLL-
ADEC_LACPL      NVMRNAGLDTDHECMTVAEAQDRVRAGMAVFLREGTVERDVLPTIGAVTEANASRFAFCTDDKMISDLLT
ADEC_SHISS      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO7I      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOLU      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOL5      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO81      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOUT      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOL6      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOK1      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO45      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOLI      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOLC      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECODH      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOBW      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO8A      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO55      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOSE      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECOHS      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO5E      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO57      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC1_CARHZ     AAHIAAGTASCHETTTKEECVEKLRYGMYVFMREGSTQKNMAECIRAVTEEDSRRLIGATDDMVAEDLAK
ADEC_SHIF8      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGXXXXXXXXXXPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_SHIDS      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_RHILO      HGYVAGGPEDDHEGTRAEDAIARVRQGMKAMLRLGSAWYDVASQIKAVTEGDPRNFILCTDDSHSGTLVH
ADEC_METJA      NKYISHGIMSDHESVDEDEALEKLRLGLKLMIREGTASKNIYLLNICKKIKDFRNIMLVSDDVCIKDL--
ADEC1_JANSC     HAYAAGGPADDHEGTSETDAMARMRQGMRSMIRLGSAWYDIESQITAITELDPRNMIICTDDCFAKTLVE
ADEC_SHIFL      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGXXXXXXXXXXPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ROSDO      AGYIAGGPADDHEGTCEADAIARMRQGMRSMIRLGSAWYDVESQITAITELDPRNMILCTDDCHSGTLVN
ADEC_ECOSM      NAYIAAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALATLINEFNSPQCMLCTDDRNPWEIAH
ADEC_ECO24      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_DESRM      NVYATAGLSDDHESVVFQELFERLRLGIKALVREGSTERNVEALVKIEQNLSTENLIFCTDDKHVNDIVR
ADEC_METAC      ETYIGVGISTDHESFTYEEAVEKIKLGMKILIREGSSARNFETLYSLID-EYPEAVMLCTDDSHPDTLIY
ADEC_SHIBS      NAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAH
ADEC_METS3      DKYMAEHISTDHECSNFAEAIEKKEKGMKIMVREGSSAKNMEALFKMPNEVLEKRIHLPVSDDKHTTDLI
ADEC_FLAPJ      KKYISAGITTDHECFTYSEAQEKLSLGMKVIIREGSAAKNFEALIDLL-PANYENMMFCSDDKHPDDLI-
ADEC_METNO      NAYAAAGIRTDHEATGAAEALEKIRKGMTVLIREGSVSKDXXXXXXXXXXXXSPFLAFCTDDRNPLDIAE
ADEC_SILPO      AAYVAGGPADDHEGTCEADAIARVRQGMRSMMRLGSAWYDVETQITAVTELDPRNFILCTDDCHSATLVN
ADEC_SULNB      TKYIEAGIETDHEAFTYEEGLEKLQKGMKILIREGSAAKNFEALAPLI-PAYPNKLMFCSDD-RHPNDLA
ADEC_METST      QKYVKHGVITDHESTTKKEVAEKKRMGMKIMIREGSESKMLEKLI------YSNCDFIVSDDLKPEDLIN
ADEC_SHEHH      XAYVACGIQNCHETTNVEEGKEKLAKGMAVIMREGSVAKNLDALAPLITDFSSPYCLLCTDDRNPHEIAN
ADEC_SALRD      AQYAAAGIETDHECVSIEEAREKLEAGMKIAIREGSAAKNFDELIPLMDEAPDRLMFCSDD--RHPDALA
ADEC_PARDP      HAYVAGGANDDHETTTEAQGIARVRQGMGCMMRLGSAWYDVESQITAITELDPRFFILCTDDSHSGTLVN
ADEC_DEIGD      QAYAAAGPHSDHEATTPEEARERLRAGLWLMVREGSAARNLEALLPVLR-ERPRRAMLVSDDVSVDEXXX
ADEC_DEIDV      QAYAAAGLHSDHEATTPEEARERLRAGLWLMVREGSAARNLQALLPVLR-ERPRRAMLVSDDVSVXXXXX
ADEC_BORAP      LKYMSSGISTDHECSTIEDARYKLSLGVKIIIREGSAAKNFESLHPLISECSNKYCMFCFDDAHPNDILH
ADEC_PARD8      KAYIESGISTDHETIYLEKGREKCELGMHVLIREGSAAKNFDALHPLLK-EYPEQIMFCTDDAH-PSFLN
ADEC2_BACSK     HQIVAAGIGSDHTHQTREGMEARIKAGMFLEIQEKSMTDDVLSYL-IENDTREHFCFVT-DDVMADSLYK
ADEC_BORBU      LKYASSGISTDHECLTIEDARYKLSLGMKILIREGSAAKNFESLHPLISECSKKYCMFCFDDAHPNDILN
ADEC_META3      INYVNMGIMSDHECTTEDEALEKLQLGLKLMVREGTASKNLLKIIDILKRKGTKNIMLVSDDISVKD-LK
ADEC_CLOP1      SLYIYRGVNGDHTQQSVGSLQEKIQNGMFIEMQHKSMTLENIKFL-IENNLYEHFALVT-DDVMADKLV-
ADEC_CLOPE      SLYIYRGVNGDHTQQSVGSLQEKIQNGMFIEMQHKSMTLENIKFL-IENNLYEHFALVT-DDVMADKLV-
ADEC_ENTFA      ADFLYSGITSDHTHQFPKTLKEKIEAGVFIQFQNKSITPE--NIQVIVDNDFYNYASIITDDVMADDLL-
ADEC_KLEP3      QAYLAAGVTSDHELTSADDALEKLRAGLTIEIR-GSHPYLLPDIVAALKTLPSSQITVCTDDVPPDMLLE
ADEC_LACDA      AKVIYAGITTDHTQQTSSLVDEKIRSGMFVEIQLKSMHQEV--IDTVIEHGYFEHVALVTDDSMPDTLL-
ADEC_DEIRA      LAYAAAGLHSDHEATTPEEARERLRAGLWLMVREGSAARNLAALLPVLRDL-PRRALLVSDDVSVXXXXX
ADEC1_DESPS     NGYLCAGVRLDHESYDHEEVVEKMRNGMHMLIRESSVTHFLEENIRAVTEVNARRVSFCTDDVTATDILE
ADEC1_LACSS     NEYLMSGVRVDHESYDHQELLEKVRKGINVVIRESSVTHFLAENIRAITETNARHVSFCTDDVNAMDIVN
ADEC_KLEP7      QAYLAAGVTSDHELTSADDALEKLRAGLTIEIR-GSHPYLLPDIVAALKTLPSSQITVCTDDVPPDILLE
ADEC2_OENOB     AKFIFAGILSDHTQQTPALIKEKIENGMFIQLQKKSLNKE--NIETIVKNHFYDYSALVTDDTMADDLIN
ADEC_SERP5      QAYLAAGVTSDHELTSGADALEKLRAGLTLEIR-GSHPYLLPEIVAALKTLPSSQITVCTDDVPPDMLLE
ADEC2_RHIL3     NAFMASGITSDHELTSGADLLAKLSAGLTIELR-GSHDHLLQEFVEVLSGLGPPTVTLCTDDVFPDELQE
ADEC_CENSY      SAYVSAGILSCHEPVNAEQAEERLRLGMWVMMREGSIRRDLAEILPLKKEAGLDRLMFCTDGIDPVDMGE
ADEC_METKA      MRYFAAGPETDHECSTAEEFTSRRELGVWTFVRQGSSSKDMEVALETLE--DLRGVCFVTDDLHVKD-MD
ADEC_RUBXD      AAYAASGISGCHEGTTPEDTLWRLRQGMYAKLRRGSAWHDVAATIKTERGLDPRRILLVTDDRSPESLLE
ADEC3_RHIL3     AAYAASGVTDTHEAIDRGIADDLLEAGVWIFLRGGPPTTPWHSLPQAIKTASHKRVAVCTDDRDAEDLLA
ADEC2_RHIEC     NAFMAAGVTSDHELTSGADLAAKLSAGLTIELR-GSHDHLLQEFVEVLNGLGPATVTLCTDDVFPDELYQ
ADEC2_AGRT5     NAFMAAGVSSDHELVSGEDLMAKLRAGLTIELR-GSHDHLLPEFVAALNTLGPQTVTLCTDDVFPXXXXX
ADEC4_RHIME     NGYMQSGVRADHESYTPEEMLEKLRAGMHVVVRESSISHFLSDNLRIVTEMGVRRISFCTDDVVASDILS
ADEC_MESSB      AAYAASGVTDTHEAIDREIADDLLEAGIWLFLRGGPPTTPWHSLPQAIKTASHKRIAVCTDDRDADDLLL
ADEC2_JANSC     NAFAAAGLASDHEAWTTEEVLDKLRRGLFMELRPHSLSEMVKGLLE-AGLEDWGQFALTTDDRSCSDTLK
ADEC1_BRAJA     AAYAASGVTDTHEXXXXXXXXXXXXXGVWVFLRGGPPTTPWHSLPQAIRTASHKRTAVCTDDRDADDLLL
ADEC2_BRAJA     NAFAAAGLASDHEVQTPEETWDKLTRGLFVELRVYAMDEIVRWLLA-KGLQDWSQIAFTTDDRSASHTLE
ADEC_BRASB      AAYAASGVTDTHEXXXXXXXXXXXXXGVWIFLRGGPPTTPWHSLPQAIRTASHKRTAVCTDDRDADDLML
ADEC2_RHIME     QAFVTAGVSSDHELVSGDDLIAKLRAGLSIELR-GSHDHLLPEFVIALGTLGPQTVTLCTDDVFPDDLHR
ADEC1_BRASO     NAFAAAGLASDHEVQTPEETWDKLTRGLFIELRIYAMPEIIGWLLK-KGLQDWSQIAFTTDDRSASHTLA
ADEC2_BRASO     AAYAASGVTDTHEXXXXXXXXXXXXXGVWIFLRGGPPTTPWHSLPQAIRTASHKRTAVCTDDRDADDLML
Y1085_PICTO     NRMAAAGITSDHEAITGEDVKTRLSLGYHVFLRYSSIRKDLKDELKYIEKLPLNRLMLTNDG--SPYYND
Y637_BACHD      TQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILKELGIDDFSRCMLTTDG-SPPSFYE
YERA_BACSU      TKMKLFGADCDHEAMTGDEVMRRLELGYYVSLRNSSIRPDVRKILQELHEKGFRYYFFYTTDGATPNFYK
Y751_OCEIH      TKMKLLGISADHEAMTGKDVMNRLQLGYMVGLRYSPIRPDLPAILELESGLTTFDQLTFTMDGPTPYFMK
Y3012_BACCR     AKLKLLGTDCDHEAMTGQEAFTRLMQGYTVSLRNSSIRPDLEVILKELLELGVKQFFFFTTDGSHPSFYE
Y3032_BACAN     AKLKLLGTDCDHEAMTGQEALARLMQGYTVSLRNSSIRPDXXXXXXXXXXXGVKQFFIFTTDGSHPSFYE
HUTI_DEIDV      ACQLGALSVDHLEASGQAQIEALAASDTVATILPG-VTLHLG--LP---AAPGRRLIDAGAAVAVGTDLN
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      EVYLAGAPVHIAHISTVGSARNAKARGVYFTLTDEAVRETNAKMNPPLRSAADVEAMKAGKDVEFNVALN
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      EVYLAGAPVHIAHISTVGSARNAKARGVYFTLTDEAVRDTNAKMNPPLRSAADIEAMKAGKDVEFNVALN
PYRC_CLOD6      GATVVAEASPHHFTLTEEDVLEKMNPPLRSKWDRDKIIEGLNDTIEIIATDHAPHSKEEKDREFIKAPSG
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      AAERGALSVDHVEYATEADARAMAASGSVAVLLPGAFYTIRETQVPPV--AEFR---MHGVPMALATDCN
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      ----------------------------------------------------------------------
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      KCIIAA--KNEGANITLEVTPHHI--GLTKEINDYRVNPPIREVEEIIKAIKMGNIDTIGTDHAPHTLEE
HYDL_ARTAU      AAYEASQP--------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      AASYGALSA-DHIEYLDEDGVAAMARGMTAVILPGAFTLRETQKPPVALLRKHRVPMAVSTDANPGSSPM
PYRC_CLOBB      KCIIAA--KDEGANITLEVTPHHI--GLTKEINDYRVNPPIREVEEIIKAIKMGNVDTIGTDHAPHTLEE
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ------------------------------------------------NVAASELAQLGLLDILSSDYYP
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      XXXXXXXXXXDHLLRASDEGIRRMAKGVIAVLLPGTA------FFLMTKAANARKIIDAGAAVALSTDCN
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      ----------------------------------------------------------------------
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      AAKVGAVSA-DHLLKASPTGIEQMAEGVIAVLLPGTA------FFLMTEPANARAMIEAGVPVALSTDRN
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ---------------------------------------------------DARRLLDAGVRVALASDCN
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      ---------------------------------------------------------LVGTHLARQALIN
ENO_ANAVT       --------------------------------------------VPLMNVINGGAHAANNVDFQEFMIVP
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       --------------------------------------------VPLMNVINGGAHASNNVDFQEFMIVP


                         .         *         .         .         .         .         +:350
query           KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
ADEC_LACS1      KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
ADEC2_DESPS     LGHLDNHLRICAEEGIDPIMAIQMATINAAECFGLKDRGAIAPGLKADIVLMDSLTNCRVEKVWIDGVLI
ADEC2_LACSS     TGHLDESIRVAIQNGIDPLTAIQMATINTAQCTGLSDRGGIAPGLKADFLLVDDLEHFNVNQTFIDGQKI
ADEC2_CARHZ     LGSINHMVKLAVSAGADLPTVLQMATINAANYFRLYDLGAIAPGYRADILVFEDLQEFKPKYVFKDGKLV
ADEC_DESVH      DGHIDNHLRIAVSHGVDPVTAVTIATLNAAECFGLRDRGAVAPGRVADFVLVDDLTGFAVRKVYAAGRLV
ADEC_DESVV      DGHIDNHLRIAVSHGVDPVTAVTIATLNAAECFGLRDRGAVAPGRVADFVLVDDLTGFAVRKVYAAGRLV
ADEC_CLOBB      EGSVDHNVRLAIKEGLDPVTAIQMVTINAAEFFGLRSFGAIAPGYQADLLILDELQNVSIDKVLKKGICV
ADEC_CLOBA      EGSVDHNVRLAIKEGLDPVTAIQMVTINAAEFFGLRSFGAIAPGYQADLLILDELQTVSIDKVLKKGICV
ADEC_CLOAB      SGHMDNCVRRAIYNGIENTAAIRMASINAAECYKLERVGAIAPSYXXXXXXXXXXXXXXXNMVIKSGEVV
ADEC_DEHE1      DGDIDAVVRKAIKLGLDPVRAIQLASINTAEYFRLNGHGAIAPGYLANMIVCQDLNQLDIDMVFHKGELV
ADEC_BACHD      EGSIDHHVRKAIQIGVNPLQAIQMASLNAAECFKLAKKGAIAPGFTADLLFIEDLQSLAITHVFKNGTCV
ADEC_BACP2      QGSIDEQVRMSIKEGLDPFLAYQMGSLNAAECFGLKTKGAIAPGYDADFMLVSDFHHVDITSVFIAGELV
ADEC_OCHA4      QGHLDYLIRTAIAGGVEPIAIYRAASVSAARAFGLFDRGLVAPGQRADLVVVDSLEGCHAEIVLSAGRVI
ADEC_KOSOT      EGHIDYMIRYAIKKGIDPITAVRAATINTARHYNLRSMGAIAPGYKADFVIVDNLEEFRISMVFKDSKLI
ADEC_BRUSU      QGHLDYLIRTAIAGGVEPLAIYRAASVSAARAFGLFDRGLVAPGQRADLVVVDSLEEIVLSAGRVVSEAL
ADEC_OCEIH      NGDIDHIIRKAIQLGLDPVMAYQMATLNTAECFGLRELGAVAPGYIADFLILNDENQVDIHQVYKNGKCV
ADEC_BRUAB      QGHLDYLIRTAIAGGVEPLAIYRAASVSAARVFGLFDRGLVAPGQRADLVVVDSLEEIVLSAGRVVSEAL
ADEC_BRUA2      QGHLDYLIRTAIAGGVEPLAIYRAASVSAARVFGLFDRGLVAPGQRADLVVVDSLEEIVLSAGRVVSEAL
ADEC_BRUME      QGHLDYLIRTAIAGGVEPLAIYRAASVSAARVFGLFDRGLVAPGQRADLVVVDSLEEIVLSAGRVVSEAL
ADEC_PETMO      EGHINFMIKKAIKLGMEPFRAIKLATLNAARSLGLHRLGGIAPGYKADLLIIDNLDELGIFQVYKDGKKV
ADEC_DEHSB      DGDIDAVVRKAIRLGLDPVRAIQLASINTAEYFHLQGHGAIAPGYLANMIVCQNLEQLDIDMVFHKGKLV
ADEC_BACLD      EGSINYQVKLAIQEGLDPFLAYQMGSLNAAECFGLKTKGAVAPGYDADLLFISDFENVSITKTMING-VI
ADEC_DEHSC      DGDIDAVVRKAIRLGLDPVRAIQLASINTAEYFHLQGHGAIAPGYLANMIVCQNLEQLDIDMVFHKGKLV
ADEC_LISW6      EGSINYNIRLAIENNIDPITAIQMATINAANCHNLPYLGAVAAGYQADIVFLKDLQTIEISKVLKNGQVV
ADEC_CLOD6      QGHIRWNIKCAIDLGMEPVRAIKVATYNSAKAYGLRKIGAIGAGYKADIVVLNDLDKMEVDSVYKDGNLV
ADEC_BACA2      EGSVNHQVKMAIKAGLDPFLAYQLASLNAAECYGLETKGAVAPGFDADLLFISDVREAVVTKTMVAGRTV
ADEC1_BACSK     EGSVDFNVRKAIALGMDPLQAIQIGTLNAAECFQLDDKGAIAPGKEASFLFVSDLSTFQVDAVYAKGMLV
ADEC_LISMO      EGSINYNIKLAIKNGIDPITAIQMATINAANCHNLPYLGAVAAGYQADIVFLTDIETVEISKVLKNGEVV
ADEC_LYSSC      EGSINYDVAMAIAEGMTPLQAIQLATVNTAECYRLFDRGVLAPGYKADFVLVDDLSTMQAKAVWKNGHKV
ADEC_LISMF      EGSINYNIRLAIKNGIDPITAIQMATINAANCHNLPYLGAVAAGYQADIVFLTDIETVEISKVLKNGEVV
ADEC1_RHIME     QGHLDNMIRTAISAGVEPLXXXXXXXXXXXXXFGLRDRGLVAPGWRADLVIVDSLENCKAELVLSAGRRV
ADEC_LISIN      EGSINYNIRLAIENGVEPITAIQMATINAANCHNLPYLGAVAAGYQADIVFLKDLKTIEISKVLKNGQVV
ADEC_THEAB      RGHINGIIKSAIDSGIDPIIAIRMATINTAKYFNLRSMGAISPGYKADIVFIDNLKDFVIKDSKIVVEDK
ADEC_GEOKA      EGSVDHNVRLAIQAGLDPLLAIQMATLNAAECYRLPTKGAVAPGYDADFLFVDDLETLNITHVFKAGRLV
ADEC_ARCFU      EGYLDHVFRRAIEEGIDEIKALQMLTLNPAEYFGIN-AGLIAPSRLADIVLLKNLRKFEVRDVFVGGRR-
ADEC_DESAA      KGHINIMVARSIRQGVDPVTAIRMASLNTAEYFGLRDRGGIAPGMRADLLVVPDLVDFHVQDVYSGGVKV
ADEC_THEM4      RGHINQIVKEAIGQGLDPVIAIRMATINTAKYFNLRSMGAISPGYKSDIVLVDNLYDFNI--LYVIKDSV
ADEC_RHISN      QGHLDHMIRTAIAAGVEPLXXXXXXXXXXXXXFGLSDRGLVAPGWRADLVVLDSLENCKAEMVFSGGRRV
ADEC1_RHIEC     QGHLDHMIRTAMASGVEPLXXXXXXXXXXXXXFGLRDRGLVAPGWRADLVVLDSLQSCRAEMVFSAGRRV
ADEC_BACSU      EGSVNHQVKMAIQAGLNPFLAYQLGSLNAAECYGLDTKGAIAPGFDADLLFVSDLENVTVTMTMVKGQTV
ADEC1_AGRT5     QGHLDYMIRTAIASGVEPLAIYRAASISAAKAFGLRDRGLVAPGWRADLVVIDTLQN-CKASMVLSGGRL
ADEC1_RHIL3     QGHLDHMIRTAIASRVEPLXXXXXXXXXXXXXFGLKDRGLVAPGWRADLVVLDSLENCRADMVFSAGRRV
ADEC_METB6      SGHIDRCIRTAVAGGLEPELALRMATLSPAERFSLPDRGALAPGRRADFCIVDDPRHFAVKETYSRGRPV
ADEC_DESHY      EGHISYNIKKSIALGLPPLKAIKMATLNTARCYNLTELGAVAPGYQADFVILDSLEEVAVHAVYHKGKKV
ADEC_DESHD      EGHISYNIKKSIALGIPPLKAIKMATINTARCYNLTKLGAVAPGYQADFVILDSLEEVAVHAVYHKGKKV
ADEC_CLOBL      DGHLDHIIKRAIEEGIEPLTAIQMVTINCAQCFQMDELGSITPGKCADIVFIEDLKDVKITKVIIDGNLV
ADEC_CLOB1      DGHLDHIIKRAIEEGIEPLTAIQMVTINCAQCFQMDELGSITPGKCADIVFIEDLKDVKITKVIIDGNLV
ADEC_GLUOX      EGHLDFLIRRAIELGVEPXXXXXXXXXXXXXXFGLRDRGQIAPGKRADIVLLDDLERCQVSDVILVNDAL
ADEC_CLOB6      DGHLDHIIKRAIEEGIEPLTAIQMVTINCAQCFQMDELGSITPGKCADIVLIEDLKDVKITKVIIDGNLV
ADEC_CLOBM      DGHLDHIIKRAIEEGIEPLTAIQMVTINCAQCFQMDELGSITPGKCADIVLIEDLKDVKITKVIIDGNLV
ADEC_METMJ      EGHIDDCVRKAVSGGLEVEQALRMATLSAAGRFGLHDRGALAPGRLADFCVADDPDRFRVLRTFKRGVEV
ADEC_SYNFM      EGHMNVIVNRAMSLGMAPVRALSLAALTPARHFRLDRRGALAPGYHADFSMSPTLNPWQPERVFKAGEVA
ADEC_RHOSK      HGHIDHMIRTAIRLGAPPLAVYRAASLSAAEAFGLKDRGLIAPGRRADIAVLDSLEG-CHXXXXXXXXXX
ADEC_RHOS1      HGHIDHMIRTAIRLGAPPLAVYRAASLSAAEAFGLKDRGLIAPGRRADIAVLDSLEG-CHXXXXXXXXXX
ADEC_METTP      XXXXXXXXXXXXEAGTDPVAAIQMATINPARHFGLRRTGAVAPGYRADIIVMD--HDFNVRRVIFEGEEV
ADEC_DESDG      SGHMDDILRKAMAAGIPPVRAVQMASINTARYFRLHRRGAVAPGYRADFVLLDDLQTMRISECYLGGRNV
ADEC_LEUMM      EGSIDYSVKLAIENGMDPAIAFTIATYNAAQAHKLQNIGALTDGFVADLAVFDDLAHLETPKVMIGGHWY
ADEC_METBU      KGYMDVIVRRAIELGLSPLDAISMCTINAAKHYRVDHVGSLSMGRKADIIVLEDLEKFIIDSVYASGRPV
ADEC_MOOTA      TGHLNHVVRRAIEEGLNPIRAIQAVTINTAECFGVQDLGAIAPGRYADILFLKDLARVAIDKVMVDGRVV
ADEC3_RHIME     DGHMNRVVRHAISQGLKPITAIQMATLNTAQHFGLRDLGSIAPGRRADLIVTSDLTALPIEIVFVRGRLL
ADEC_RHOS4      HGHIDHMIRTAIRLGAPPLAVYRAASLSAADAFGLKDRGLIAPGRRADIAVLDSLEG-CHXXXXXXXXXX
ADEC_EDWI9      EGHIDALIRRLIQHHIAPHVAYRVASWSAARHFGLKRLGLIAPGKKADIVLLDNLEQVAIRQVF-AGGKA
ADEC_METBF      EGHIDKLLRRGQEKGLDIYNLIRAAVINPVEHYGLN-VGLLREGDPADFIIVDDLKAFNVLKTFIDGSCV
ADEC_BDEBA      EGHINYLIKELINKGVAVHVAYRLATYSAARHFGLKRLGLVAPGKKADLVFLKDLKAVDIQEVMIGGKFV
ADEC1_OENOB     EGSVDNNVRLAISKGIPAERAFTMASYNAAVAQHVKNVGALTDGFIADLVIISNLDNFVTEKVMTEGNWV
ADEC_RHOS5      HGHIDHMIRTAIRLGAPPLAVYRAASLSAAEAFGLKDRGLIAPGKRADVVALDSLEGC---HXXXXXXXX
ADEC_METS4      EGHLDALIRMAIGLGVXXXXXXXXXXXXXXXXXXXXDRGMIAPGRRADIVLLDDVETCAVARVIAGGR--
ADEC_METMA      EGHIDKLIRRGQEKGLDIYNLIRTAVFNPVEHYGLN-VGLLREGDPADFIIVDNLKSFNILSTFIDGECV
ADEC_ESCF3      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_SILST      EGHMNRAVRHAIDCGCDPLIAIQMATINTATHFGLREIGSITPGRRADIILTSDLKTLPIEVVIARGQIV
ADEC_STAMF      KGHMDRIINIAIEYGVDPVKAIQLATIGPAMRIHLEDHGVVGPARLADIVLSKNIEYIKPHTVIANGEII
ADEC_LEUCK      EGAIDFNVKLAIQSGMSPAMAFTIASYNAATAHRLDNVGALTDGYVADLVIIDSLDDFNIKKVMISGQWY
ADEC_METTH      EGHMDRILRRAVDYGIDPVSAVQMVTINPAEHYGLS-TGAIAPGWDADFVVVDSLRDFNVKRVYIDGRPV
ADEC_LACPL      EGSIDYNVRLAMQSGMRPELAYTLASLNGAMAHRLSDRGSLSAGQLADLVVLDDLEHVRIARTMKRGQWI
ADEC_SHISS      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECO7I      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECOLU      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECOL5      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECO81      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECOUT      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECOL6      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECOK1      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECO45      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECOLI      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECOLC      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECODH      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECOBW      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECO8A      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECO55      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECOSE      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECOHS      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_ECO5E      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEKL
ADEC_ECO57      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEKL
ADEC1_CARHZ     NGHMNWVVARIIKQGIDPVEAIQMVTINPATYFGLKHVGVLAPGKMADIVVISDLMDMKVEKVYIGGKLV
ADEC_SHIF8      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_SHIDS      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_RHILO      EGHMDRVVRHAIQQGLKPVTAIQMATINTAQHFRLREIGSIAPGRLADLLIVSDLAAMTIDEVYARGVRL
ADEC_METJA      DGYMLNILRKATNY-VSPIEAIQMVTINPANYFGFD--VGIKAGNEASFVIFEDLDNFKVYNIVIKGRFL
ADEC1_JANSC     DGHMNRAVRHAIDCGCDPLIALQMATINTATHFGLREIGQIAPGRRADMIVTRDLRTLPIEVVYARGQRV
ADEC_SHIFL      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ROSDO      DGHMNRVVRHAIECGCDPLVALQMATINTATHFGLREIGSITPGRRADIILTSDLRTLPIETVIARGQVV
ADEC_ECOSM      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGEPI
ADEC_ECO24      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_DESRM      EGHISFNVQKAIALGLNPIKAIQMATINTAKHFRLDHYGALTPGKVADIVLLDDLVEIKPAYVFKNGKLV
ADEC_METAC      EGHIDKLIRRGQEKGLDIFNLIRAAVINPVEHYGLN-VGLLREGDPADFITVDDLKSFNVLSTFIDGECV
ADEC_SHIBS      EGHIDALIRRLIEQHNVPLVAYRVASWSTARHFGLNHLDLLAPGKQADIVLLSDARKVTVQQVLVKGERL
ADEC_METS3      KGHLNESIKKAIDLEVSPISAIEMVTVNPSTHYNLN-TGAIVKGMQADYVVVDNLNDLNILKTYVAGKCV
ADEC_FLAPJ      LGHINLLCARAVAKGIDVFKILQVACVNPVHHYKMK-VGLLKKNDAADFIVVEDLVNFKVNKTYINGELV
ADEC_METNO      EGHLDHLIRTAIRLGVPPXXXXXXXXXXXXXXFGLTDRGMIAPGRRADIVLLDDLEXXXXEEALFAGRAR
ADEC_SILPO      DGHMNRVVRHAIACGCDPLIALQMATINTATHFGLRELGSTAPGRRADVILTSDLRDLPIELVIARGQVV
ADEC_SULNB      REHIDGHVRRAIAKGYDLFDVLRIASVNPVEHYGL-EVGLLRVGDPADFIVVEDLKDFKVLQTVIDGEIV
ADEC_METST      -GHLDKCLRKAVDYGMDPYEAIKLVTINPAEHYNLN-AGSISPGKSADLVFIDNLRDFTVKRVVINGNTI
ADEC_SHEHH      EGHINFMVKRLIQQDIPAYLAYRVASWSAAKHFGLRRLGLIAPGYRADINLVSTLDAVDIQRVLIAGEFV
ADEC_SALRD      EGHIDTLVRRALNRGYDRFDVLRAACVHPVEHYGL-DVGLLREGDPADFIVVDDLDALNVQETYVEGALV
ADEC_PARDP      DGHMNRVVRHAVDCGCDPLVAIQMATINAASHFGLRELGSITPGRRADVILTSDLRSLPIETVIAQGVVV
ADEC_DEIGD      XXXXXXXXRACVAGGLHPADAVALVTCNPAEYWGLHDLGLVAPGYHADFVLLRDLERFEVLDTFVGGVEA
ADEC_DEIDV      XXXXXXXXXACVXXXXXXXXXXXXVTCNPAEYWGLHDVGLIAPGHLADFVLLRDLQSFEVLETFVGGAEL
ADEC_BORAP      -GHINSIVARAIGYGHDFFDVLKIACINPVLHYKI-PVGLLRIGDPAXXXXXXXXXXXXXXXXYINGKLV
ADEC_PARD8      KGHINRMVKKSLDLGYDLYDVLRAASYNPAMHYKI-PAGFLREGDSADFIQVNNLKNLTIQATYIQGTCV
ADEC2_BACSK     RGHLNVLANKALAAGMKFEDVIYACTMAPAKRMKLEDRGAIAPGKIADFILLAEDGQFVFSAVYMLAFDA
ADEC_BORBU      -GHINLIVARAIKHGHDFFDVLKIACINPVLHVGLLRIGDPAXXXXXXXXXXXXXXXXYINGKLVFNDGI
ADEC_META3      EGYLINTLKKAV-KYVSPIEAIQMITINPANYFGLDME--IKPDNYADLIIFDDLEEFKINSVIIKGKXX
ADEC_CLOP1      KGHLDEILKEAVKLGMSIENAIYASTYTPARRMNLLDRGTIAPGKLADFILLDSIEDFNIYEVYKNGEMV
ADEC_CLOPE      KGHLDEILKEAVKLGMSIENAIYASTYTPARRMNLLDRGTIAPGKLADFILLDSIEDFNIYEVYKNGEMV
ADEC_ENTFA      KGHLNENVKKAVHAGLPIEKAIYMATYTPAKRMGLHDRGEIAPGKKADFLLLNDLESFDINTVYKSGKVV
ADEC_KLEP3      KGGIIALLNLLIEHGLPAVDALRFATLNAAIRLQRHDLGLIAAGRRADLVVFDSLEKLVAREVYVGGERL
ADEC_LACDA      KGHLNLLVKKAIDMGMRPEDAIYISTYTPARHMGLWDRGAIAPGRVADFIVLNNLEDLSIAQVYKNGLPF
ADEC_DEIRA      XXXXXXXXXTCVAGGLHPADAVALVTSQPAEYWGLHDLGVIAPGYHADFVLLRDLQHFGVLETFVGGEE-
ADEC1_DESPS     KGHMDNVVRQAIKAGVEPITAIQMATINSAEAYRIDHLGSITPGKIADIVMVDSLEGFQVQAVLTDGKLV
ADEC1_LACSS     KGHLDHLVRLAIAAGVAPMTAIQMATINSAEAYRIDDQGLIAPGRNADILLVSDLEAFEIKRVLAKGQPV
ADEC_KLEP7      KGGIIALLNLLIEHGLPAVDALRFATLNAAIRLQRHDLGLIAAGRRADLVVFDSLEKLVAREVYIGGKLL
ADEC2_OENOB     -GHLNSIIKLAVKCGLPLEWAIYMTTYTPAQHMHFQDRGVIAPGKIADFVVLNNLDGFSIKNVYKRGDKL
ADEC_SERP5      KGGIVALLNMLIEQGLPATDVLRMATLNAAIRLQRNDLGLIAAGRVADLVVFDSLTQLRAQQVYVAGKLT
ADEC2_RHIL3     GGGLDDVVRRLVRYGMKPEWAIRAATFNAAQRLKRSDLGLVATGRRADIVLFEDLTEFRARLVISGGRIV
ADEC_CENSY      KGHIDHCVREAVRLGADPVRAIAMASRNCFDYYNMRDLGGISPGRIADIQMLYDLESFRPEDVFVGGNRM
ADEC_METKA      EISLRKIVGRAIEAGFDPLESLSAVTLNPSLCYGLQS-GRLVPGFHADIVVVEDLENMELTDVWIGGKRS
ADEC_RUBXD      EGHMDFVVRHAIAQGVNPVTAFQMATLNPAEFRVSHDVGSVTPGRYADILLLEDLAEVRVSLTVAAGEVV
ADEC3_RHIL3     FG-LDWVTREAVKYGMRPEEAWAMGSLHGARFXXXXXXXXXXXXRRADLVLLS--DDLTPVSTWILDEAL
ADEC2_RHIEC     SGGLDEVARRLVRYGMKPEWALRAATFNAAQRLKRSDLGLVASGRRADLVLFEDLTELRARLVISDGRIV
ADEC2_AGRT5     XXXXXXVVRRLVRYGLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEDLNGFSARHVLASGRAV
ADEC4_RHIME     RGHLDNMVRMAMAMGISPMAAIQMATINGAEALRIDHKGSISPGRTADILIVNDLRDFRIEAVVANGTVA
ADEC_MESSB      FG-LDWVTREAMKAGMKPEQAWAMGSLHGAXXXXXXXXXXXXXXXXXXXXXFKPVNTWYGGELVVENRKI
ADEC2_JANSC     MGATDHNVRLAISAGLSPEVAIQMVTINPARHMRLTPVGSLAPGRFADIVLLDDLPSVSIRQVWADGELV
ADEC1_BRAJA     FG-LDWVVREAVKAGMSPEQAWSMGSLHGARFXXXXXXXXXXXXRRADLVLMD--DQLKPQCTWYGGELV
ADEC2_BRAJA     LGASDHNARLAIEAGLAPEIAIQCLTINPARHMRLTPFGSLAPGRFGDVVLLSDVGKLTIAEVWADGVQI
ADEC_BRASB      FG-LDWVVREAVKAGMSPEQAWSMGSLHGATRFAM-XXXXXXXXXXXXXXXXXXXXXXKPQSTWYGGELV
ADEC2_RHIME     DGGLDDVVRRLVRYGLKAEWALQAATLNAARRLGRADLGLIAPGRRADIVLFEDIRDFRALHVLANGRLV
ADEC1_BRASO     LGASDHNARVAIEAGLAPEIAIQCLTINPARHMRLTPVGSLAPGRFGDVVLLSDVGKLEIAEVWADGAQV
ADEC2_BRASO     FG-LDWVVREAVKAGMSPEQAWSMGSLHGATRFAM-XXXXXXXXXXXXXXXXXXXXXXKPQSTWYGGEVV
Y1085_PICTO     YMGMDDLIKIAISTGLNPFDAYSMASLNPAVYYNIDGYGGIAPGRLADMNFIRDL--YNPEPVFL----M
Y637_BACHD      QGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLDELGMIAPGRIAHLNFLDNVFNPVPTSVLAKGQWV
YERA_BACSU      GGMTNELIRIALEEGVPAIDAYNMASFNIAKYYQMDDLGVVGPGRLASLNILEDPLNPNPVTVLSKGTIL
Y751_OCEIH      DGVINTCIQIAIDKGIPLEDAYRMGSFHAAKHLRMDEEGSIAPGRIAHINILQEKEN-----PNPIG-VL
Y3012_BACCR     NGMTNVMISTAIKQGVPVIDAYDMASYNIARYYNMEHHGSIATGRIANINILESKENPVPISVLAKGKWV
Y3032_BACAN     NGMTNIMIATAIKKGIPVIDAYQMASYNIARYYNMEHHGAIATGRIANINILESKENPVPTSVIAKGQWV
HUTI_DEIDV      PGSLALAVRLC---GLTPPEALSACTVNAAHALGLRDRGALAPGQRADFLALHS----------------
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      ETSLSLSLKLVEEGRLDLNQLVSLMSCTPAKILGL-DRGTLKVGAVGDVTIIDPAKEWQVEAAKL--ESK
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      ETSLPLSLKLVEEGRLDLNQLVSLMSCNPAKILGL-DRGTLKVGAVGDVTVIDPAKEWQVEAAKL--ESK
PYRC_CLOD6      IIGLETSLALGIKNHLSMMQLIEKMSINPAKLYNLN-IGFIEEGAVADIVIFNPEEEWTVESFVSKADNS
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      PGXXXXXXXXCTLFRLTPEEALAGVTRNAARALGMQDRGRIAPGLRADLAVWD-----------------
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      ---------------------LQWMSINPAEKFGMEDAGELLPGKSADLAIFDLNKEYVIKEEDYLSKGI
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      KSKLETAFPICYENGVSLNELSKLMSLNPAKLLGMN-KGKISIGVDADLVLIDIDKKIKVDSNEFISKGR
HYDL_ARTAU      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      TSLLLAMNMACTLFRLTPEEALAGTTRNAARALGMADRGTLAPGQRADLAVWD-----------------
PYRC_CLOBB      KSKLETAFPICYENGVSLNELSKLMSLNPARLLGMN-KGRISIGVEADLVLIDIDKKIKVDSNEFVSKGR
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ASLLDAAFRVADDQS-NRFTAVKLVTKNPAQALNLQDRGVIGEGKRADLVL-------------------
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      PGSSPTSLPLCLQMGMTPAEALAAVTINAAHAINRHEIGSIEVGKKADLVLFD-----------------
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      -----------------PAEALSACTVNAAYALGLSDRGSLSAGQRADFLVLNTLGGNAVAEVYLAGAQL
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      ---------------------ISKLTINPARFYNL-DRGYIKEGHRADIVIFDPDEKYTVKEEEFQSKAS
HYDA_BACST      ----------------------------------------------------------------------
AGAA_ECOLI      ---VDAAVRNMVETGVTPAEAIHMASLHPARMLGVDGLGSLKPGKRASVVALDS--GLHVQQIWIQGQLA
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      PGSSPTESLACLTMKMTPEEVLAASTINAAHAIGAKDIGSIEAGKNADLVLFDA----------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
HUTI_RHORT      ----------CVLFRLTPEEALAGLTRNGAKALGLSDRGVLAPGLRADFALWD-----------------
HUTI_NOCSJ      PGSFTSSIPLCIEMGMTPAEAVHAATYRGAQALGQHGIGALVPGRRADLAVLDA----------------
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ---------------LTPEEALAGTTIHAARALGLSDTGRIAPGFRADLAIWEA----------------
HUTI_RHOS1      ---------------LTPEEALAGTTIHAARALGLSDTGRIAPGFRADLAIWEA----------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      K-EIDMALVGGVSLYLTPESYMSMCELSPDGQCKAFDNGAFVPGEGAGALVLKRLKDAEADRDHIYGIII
ENO_ANAVT       VGA--TSFREALRWGAEVFATLSEVLHDKGLLTGVGDEGGFAPNLESNQVALELLVDVAASEFYKEGQYV
ALN2_DICDI      ----------CKNRGI-PITQLSEWLSNPSKLVGLNDRGSIEIGRDADFVIFNPNESFIVNE--------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ---------------LTPEEALAGTTIHAARALGLSDIGRIAPGFRADLAIWEA----------------
ENO_ANASP       VGA--TSFREALRWGAEVFATLSEVLHDKGLLTGVGDEGGFAPNLESNQVALELLVDVAASEFYKEGQYV


                         .         .         .         .         *         .         .:420
query           SQGNEYLGEVNYYPIDSVESSMHVKDFTREKLQLHLNSDKVRAIGVVPGEVLTTEEHVTVKRDGDGNFVY
ADEC_LACS1      SQGNEYLGEVNYYPIDSVESSMHVKDFTREKLQLHLNSDKVRAIGVVPGEVLTTEEHVTVKRDGDGNFVY
ADEC2_DESPS     ADSGKYLPEIKRHDISSTKGNFKVKDFSVKKLKLAIQSPQAHVINILPGGVVTSKEVVAINRNSDNEFVY
ADEC2_LACSS     AANGAYLTDDSVAGFDDLLETVHLDNFSADQLKLNLTSDKAHVIGL--QSISRTQNLVPVAHDAEGDFHY
ADEC2_CARHZ     AENGKPL--FTGYPVDAVRNTMRLKEINPEKLKIPAKSNRARVIGLIPHQIVTKKLELEVPVEG-GYFKT
ADEC_DESVH      ARDGAVVVDLPDHADPAVRDTVNIRPLDDTAFRLPLPTGLARVIGLQPHSLLTDALERDVPRDASGCFTP
ADEC_DESVV      ARDGAVVVDLPDHADPAVRDTVNIRPLDDTAFRLPLPTGLARVIGLQPHSLLTDALERDVPRDASGCFTP
ADEC_CLOBB      VDNGEIKKEEFKINDNSKELAMNMKELEKNAFKIPLSSDLCNVIEIVPNSLIT--YHRVEKVDIDGNFSV
ADEC_CLOBA      VDNGEIKKEEFKINDNSKELAMNMKALEKNAFEIPLSSDLCNVIEIVPNSLIT--HHRVEKVDIDGNFSA
ADEC_CLOAB      FKDNKHLKDMSKSDITKVSNTVNIKKVSEENLELKLDTDVCSIISVALNSISTK----NVKRKSNGIFKC
ADEC_DEHE1      AEKGQVLFKPQSHVPKSLLSSMHIKPFDIKDLAIKGSSTQMPVIEVIPGQIVTRRLNLKIPAE-NGVLTP
ADEC_BACHD      AKNGKLIVPITVQPPQRLLESVNMKLVTKXXXXXXXXXXXAHLIQIQPGSIVTIREKVAVK---DGVFIP
ADEC_BACP2      AQNGEYKPSVKIAPSPALLQSVHAIDVQEEDIALPITGDQMNVIRIIPNQLETKLEQVS-PSEMNGQFTS
ADEC_OCHA4      SE-DLFAARKTVAPVG--RNXXXXXXXXXXXFRSHSNSGKTRAIGIIPGKIITESLEFDLK-VGPNGVEP
ADEC_KOSOT      AENGKLVIDINQFPLEEV-NTFKCPHIEEKDLEVLNKGENIRVIRVYGDDVLTKELRMEPKTK-DGRIVS
ADEC_BRUSU      FAARKPVAEVG-------RNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNG--VE
ADEC_OCEIH      VDEGEYFAASLTYDATTLPKP-RIQQLKASDFSIDLTDDYCNIIEIVPNKIITNHERVEVK---EGKFVP
ADEC_BRUAB      FAARKPVAEVG-------RNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNG--VE
ADEC_BRUA2      FAARKPVAEVG-------RNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNG--VE
ADEC_BRUME      FAARKPVAEVG-------RNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNG--VE
ADEC_PETMO      AENGKALFQVNSNNFETIFHSVNIAPIREEDFKIP-KGKTYRVINMIQDQIITXXXXXXXXXXXXXRFI-
ADEC_DEHSB      AEKGQALFKPQSRIPKSLLNSIHIKPFNTEDLVLKTXXXXXXXXXXXXXXXXTRRLDLKITAE-NGVIKA
ADEC_BACLD      WSGTEQSQSTGGKAASGLLQSVHLSDLHENDLQIPIQENEIRVIDIIPNQL---ETKLSLAKPKSGAFFQ
ADEC_DEHSC      AEKGQALFKPQSRIPKSLLNSIHIRPFDTKDLILKTXXXXXXXXXXXXXXXXTRRLDLKIPAE-NGVIKA
ADEC_LISW6      VENNEAAFEKKHSETFISPKIQH--HLSKQDLELPLTNDTCYVIGMKQNNLFTEKEQVNVE---NGKFVP
ADEC_CLOD6      NE--EMFSNYNYEIKDELLNTVKFKYINKEKIQLKV-SEKNYVMEIVPYQILTNKVYESLP-CADGYFVP
ADEC_BACA2      AENGRTVYEQSYSPDQALLDTVRLKAPLTES-DFHIEGKKMNVIEMIPNHLETRKKEVPA--PSADAFCP
ADEC1_BACSK     AEKGELTSPIRTYPVERLLNSVHLAPFAREDLTLKLNAHSTPVIETTLGSIVTKKAMASVPAE---NGIF
ADEC_LISMO      VD-NGVRNEAAFVPFVSPPINHHVH---LQDLALPLTKETCYVIGMQPNSLFTEKEQVTIQ---GGKFVP
ADEC_LYSSC      AENGEMLTSRQEAKVPAIHHSVHLPSMTKDSLQLSFKGTRANVMEIVPNQLITNHLVIDVPVK-EGVFVP
ADEC_LISMF      VD-NGVRHEAAFVPFVSPPINHHV---SLQDLALPLTKETCYVIGMQPNS-LFTEKRIEQVAIQDGKFVP
ADEC1_RHIME     TDA-LFAGRKPVEPVGL--DSVKAREVKAADFGLPYNEGETSVLGVLPGKIIT--EHRRYRLPAEGNRTG
ADEC_LISIN      VENGTRXXXXXXXXXXXXXISPKINHHLSIKLELPLTNETCYVIGMQQNNLFTEKEQVTIK---NGKFVP
ADEC_THEAB      RINMNVESIIRNIP-NTLGKINIVKNYS---LSIKNRNRKIRVISVKSGTLLTDE--LIVEPNVEKGYVV
ADEC_GEOKA      AQH----GQTVFPAERSAESSIRCQAVDETDLRIPMRGTKAHVIEIIPNH-LHTNHLITDVDVQEGAFCP
ADEC_ARCFU      ---PEF---KRFNHPEWAKKTVKARKITPESIQ--LKTGRVRVIEVYDGEIVTGEAIEEVQG-------V
ADEC_DESAA      VEDGCGLPSPMDPPPRPQTSSMNV-DVDGLDFTIKAGSGKARIIKLIPDQVVTAAMTGDVLQK-NGEALS
ADEC_THEM4      KDGKIDLKIESVF--KDVPTTIGKINITKNYSXXXXXXXXXXXXXXXXXXXXXTEESIVSPKVSKNEIIS
ADEC_RHISN      TDAL----FARRKPVEPVGDSVKAREVKAADFGVPYSEVETSVIGVLPGKIIT--EHRRYRLPAVGNQTG
ADEC1_RHIEC     SDA-LFATRKPVAPIGL--DSVKARPVNAAHFGVPVAEGETSVIGVMPGKIIT--EHRRYRLPAKGNETT
ADEC_BACSU      AEDSKYQDHASTAAPDQLDSVKLAAPLNKQDFHMPIDSEXXXXXXXXXXXXLET-RLVQVPAPVAREFEP
ADEC1_AGRT5     VDDALFATRKPVAPVGL--DSVKARPVLASHFGVPVTEGETPVMGVLPGKIIT--EHRRYKLPTDGNQTT
ADEC1_RHIL3     TDA-LFSSRRPVAPIGL--DSVKARPVNAAHFGVPVAEGETPVIGVIPGKIIT--EHRRYRLPVRGNEAA
ADEC_METB6      A---EYAAPQARPP---VFAALRCTVPSRDQIRL-FGTGRARVIGLVPGQILT--ESLTF--DLDAAALP
ADEC_DESHY      EREK----KIDIKPCEQLRRTVHLPALSAEDLKLAVPDSPSSLIQMSEGQI-TTKHVRDVLPARDGCFVP
ADEC_DESHD      DREKKI--EIKPCP-EQLRRTVHLPNLSADDLKLAVPDSPSSLIQMIEGQI-TTKHVRDVLPAQDGCFVP
ADEC_CLOBL      AKGGLLTTSIAKYPEDAM-NSMHIKNITPDSFNIMANKEKIRVIEIIPERVGTYERHIELKVKDD-KVQC
ADEC_CLOB1      AKGGLLTTSIAKYPEDAM-NSMHIKNITPDSFNIMANKEKIRVIEIIPERVGTYERHVELNVKDD-KVQC
ADEC_GLUOX      FNSREIVSPV------GLESVKLPRPVTAQDMAVEGSGRDRPVMGVIPGQIITEFLRLDLPED-HGHVLP
ADEC_CLOB6      AKDGVLTTSIAKYPEDAMHS-MHIKDITPASFNIMANKEKVRVIEIIPERVGTYERHIELNVKDD-KVQC
ADEC_CLOBM      AKDGVLTTSIAKYDYENAMHSMHIRDITPASFNIMANKEKVRVIEIIPERVGTYERHIELNVKDD-KVQC
ADEC_METMJ      V-------DAGYLPPACPKSPMHARVPEPGDIRI-TGRGEARVIEIVPGQITTRDLRYPVDAAG----IP
ADEC_SYNFM      XXXXXXXXXXXXXXVAAPPSPMHITRLLAEDLVVPAQPGLLRIIGVREGTLL-TRKIVLPPKIHEGAAVA
ADEC_RHOSK      XXXXXFSARSGVEPV--ARASVKVAEIAPEAFRCPGNRAETPVIGILPGKIIT--EHLTAEIEPDGDKRP
ADEC_RHOS1      XXXXXFSARSDVEPV--ARASVKVAEIAPEAFRCPGNRAETPVIGILPGKIIT--EHLTAEIEPDGDKRP
ADEC_METTP      ARDGRLTASFESKRL-PVQTSMNVRPITRESFRIPATGRIVRVIGVAPNQILT--ETIAARPERNGEVIS
ADEC_DESDG      KE-IDFTGHSAAFSANTV----HVAGLNTDSLHVAAGNGNLRVIGIVPGQVITLELPPTLR---EGAAVA
ADEC_LEUMM      KDNQSIVTPLANQSLNF--------SLTKSDIALPLQSDKPAXXXXXXXXXXXXXXXXXXXXXXQGLFVA
ADEC_METBU      ----ESFVPSYEYP-DTVFNTVKFDAVTATDLQIMSDADKVRVIKVVPDLIVTENETFVLHSDRHGILMP
ADEC_MOOTA      AAGGRLLVDLPAYP-DRVRHSVHLKELTPWHFRINAPAGKVRVMEIIEANVNTRHLTVTVP-VVDGQVTA
ADEC3_RHIME     AEKGVLVADIPAYDYNTVKLGKRLAPTDFDICAAGSSEVEVRVIGVIENQAPTLQRRLPVE---CGVVQM
ADEC_RHOS4      XXXXXFSARSDIEPV--ARASVKVAEIAPEAFRCPGNRADTPVIGILPGKIIT--EHLTAEIEPDGDKRP
ADEC_EDWI9      IDAQQLLRSAAMRQLASCHNTLRRAPLSAEDLTLPLTQDDYRAIQLIPNELITPAR--TVRWLGDG----
ADEC_METBF      YNDGKVLFSVEQAPVDDVKLAMPASGNNGEQMK------KIRVIVAQDGELVTGQE-LALPKVENGNLIS
ADEC_BDEBA      SELQDSLQEKLQTSQPPLENTMKRSPLTEKELTVNLLPGVYNVIEIVPHEIIT--QHLTVAFDGQ-KFA-
ADEC1_OENOB     ---DKLESKVTTFTSPAVNAELSLND-----LKLPLKSDKAHVINIQPEHITTKHTIESVNRDQQGNFVA
ADEC_RHOS5      XXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXFRCPGNRAETPVIGILPGKIIT--EHLTAIEPVDGDKRP
ADEC_METS4      -PAEEALXXXXXXXXXXXXXSVKAAPVAPEAFRVAAAPGETSVIGVVPGRIITEHRRLTLPA-RDGAALC
ADEC_METMA      YENGKVLFPLEKVPIDDVKPAGAIQEQTTEK-----GIKKIRVIVANDGELVTGQELIVPKIE-NGNLVS
ADEC_ESCF3      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_SILST      AESGSIKVECPHWP-ESARGTVHLTDFELAAPE-GANAVTANVIGVVPTKALKAELPV---RDG----LV
ADEC_STAMF      ----YYKGELNYYPEETLNTVKLAKIPEPQEFIPKINTREANIIEVTPGSALTKHEELAVK---NYNVLA
ADEC_LEUCK      VE-----PETTVLPLANQSLNF---TLTVDDLKLPINDKKAHVIEIMPHHITTTHLVEDVPSQ-EGLFVA
ADEC_METTH      ADRGRYLGGTRAPP-----RKLEVPDFPVERLNIRAEGDEVRVIDVLDGQLITEELIATLEVE-DGTVQA
ADEC_LACPL      LPSTT---KPLPFTATRVQHHAQLADF-----QLPLATGLANVIGVQPNHIET--DHLTLPIDATQNFEA
ADEC_SHISS      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECO7I      DQAKEYGNTISRQPVSASDFAL---QFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_ECOLU      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_ECOL5      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECO81      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECOUT      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECOL6      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECOK1      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECO45      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEVIHNELITHSRSSVYSENG------
ADEC_ECOLI      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECOLC      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECODH      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECOBW      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECO8A      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECO55      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECOSE      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECOHS      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECO5E      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_ECO57      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC1_CARHZ     AEKGKMVVNIPKYTYEEVKHSVKCKPVTAEALEIKATGSNVRTIGLIPDQNLTESFEFTVPVSG-GVAQP
ADEC_SHIF8      DAQTLQAEESNTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_SHIDS      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_RHILO      AKGGKLDIDIPAYDYNTVKLGKKLRDITAPK---GANEVRVRVIGVIENQAPTRALEADLPVE-DGLVAM
ADEC_METJA      ---DDVLNELNKNKKRKIPEKLNEGDFLIKGIDYKERDGFIRVIKPLKDSLITEELIFSTEEIK----IL
ADEC1_JANSC     AQFGECLVECPHWPTDTRHSVNLGKSLTAADFEIRSDAAEVTAIGVVPTKALTQTRHGVVEPDG------
ADEC_SHIFL      DAQTLQAEESNTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSRSSVYSENG------
ADEC_ROSDO      AEDGHCLVECPHFDWPAARQTVHMDDFTINAPK-GANAVTANVIGVVPTKALKFELPVTEGR-------V
ADEC_ECOSM      DQAEEYGNTIDRQPVSASDFAL---QFTPGK--------RYRVIEAIHNELITHSRSSVYSENG------
ADEC_ECO24      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_DESRM      AQGGKLTQEISQYPAFLNETVKLPPNLTSFALPSQGNRCKVNVINLYPDQIINFASQEWLNVAG-GEVQV
ADEC_METAC      YENGKVLFPMKKVPAKNVFNRNKISDAAKLAVPAEETGDKIRVIVARDGELVTGQELAFPKVE-NGNMVS
ADEC_SHIBS      AQSAPPYG--NTIARQPVSASDFALQFTPGK--------RYRVIDVIHNELITHSHSSVYSENG------
ADEC_METS3      FDGENVLFDVNTFDVSKKES----EDF---EISCDEPSADVNVIRCFNGELITEAESATL--ETKKGFVQ
ADEC_FLAPJ      AEGQSFVENINFTPNNFNITKKKISDFEIPSL-----AEKIRVIEALEGQLITNEIHHNIK---NGKLVS
ADEC_METNO      TPA-PGRGSVKAAPVAAEDFRIPGAD-----------GAETSVIGVVPGRIITEHRRLELPA-ANGCAGC
ADEC_SILPO      AENGKIAVDCPHYDPDTARGTVHLRDF---EIAAPTGANRVRAIGVVENQAPTKALKAELPVREGLVETA
ADEC_SULNB      ARGKKPL-------IDSVETPNHFHTGIKKEEDFILER-------CVHTEIIHALDHSLITEEEIMDLSS
ADEC_METST      FKKQKLLFRANPRPID---TTLHVEDFDLKAQNPAHKSATVNLINVSDNTIITKQSSAKLSIQ-KKTIIP
ADEC_SHEHH      DXXXXXXXXXXXXXXPPLHNTVKHRPITEAELTIPLKEGEYRVIGVVKDELLT--NHLVCHFDGQ----H
ADEC_SALRD      AEEGETHIE---HVASDVVNRFDAEPVAPADFRVPAGGDRLRVITAVDNQLGTGEEVVTTPTD-DGYAVA
ADEC_PARDP      AETGKLLVDCPAWP-EAARDSVHLRSLTGADFAVRATGDRVRVIGVVPTRALTAQLPI---RDG----VV
ADEC_DEIGD      QAGSETXXXXXXXXXXXXSWATATFEVPASWPVMQVRPDQITTGVGAPG-------------SGDARLVV
ADEC_DEIDV      SGGGVHLGQGWDAATFEVPPGWPV-------LGIH-------------------AEQITTSREPEGS---
ADEC_BORAP      SDGISHIPLISEIPINNFNSEKSILDFK------FSTKNKMXXXXXXXXXXXXTQKTMIDSNLLAPDFQS
ADEC_PARD8      -----YDGEKCTLPFHKLRNNFHTKPIPLEKLAVKAKGKQMRVIVCEDRELITKEELYPVHTDG---FVE
ADEC2_BACSK     ASPYKQTPKPRQFPPHFYES---VKLAPLQEEDFHVVADRCRVMNVADGSTFTTQERVPV---ANGLLQW
ADEC_BORBU      SXXXXXXXXXXXXXXCSKKSISDFKFSTKNKM--------IPVIKCISNQIITHKTMIDSNLLAP-DFQS
ADEC_META3      XXXXXXXXXXXXXXXYKTENDFLIDGIDGGGAPISTNS-KVRIIEPIGSSLITNEIMLNI----DDAKTK
ADEC_CLOP1      FNRDKGLKEEFFEDKSKLDNSIELNNITKESLEXXXXXXXCRTMKVLKNTTFTEEGEVTL--NVYNNILQ
ADEC_CLOPE      FNRDKGLKEEFFEDKSKLDNSIELNNITKESLEXXXXXXXCRTMKVLKNTTFTEEGEVTL--NVYNNILQ
ADEC_ENTFA      FEKGEYPEKIEEFPA-TYQQTIQCKKLTEEDLLLKVATTKVRCNVIQKQEIGTFTERITKEIPVENGLLQ
ADEC_KLEP3      AHAGRLLKPIAPAPVTPPRDTLPIAPLRADDFVLRVQGIRVARLRHIRGARFTQWGEVEVQRDGKVQL--
ADEC_LACDA      AAKDE--KDNNVYPEELLHS---VKAPKLSEADFDLKTDLVQNGKVVANEVGTFTNHIQKCLEVKDGHVQ
ADEC_DEIRA      ----------------------------------------------------------------------
ADEC1_DESPS     ARDKKMSYELKAPARSSVLSALKCATTTPEDFQYRVEIEQGTAEVLVKGPFVRKRRDVTLQ--VANHIVQ
ADEC1_LACSS     ATD----GHINQSIERPVRPASLANTIIREAVQAHVAADASQVTVQTIASEGPFVRHAKTKTVEDGIVQI
ADEC_KLEP7      ARAGNLLTPIATPPRDTLQAPLRADDFILRVQGIRHGIARLRHI---RGARFTQWGEVEVQRDG----IV
ADEC2_OENOB     SIDDEKFASEEYHSIYVPNRS--AKDFTKDLKKITANVIEIAAKGTFTKAV---KKELLVK-DG---IVD
ADEC_SERP5      AQQGKMQKPLNANPVAAPRDTLRLQPLAAGDFVLKVPAIRKATLRHIKGARFTQWNETTVERNGEVQI--
ADEC2_RHIL3     ARNGSMQVAVQQIDTAPLVNSVKLPPLTENDFRIPAKGERVRVATIDRPRFTQWGEAETEVRDG---FIV
ADEC_CENSY      VSGGKLVS--RQHPVKATRRTIRLGRLTAADFAVHSRKKTEQVNTITMKTEIITEQGSAELSVKEGNVEP
ADEC_METKA      ERVRFRDAEAE---LPDVELSVDPREVSFQD-----GKYEVRCVGLVRGSIRTEE----IVREITXXXXX
ADEC_RUBXD      AEGGRMVAELEPYDYPAVAGGLGPEDFD-IPAPXXXXXXXXXXXXXXXNHVETRGEWVELPVEG-GLVRL
ADEC3_RHIL3     SKPYRY-PDAAYHTVKLPKNLKLTPDLPTETVVAH--TIKTELPGITLGHVTVTLEPA---NDWQAHF--
ADEC2_RHIEC     ARNGSM--EAAVQPLDTAPNSTKLPPLTESDFRVPAKGARVRIATIDRPRFTQWGEAETEIRDG---FVV
ADEC2_AGRT5     AEGGRMLVDIPTCDTTVLKGSMKLPLRMANDFLVKSQGAKVRLATIDRPRFTQWGETEADVKDG---FVV
ADEC4_RHIME     ARGRMVVKLVPPQRSAGLLRSVKTTPVTAADIAVPFTGTEVLAIAVTPEKVFVRTRRDVRLPVVDGKILA
ADEC_MESSB      TPLLDTALSNRYYP----EAAYHVKLPKAVKLTPELPTARVVAHTILPG-ITLGHERITLEPSNHWQDHF
ADEC2_JANSC     AEDGTYLKPIP--KIDKIDRAMMADDFA---IPAKRGRDTMHAALLRPFH--WDDDFITMDLPKDGQVQR
ADEC1_BRAJA     VEHDQALSQRYQYP-KAAYATVKLPEKVKLTPELPAKACTVNAIKTALPGITLIHEKVAIEPAKDWPTLF
ADEC2_BRAJA     SEGERYIGQVPVWPTVNIKRSIKPQDF---ELRAEPGRATMKAAVIRPPEFYTLELPVR-----DGAVQR
ADEC_BRASB      VENDQALSQRYQYP-KAAYATVKLPAQVKLTPELPTKACTVNAIKTALPGITLIHDKVAIAPASDWPTLF
ADEC2_RHIME     ASGGGMLQAPVAAGVSPLRHTMKIEPLTEDDFRIAATGSTARVVTIDRPRFTRWGE---TRAEVSGGYLV
ADEC1_BRASO     SEGTRYLGDVPAWPDWATQTINIKREIKAEDFALPAAPGRTTMQAAVIRPFHWHPEFYTFEAVRDGAVQR
ADEC2_BRASO     DQGDQALSQRYQYP-KAAYATVKLPAQMKLTPELPAKACTVNAIKTALPGITLIHEKVAIKPANDWDTLF
Y1085_PICTO     LDGKIIDKEVKLDPPDWKGYGMLYKNRNIDINKINFNSDETL---FMRNQVIMDLNKYKMEDSMEIHLIT
Y637_BACHD      VRDGQRYGSDSVFPWEDFGMKRLTIDWDLSVDELHMGIELVNSVILKPYQVSVEASRDTLAEDHDECF--
YERA_BACSU      RENGKAFTKTDWHKGGLVPLELSY-DMTMDDLQFSM------PMGVKMRNAVIMEPYM-IEIDNSMEQLS
Y751_OCEIH      AKGEWIVKETKEIDIPSI-IDWSKYEINEMNIDWNLTEDDLQFSVPVGMDVVNDVIIKPYTIDSDVSFEL
Y3012_BACCR     KRDGVNTHEALHIDWSKHKVTPLSLDWSIEKEMIFSNKTGIHLLNNVITKPYTSEINI------DCDELS
Y3032_BACAN     KRDGVNTHEALHIDWSKCKVTPLSLEWSIEKEMLFSNKTGIHLLNNVITKPYTSEINI------DCDELS
HUTI_DEIDV      ----------------------------------------------------------------------
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      SKNSPFLG--------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      SKNSPFLG--------------------------------------------------------------
PYRC_CLOD6      PKGKSLYGKVNY----------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      N--TPFTGEKVY----------------------------------------------------------
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      NEGMEYYGEV------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      ----------------------------------------------------------------------
PYRC_CLOBB      NEGMEYYGEV------------------------------------------------------------
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      NSGKELFGKV------------------------------------------------------------
HYDA_BACST      ----------------------------------------------------------------------
AGAA_ECOLI      S---------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      ----------------------------------------------------------------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      GSGINQDGKTNGITAPSAKS------------QMDLERDIYETYGIHPESISYVEMHGTGTKQGD-----
ENO_ANAVT       YDGRDYLGQVDQYPIVSIEDGLHEEDWQNWQLLTQKVGSRVQLVG-------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       YDGRDYLGQVDQYPIVSIEDGLHEEDWQHWQLLTQKVGSRVQLVG-------------------------


                         .         .         +         .         .         .         .:490
query           NDQEDVTKIVVVERHHNTGNVNVNLLSXXXXXXXXXXXXXXHDSHNIIATGTNDDDIFMAVNELIKQEGG
ADEC_LACS1      NDQEDVTKIVVVERHHNTGNVNVNLLSXXXXXXXXXXXXXXHDSHNIIATGTNDDDIFMAVNELIKQEGG
ADEC2_DESPS     GHGQDVVKIAVVERHQNTGNVAVALLQGYGIKRGAIALSVAHDSHNIIVVGVDDTDMACAVEALIAQDGG
ADEC2_LACSS     KPSEDIVKVAVVERHHLTGNVGVGLLSGFGLQNGAIATSIGHDSHNLVVVGTNDADMVVAIDALKACXXX
ADEC2_CARHZ     STEKDIAKLAVFERHNYTGNVGVGLIHGLGLKKGAIASTVAHDSHNLVVAGMSDEDIIAAVEELKRIGGG
ADEC_DESVH      GD--GLVKLAVVERHKATGNVGVGIIEGYGLRGGAVATTVAHDSHNIVVAGDNDADMLVAVRELERTGGG
ADEC_DESVV      GD--GLVKLAVVERHKATGNVGVGIIEGYGLRGGAVATTVAHDSHNIVVAGDNDADMLVAVRELERTGGG
ADEC_CLOBB      SIANDQLKMAVIERHHATGNIGLGIVKGFGIKNGAIATTVAHDSHNIVVVGTSDEEMFLAVNHLKKMNGG
ADEC_CLOBA      SISNDQLKMAVIERHHATGNIGLGIVKGFGIKNGAIATTVAHDSHNIVVVGTSDEEMFLAVNHLKKMNGG
ADEC_CLOAB      ELNYGINKVAVIERHKKSGSIGIGLVENFGLKRGAIASTVAHDSHNIIVLGNNDEDMVKAVNEIERVGGG
ADEC_DEHE1      DIEQDLLKIVVLERHCQSGNIGRGLIKGFGLKKGAIASSVAHDSHNVIAVGTNDADIYTAVKELERINGG
ADEC_BACHD      SVARDQLKLVVAERHHKRGTVGVGIVKGFGLTKGAIATTVAHDSHNIVAVGTNDEDLLAAIKELENIQGG
ADEC_BACP2      DTGRDVLKMVLVERHQGLSEMGVGIVSGFGIKQGAIATTVAHDSHNLIAVGTNDADIIKAIEALKEAGGG
ADEC_OCHA4      DFEKDVVKIAVVERHGKNGNIATGFVHGFGLKSGAIASTVSHDSHNICVVGTSDEDIAAAANRLGEIEGG
ADEC_KOSOT      DVNRDILKVASICRYCEEKSMAIGFINGTGLKQGAVATSVGHDAHNMSVIGTNDADMVVAANRVIDMGGG
ADEC_BRUSU      PDLEDVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAANRLGEIEGG
ADEC_OCEIH      SVDKDQLLIAVVERHKGLGYIGKGIVKGFKMKEGAIATSVAHDSHNFVVVGTSEEEMLSAIKKVEQLDGG
ADEC_BRUAB      PDLEDVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAANRLGEIEGG
ADEC_BRUA2      PDLEDVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAANRLGEIEGG
ADEC_BRUME      PDLEDVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAANRLGEIEGG
ADEC_PETMO      --RYNINKIAVVERHKSTGKIGLGLIRGFGLESGAIASSIAHDSHNIIVLGTNSCDMKIAVEKIAEIQGG
ADEC_DEHSB      NTELDLLKIVVLERHHQSGNIGHGLIRGFGLKKGAIASSVAHDSHNVVAVGTNDADLYTAIKELERINGG
ADEC_BACLD      PDLEDLLKIAVVERHRGVKEIGLGVVRGFGLKEGAIATTISHDSHNLIAVGTNDQDILKAIERLGEIGGG
ADEC_DEHSC      NTELDLLKIVVMERHHQSGNMGHGLIRGFGLKKGAIASSVAHDSHNVVAVGTNDADLYTAIKELERINGG
ADEC_LISW6      SIEKDLLKMAVVERHHNTGCVGVGIVKGFGLKEGAIATTVAHDSHNIVAVGASDEAMEKAINYVTEMGGG
ADEC_CLOD6      N--KEYSKLCVVERHRMTGNVAIAPLKGFGIKNGAIATTVAHDSHNIIVAGDNDDDILVAINYLKEIQGG
ADEC_BACA2      DTENDLLKIAVAERHSGEKMIGLGIVQGFGLKEGAIATTISHDSHNIIAVGTNDADLAKAINRLRDTGGG
ADEC1_BACSK     QPGGKWLKLAVVERHEATGHIGLAIVKGFPFSEGAIAATVAHDSHNLIAVGADDESLYHAIHHVAGLGGG
ADEC_LISMO      TVENDLLKMAVVERHHDTGCVGVGIVKGFGLTEGAIATTVAHDSHNIVAVGVSDEAMKAAIDHITQTGGG
ADEC_LYSSC      SIEQDLLKLAVIERHHHLHTTGLGIVKGFGLQKGAVATTVAHDSHNALVVGTNDEDMILALSRIQEIQGG
ADEC_LISMF      TVENDLLKMAVVERHHDTGCVGLGIVKGFGLTEGAIATTVAHDSHNIVAVGISDEAMKAAIDHITQTGGG
ADEC1_RHIME     VDDRDIIKVAVIERHGVNGNHANGFVQGFGLKKGAIASTVGHDSHNICVVGVNDDDMALAVNRLGEIKGG
ADEC_LISIN      SIEKDLLKMAVVERHHNTGCVGVGIVKGFGLTEGAIATTVAHDSHNIVAVGVSDEAMEKAIDHVTKTGGG
ADEC_THEAB      SDDRDIIKIAVFDRHKASG-YSIGFVHGLSIKNGAVATTIGHDSHNLTVVGTNDEDMNYAISRIKELNGG
ADEC_GEOKA      SIERDLLKLVVVER-HXXXXXXXXXXXXXXXKAGAIASSIAHDSHHIIAAGTNDRDLTAAIEQLRQQHGG
ADEC_ARCFU      DVERDILKAVVVERHIRSGRVGKAYVRGFGLKRGAIAQSIAHDAHNIVCVGVDDGSICAAVNRVIELQGG
ADEC_DESAA      DPGNDILKIAVVERHKGTGNIGLGFVNGFGLQKGALASSVAHDSHNIIXXXXXXXXXXXXXXXXXXXXXX
ADEC_THEM4      DVENDIVKIAVFDR-HNASGFSIGFVKGTGIKNGAIATTIGHDSHNLAVLGTNDKDMELAIKRILEINGG
ADEC_RHISN      PDGRDIIKVAVIERHGVNGNHANGFVQGFGLKKGAIASTVGHDSHNICVVGVSEEDMALAANRLGAIKGG
ADEC1_RHIEC     VDTNDIIKVAVIERHGKNGNHANGFVQGFGLKKGAIASTVGHDSHNICVVGVNEDDMAYAANRLGEIKGG
ADEC_BACSU      DTELDLLKIAVVERHKGLKETGLGVVKGFGFKSGAIATTISHDSHNIIAVGTNDEDIAAAVNKLQEIGGG
ADEC1_AGRT5     VDLEDIIKVAVIERHGKNGNHANGFVQGFGLKKGAIASTVGHDSHNICVVGVSEDDMALAANRLGDIKGG
ADEC1_RHIL3     VDANDIIKVAVIERHGKNGNHANGFVQGFGLKKGAIASTVGHDSHNICVVGVSEDDMARAANRLSEIKGG
ADEC_METB6      DISRDLLKLVVCNR-YGKGSVGTGIVHGFGFKDGAIAASISHDAHNIVAAGTGDEVILSALTAVIRAGGG
ADEC_DESHY      NAQ--YNKVVVVERHKGTGHFAVAPVLGFNLGQGAIATSVSHDSHNVVAIGDNDESILLALQELQRVQGG
ADEC_DESHD      NAQ--YNKVVVVERHKGTGHFAVAPVLGFNLRQGAIATSVSHDSHNVVAIGDNDESILLALQELQRVQGG
ADEC_CLOBL      DPNKDVLKAVVFERHHETGKAGYGFVKGFGIKRGAMAATVAHDAHNLLVIGTNDEDMALAANTLIECGGG
ADEC_CLOB1      DPSKDVLKAVVFERHHETGTAGYGFVKGFGIKRGAMAATVAHDAHNLLVIGTNDEDMALAANTLIECGGG
ADEC_GLUOX      DPEQDVAKVCVVARHGHNDNIGRGFVRGFGLKEGALASSVGHDSHNICVVGTSDADMACAVNHLEKTGGG
ADEC_CLOB6      DPSKDVLKAVVFERHHETGKAGYGFVKGFGIKRGAMAATVAHDAHNLLVIGTNDEDMALAANTLIECGGG
ADEC_CLOBM      DPSKDVLKAVVFERHHETGKAGYGFVKGFGIKRGAMAATVAHDAHNLLVIGTNDEDMALAANTLIECGGG
ADEC_METMJ      DLDRDILKAVVIDRYRATGS-GVGLVHGFHLQEGAIAGSVSHDSHNIVAVGAGDADIVRAVAEVVRLGGG
ADEC_SYNFM      DLDRDILKLAVYNRYVPDRPPAVAFVQGLGLKEGAIATTVAHDSHNLIVAGASDADILHVVDAVRKSGGG
ADEC_RHOSK      DPARDLARIAVIERHGKTGGRATGFVQGFGMARGAIASTVCHDHHNLAVVGIDYADMALAANRLRALEGG
ADEC_RHOS1      DPARDLARIAVIERHGKTGGRATGFVRGFGMARGAIASTVCHDHHNLAVVGIDYADMALAANRLRALEGG
ADEC_METTP      DTRNDILKVAVVERHRATGNVGLGLVSGFGLKRGAIASSVSHDSHNIIVVGEDEESMVRAVESLISMGGG
ADEC_DESDG      DPSRDLAKLAVFERHKGTGNVGLGFTXXXXXXXXXXXXTVSHDSHNLIVAGMDDADMITAAEEVQCIGGG
ADEC_LEUMM      N--ETFAKIVVAERYHNLGH-GVGIIKGFNMRDGAIASTIAHDSHNVIIAGVNDDDMILAADTLHEIGGG
ADEC_METBU      DVENDVLSVAVIERHGKNGNIGTGFIKGMGLRNGAIGQSIGHDSHNVVVTGVDHSDMALCANTIRSMNGG
ADEC_MOOTA      GVEADLAKVAVVERHGGNGSIGLGFVRGFGFKAGAVASTVAHDSHNLLIVGMNDADMALAGNTLAGCGGG
ADEC3_RHIME     DRASDVCQIALVERHRATGGVNAFVSGFGYDTHCAMASTVAHDSHHMIVVGTNKADMAQAANRLQEVGGG
ADEC_RHOS4      DPVRDLARIAVIERHGKTGGRATGFVRGFGMARGAIASTVCHDHHNLAVVGIDYADMALAANRLRALEGG
ADEC_EDWI9      FDTPDVCRIAVMERYGQQRVPALGLLHNSGLSKGALAATVSHDSHNIVVIGHHPAEMALAVNQLIDDGGG
ADEC_METBF      DPARDILKMVVLSRYAD-DPVQIGFIKNIGLKKGAIASSIAHDSHNIIAVGATDEDIVGAVNRLVENRGG
ADEC_BDEBA      --ESDVLYMANIERYGKGLPPALGLVKGMGLKSGALASSVAHDSHNIMVIGTNPADMVLAVNTLIKSGGG
ADEC1_OENOB     D--QDYAKIIVAERYHN-XXXXXXXXXXFNMQEGAIGSTIAHDSHNMIIAGVDDKPMIIAYDRLKRMGGG
ADEC_RHOS5      DPSRDLARIAVIERHXXXXXXXXXXXXXXXXXXXXIASTVCHDHHNLAVVGVDYADMALAANRLREIEGG
ADEC_METS4      DLAQDAVKVAVIARHGAPG-MACGFVQGFGLRRGAIASSVGHDSHNLCVVGADEADMALAVNRLIALQGG
ADEC_METMA      DPERDILKMVVLSR-YSDDPVRIGFIKNIGLEKGAIASSIAHDSHNIIAVGATDEDIVETVNRLIKNKGG
ADEC_ESCF3      FDRDDVCFIAVLERYGQRLDPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_SILST      EGEGDVCQIALVERHRATGGVNAFVSGFGYEGKMAMASTVAHDSHHMIVVGTDRTQMALAANRLAEVGGG
ADEC_STAMF      DPNRDIIYAAVIDRHKATGSMGKGFIKGLGFRAGAIAQTIAHDTHNLIVAGNNPEDMSRAVKRIVEIQGG
ADEC_LEUCK      D--KTYTKIVVAERYHNLGH-GVGIIKGFQMTDGAIASTIAHDSHNIIIAGTNDEDMLLAANKL-REIXX
ADEC_METTH      DTSSDILRVSVLDR-YGRGNISSGFVHGFGLQEGAIASTVAHDSHNLIVVGVDPELMKRAVDILKKAGGG
ADEC_LACPL      DCQRDILKMVVIERHHNTGKVGVGLVHGFALKQGAIAGTVAHDAHNIVAVGTSDAAILRAVAQITQDNGG
ADEC_SHISS      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO7I      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOLU      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOL5      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO81      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOUT      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOL6      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOK1      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO45      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOLI      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOLC      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECODH      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOBW      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO8A      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO55      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOSE      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECOHS      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO5E      FERNDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO57      FERNDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC1_CARHZ     DLTQDVLPIAVVERYGRNGSIGRAFVRGFGLKGGAFAESVSHDAHNIIVVGTSYQDMALAVNRVIEMGGG
ADEC_SHIF8      FDRDDVCFIAVLERYRQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_SHIDS      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_RHILO      DRRNDVCQIALVERHRGTGGVNAFVSGFGYMGDCAMASSVAHDAHHIICVGTNKQDMALAVNRLGQVGGG
ADEC_METJA      LNENAINKIFVIERHKNTGNIGKGLI-YNFLEEGALASSYAHDSHNVIAIGNNEKDLALAVNKLKDIGGG
ADEC1_JANSC     -----IAQIALVERHRGTGGVNAFVSGFGYGPGMAMASTVAHDSHHMIVVGTDRAMMAKAAMRLGEVGGG
ADEC_SHIFL      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ROSDO      QATGDVAQIALVERHRATGSVNAFVSGFGYQGRMAMASTVAHDSHHMIVVGTDADDMARAANRLGEVGGG
ADEC_ECOSM      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_ECO24      FDRDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGG
ADEC_DESRM      NTNEDILKLAVVERYGKNGSVGVGFVRGFKLKAGALASSVSHDHHNIVIVGTNDQDMDLAAREIARHQGG
ADEC_METAC      DPEKDILKMVVLSRYAD-DPVQIGFIKNIGLKEGAIASSIAHDSHNIIAVGATDKDIVEAVNRLVENKGG
ADEC_SHIBS      FDRDDVCFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVYQVIQDGGG
ADEC_METS3      PDEEDILKIAVVERYGGNSIAN-GFITGFNLKKGAIASSVAHDSHNIVVVGTNSEDMANAVNCLIDNEGG
ADEC_FLAPJ      DIENDILKMAVVNRYQNT-TPAIAFIKNFGLKKGAIASSVAHDCHNIVVVGTSDEEICNAVNLIIKNTGG
ADEC_METNO      DLDQDVVKVAVIARHGRPG-MGRGFVQGFGLRRGAIASSVGHDSHNLCXXXXXXXXXXXXINRLIALQGG
ADEC_SILPO      EHPDDVCQIALVERHRATGGVNAFVSGFGYQGRMAMASTVAHDSHHMIVVGTDREQMALAANRLAEVGGG
ADEC_SULNB      GKAKDVLKITVVNRYEDV-KPAVAYVHGFGLKKGAIASSVAHDSHNIIAVGCSDALIAKAVNTIIGNRGG
ADEC_METST      SVFEDILKISVVDR-YGGNTISNGFVKGFGIKNGAIASSVSHDSHNIIVVGTNSEYMSRATNHLIENKGG
ADEC_SHEHH      FAEPGVNKLAVIERYGHQLPPALSLVKGFDIEQGAIATSVGHDSHNIVVIGADEKSMAHAVNHLLEIGGG
ADEC_SALRD      DPDRDVLKLAVVNRYTEESTPAVAFVRGFGLDGGALASSVAHDSHNVVAVGXXXXXXXXXXXXXXXXEGG
ADEC_PARDP      EPQGETCHIALVERHRXXXXXXXXXXXXXYQGRMAVASTVAHDSHHMIVVGTDRDSMAAAANHLGRIGGG
ADEC_DEIGD      ADR------------YGRGEHAACWXXXXXXXXXXXXXXXXHDAHHVAVLGGSNADVRAAGRALEAMXXX
ADEC_DEIDV      ----GDARLIVADR-YGRGEWSACWTAXXXXXXXXXXXXVLHDAHHAAFLGGSDTDVRMXXXXXXXXXXX
ADEC_BORAP      NIAEDILKIAIINRYEDNSKISIGFIKNFGIRKGAIGSTVAHDSHNIIVVGTNDEYLCKATNIIIENKGG
ADEC_PARD8      SDTEDILKLVILNR-YQTAPPAIAFIKGTGLKLGAIAQSISHDSHNIIAIGVTDFELMQAINVVIKAKGG
ADEC2_BACSK     QD-SDFRLIATFERYGKTGGRAHGLIAGDILQRGAVATTYSHDNHNLLVVGANILDMVCAANAVIQAQGG
ADEC_BORBU      NIAEDILKIAIINRYKDNSKISIGFIKNFGIRNGAIGSTVAHDSHNIILVGSNDEYLCKAANTIIQNKGG
ADEC_META3      LKNNEINRIFVLERHRNTNKIGKGLIK--YLKTGTIASSYAHDSHNVIVIGNNLKDIAIAVNHLKDMGGG
ADEC_CLOP1      WEKSSCALIAVFERYGKNNNISFGLVEGEIIKEGAIATTWAHDHHNLMVMGRNISDMTIAANEVINSRGG
ADEC_CLOPE      WEKSSCALIAVFERYGKNNNISFGLVEGEIIKEGAIATTWAHDHHNLMVMGRNISDMTIAANEVINSRGG
ADEC_ENTFA      WQKANCALLIVMERYGKNGNISFSLMDQPLSEKGAIATTWAHDHHNLMVMGNTIEDILLAQNELLAMQGG
ADEC_KLEP3      --PAGFSLIWVKHRHRHQATPQIALLEGWGELRGAIATSYSHDSHNLVVLGRDADDMALAANQLIASGGG
ADEC_LACDA      WKKAGLALMLCQERYKNEGRYAFALIDRGIVGDGAIGATWAHDHHNLIILGTNIAGMVSVQNLLVEEQGG
ADEC_DEIRA      ----------------------------------------------------------------------
ADEC1_DESPS     ADTEDVLMVSVLERFGRNGNKSLAFCSGWKLKKGAMASSAAPDDNNIIVMGADASDMSIAVNHLIENGGG
ADEC1_LACSS     DPAKDVALISVLERFGKNGNQSLGFTSGWTLKKGAMASTAAPDDNNIIVMGVNPDDMALAVNTLIERDGG
ADEC_KLEP7      QLPAGFSLIWVKHRHRHQATPQIALLEGWGELRGAIATSYSHDSHNLVVLGRDANDMALAANQLIASGGG
ADEC2_OENOB     WQKAGLALLAVQERYGKTGQLTLALVSKSINKSGAIATTWAHDHHNLMVLGTNPDSMAIAYDKVASQQGG
ADEC_SERP5      --PQGFSLIWVQHRHRHQATPQLALLEGWGELRGAIATSYSHDSHNLVVLGRXXXXXXXXXXXXXXSGGG
ADEC2_RHIL3     -PPAGSAMISVAHRHGKTDGIRIGFLTGWGEWRGAFCTTVSHDSHNLTVFGGNAGDMALAANAVISAGGG
ADEC_CENSY      SRDSDVWKVAAFDRLSGNGGRTVGFLENFGADIGALASSWSFHENDLVVLGSSEIEMAKAANAVMDKGGG
ADEC_METKA      XXXXXXXFLVVTDR-YGQGSWSIGFVEGFEELDCAVVSTVAHDSHNVVVAGRRLDDVRRAL-QLVSEVGG
ADEC_RUBXD      DPRKDVCKLFVIEXXXXXXXXXXXXXXXXFERPAALASTVAHDSHNLMVLG-NSEELMSXXXXXXXXXXX
ADEC3_RHIL3     -DKHDLCFVTVVERHKSAGNVAHGLLNGFGLRQGAVASSVGHDSHNIIVAGTNAADMQVALDAIEEKQGG
ADEC2_RHIEC     -PPAGSAMIAVAHRHGKAGGTRIGFLTGWGEWRGAFCTTVSHDSHNLTVFGGDARDMALAANAVIKAGGG
ADEC2_AGRT5     -PPEGATMISVTHRHGMAPTTKTGFLTGWGRWNGAFATTVSHDSHNLTVFGGNAGDMALAANAVIGTGGG
ADEC4_RHIME     DASQNVQYVTVVERYGKTLNRPVAFVSGFNLKSGAIASSTAPDDNNIICIGADPQDMAIAINHLVANNGG
ADEC_MESSB      -DRHGLCFVAVVERHKSAGNVAHGLLSNFNLKRGAVASSVGHDSHNIIVAGTNEADMQVALRAIEEAQGG
ADEC2_JANSC     DPRRNVTKFAIVDRFSGEGKTSAMLGTGPRTSDTALACSMGHDKHNVWAVGSSDAAMAMAVNALRDIQGG
ADEC1_BRAJA     -ARYGLCFVTVVERHKSAGNVAYGLLKDFGLKRGAVASSVGHDSHNIIVAGTNEPDMQVAIAAIKEHQGA
ADEC2_BRAJA     DESEAITKFAIVDRFSGDGRIAKMFWRGCGPRTPETAVACSHDKHNIWVVGSSDAAMAKAVNALIELQGG
ADEC_BRASB      -ARHGLCFVAVIERHKSAGNVAHGLLKDFGLTRGAVASSVGHDSHNIIVAGTNEADMQVAVAAIGSHQGG
ADEC2_RHIME     -PPKGMTLIAVAHRHGRASRPRVGLLEGWGEWRGAFATTVSHDSHNLTVFGSSPRDMRVAANXXXXXXXX
ADEC1_BRASO     DESQAITKFAIVDRFSGDGLVSKMFWKGPRTPETALACSVAHDKHNIWAVGSSDXXXXXXXXXXXXQQGG
ADEC2_BRASO     -ARHGLCFVAVIERHKSAGNVAHGLLKDFGLKRGAVASSVGHDSHNIIVAGTNEADMQTXXXXXXXXXXX
Y1085_PICTO     KD----LKRIVSSNIHGMGQFDA-----------------LASSYNIIVIGSSHDLMKKALKEVIK--NG
Y637_BACHD      --------FLLLDKH---GKWKIPTMIKGFAKKVSGLASSFSTTGDIILIGKCIQDMIVAFNALKQQGGG
YERA_BACSU      FD-HDESYLTMLDRH---GKWRVNTMIKGFASSVQGFVSSFTTTGDIVAIGKNKADMLLAFARMKEIGGG
Y751_OCEIH      NEEKGEQFILLIDR---KGKWRVNTIIRGFAPKLGALISSYSASGDIIIIGNSKKDIFIAWNRLKEIKGG
Y3012_BACCR     TDHDECFFMMIA----RDGSWQVNIAVKGFAKELGGLASSYSGTGDIILIGKRKEDMLTAFRRVKELGGG
Y3032_BACAN     IDYDECFLMMIA----RDGTWRVNTVVKGFAKEIGGLASSYSGTGDIILVGKRKEDMLTAFHRIKELGGG
HUTI_DEIDV      ----------------------------------------------------------------------
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      ----------------------------------------------------------------------
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      ----------------------------------------------------------------------
PYRC_CLOBB      ----------------------------------------------------------------------
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      ----------------------------------------------------------------------
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      ----------------------------------------------------------------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      ----------------------------------------------------------------------
ENO_ANAVT       ----------------------------------------------------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           AVVVKDEKVISRMELKIAGLMCNLPAEKMIAQQDALDEAVHEELGVPDNVNPVMTLSFMPLAVIPKLKIT
ADEC_LACS1      AVVVKDEKVISRMELKIAGLMCNLPAEKMIAQQDALDEAVHEELGVPDNVNPVMTLSFMPLAVIPKLKIT
ADEC2_DESPS     IVLVNGEEVVESMPMPIAGLMSDQCGEWVEAKLTSIHSKAHEVLGVNADVEPVMTLCFMSLAVIPEIKLT
ADEC2_LACSS     XXXXXXXXXIATLPFVIGGLMSTEPIDSLIAHQKAFNTICHEQLNVTAQFDPIMKLGAMPLDVIPNLRIT
ADEC2_CARHZ     LTVVADGQVLGSLPLPIAGLMSDRTLYEVQEELEKLHRIV-RNLGVSENYDPFMTLAFLSLPVIPELKLT
ADEC_DESVH      ITLCAGGRVLASLPLPVAGLMSDRPATEVSATFAQMLSIAHETLHISRDIEPFMTLSFLTLPVIPALKLT
ADEC_DESVV      ITLCAGGRVLASLPLPVAGLMSDRPATEVSETFAQMLSIAHETLHISRDIEPFMTLSFLTLPVIPALKLT
ADEC_CLOBB      IAIASGKEIIASLPLAIGGLISENGYLEVQQQLKILNQAL-SIIGVNADFNPFLTLSFLTLPVIPEIKLT
ADEC_CLOBA      IAIASGKEIIASLPLAIGGLISENSYLEVQEQLKILNQAL-SIIGVDADFNPFLTLSFLTLPVIPEIKLT
ADEC_CLOAB      ITISLDGKIIETLELEIAGLMSNKSMEFVAERVSKMINICHNTLGVNKDIQPFMTLAFLALPVIPEIRIT
ADEC_DEHE1      IALVVDGKISASVPLPVAGLLSTQPLEKVV---DALEEINKQAAGLGCKLSPFATLSFMALPVIPELRLT
ADEC_BACHD      MTIVKDGKVLVSLPLTIGGLMSDQSYDVVCEQIKSVDAAI-GALGFVGDFNPFLTLSFLALPVIPEIKLT
ADEC_BACP2      LTVVKEGQSLHTLPLPISGLLSDQPAHLVNESLHSLHEAL-KETGFSLDFNPFLTLSFLALPVIPDVKMT
ADEC_OCHA4      FVVVRDGKVLAEMPLPIAGLMSAEPYETVRDQLRVLRHAAEELGSVLE--EPFLQLAFIALPVIPHLKIT
ADEC_KOSOT      LVIANSGKVLAELPLPIAGLMSNL-SSKEVAERLGHLKTVLKELGVPD---LFMTLSFVQLSVIPELRIT
ADEC_BRUSU      FVVVRDGKVLAEMPLPIAGLMSTEPYETV---REALRKLRHEDLGSVLE-EPFLQLAFIALPVIPHLKIT
ADEC_OCEIH      LVVTKRKQVKAHLALPIGGLMSD--KDYLDAYEEVLKNHVAVENGIPSNFNPFLTLSFLTLPVIPTLKVT
ADEC_BRUAB      FVVVRDGKVLAEMPLPIAGLMSTEPYETV---REALRKLRHEDLGSVLE-EPFLQLAFIALPVIPHLKIT
ADEC_BRUA2      FVVVRDGKVLAEMPLPIAGLMSTEPYETV---REALRKLRHEDLGSVLE-EPFLQLAFIALPVIPHLKIT
ADEC_BRUME      FVVVRDGKVLAEIPLPIAGLMSTEPYETV---REALRKLRHEDLGSVLE-EPFLQLAFIALPVIPHLKIT
ADEC_PETMO      IVIANNQKIVDFIELPIGGLISTDPIGKVSEKLQELRKIVH-NLGVKTN-SPFMTLAFMGLPVVPKLKIT
ADEC_DEHSB      IALAVDGQVTASVSLPVAGLLSTKPLEEVVTELEEINNQV-AKLGCKLSA-PFATLSFMALPVIPELRLT
ADEC_BACLD      LTIAKGGKELQSVALPIAGLLSDKPLETVNESLKSLHAAI-TETGFSGAFNPFLTLSFLALPVIPDIKMT
ADEC_DEHSC      IALAVDGQVTASVSLPVAGLLSTKPLEEVVTELEEINNQV-AKLGCKLSA-PFATLSFMALPVIPELRLT
ADEC_LISW6      AVVDETGKVLHDLALPVAGLLSNKPYEEVERDLAGLLKAFN-QISNAKGFDPFLTLSFLTLPVIPELKLT
ADEC_CLOD6      YVIVSNGKVLAHLSLQVAGLISTFTAEEVQEITDNMLE-IARKMEVPEYVDPFITLSFMALPVVPQIRLT
ADEC_BACA2      LTAVKNGELLHSVPLPIAGLLSDKSAEWV---NDSLG-VLHEKLGFTGDFNPFLTLSFLALPVIPDIKMT
ADEC1_BACSK     MAVVKGNNVLAAMPLKLGGLMSTDSAETVKQQLNELQQSL-VHLGYQEKIDPFLTLAFLALPVIPALKLT
ADEC_LISMO      IAVVNGAQVLHDLALPIAGLLSDKSYEEVENDLAGLLNA-FKQISTANGFDPFLTLSFLTLPVIPELKLT
ADEC_LYSSC      FVIVADGEILAEMPLTIGGLMTDVPAQQAKEQLAGLHNAL-QKLNPTLDFHFLLTFSFVALPVIPALKLT
ADEC_LISMF      IAVVNGAQVLHDLALPIAGLLSDKSYEEVENDLAGLLNA-FKQISTADGFDPFLTLSFLTLPVIPELKLT
ADEC1_RHIME     FVVVHDGKVTGEIALPVAGLMSLEPYERVRDTLHHLRQAAF-ALGATLE-EPFLQLAFLPLPVIPHLKIS
ADEC_LISIN      AVVDAAGNVLHDLALQVAGLLSDKPYEEVENDLAGLLKAFN-QISKAKGFDPFLTLSFLTLPVIPELKLT
ADEC_THEAB      IVVVKNKKLIASLSLPIAGLMSDKNYGFVVEELRKLKNSL-VEIGV--NSDILMQIHFLQLAVIPKLKIT
ADEC_GEOKA      LAVIKDGAVLASLPLEIGGLMTRKDYTEVLSGLKQIDKAL-KAIGANGSFNPFITLSFLALPVIPELKLT
ADEC_ARCFU      -IVVADAEVRAELPLPIAGIMSDERAERVLERLSEIEEEV-RKLGCRLK-SPVITLSFIALPVIPKLKLT
ADEC_DESAA      XXXXXXXXXLSVCPLPIAGLMSDQPMEQVRRQLDILMQTA-KELGAKAE-DPFMSLSFLALPVIPELKIT
ADEC_THEM4      IVVIKDKKVISELSLPIAGLMSDETYNTVIKKLQHLKKSI-EKLGTKNDV--LMNIHFLQLAVIPKLKIT
ADEC_RHISN      FVVVEDGRVTGEIALPIAGLMSLEPYERV---RDILHHLRQAAFALGATLEPFLQLAFLPLPVIPHLKIS
ADEC1_RHIEC     FVVVEDGKITGEIALPVAGLMSIEPYETV---RDTLHHLRQAALALGATLHPFLQLAFLPLPVIPHLKIS
ADEC_BACSU      LTIIKNGEELHSVPLPIAGLLSDQSAEQV--NQSLL--TLHDKLGFTGGFNPFLTLSFLALPVIPDIKMT
ADEC1_AGRT5     FVVVEDGRVTGEIALPVAGLMSLEPYETVRDTLHTLRKAAY-ALGTTLE-EPFLQVAFLPLPVIPHLKIS
ADEC1_RHIL3     FVVVEDGKVTGEIALPIAGLMSLEPYETV---RDTLHQLRKAAFALGATLEPFLQLAFLPLPVIPHLKIS
ADEC_METB6      MAAV-HKKDVTVLPLDCAGLMSTHPAREVIAGLDALSAATRRIGGIDD---PFMYLSFLALTVIPALRLT
ADEC_DESHY      YTMIREQRVLATLPLPIMGLISDAGHQAVESMLNTMVGYAH-EMGVPASIHPFIALSFIALPVIPEIRIT
ADEC_DESHD      YTMIRGQRVLATLPLPIMGLISDAGYQ---AVENTLNQMIAHEMGVPAHTHPFIALSFIALPVIPEIRIT
ADEC_CLOBL      MVAVQDGKVLGLVPLPIAGLMSNKPLEEMAEMVEKLDSA-WKEIGC-DIVSPFMTMALIPLACLPELRLT
ADEC_CLOB1      MVAVQDGKVLGLVPLPIAGLMSNKPLEEMAEMVEKLDSA-WKEIGC-DIVSPFMTMALIPLACLPELRLT
ADEC_GLUOX      FVAVRNGQVLADLCLPVAGLMSDAPYEQVRDDLIILRKAA-KTMGVVLE-EPFLQLAFLPLPVIPHLKIT
ADEC_CLOB6      MVAVQDGKVLGLVPLPIAGLMSNKPLEEMAEMVEKLDSA-WKEIGC-DIVSPFMTMALIPLACLPELRLT
ADEC_CLOBM      MVAVQDGKVLGLVPLPIAGLMSNKPLEEMAEMVEKLDSA-WKEIGC-DIVSPFMTMALIPLACLPELRLT
ADEC_METMJ      LAVVSGDD-ITALPLECAGLMSALPYDEVVXXXXXXXXXXXXXXXI---ANPFMYLSFLALTVIPEVRVT
ADEC_SYNFM      MAAGRTGAEVDVLALPIAGLMSDQPVERVAERLEQLQRARAAGSGLR---NPFMALSFLALPVIPELKLT
ADEC_RHOSK      FXXXXXXXXXXXXXXPVGGLMSLRPFEEVRDALVTLREAA-RSLGVTLE-EPFLQLAFLALPVIPHLKIT
ADEC_RHOS1      FXXXXXXXXXXXXXXPVGGLMSLRPFEEVRDALVTLREAA-RSLGVTLE-EPFLQLAFLALPVIPHLKIT
ADEC_METTP      WVSV-DGTTIASLPLPIAGLLSERRXXXXXXXXXXXXXXSH-SLG-SELEDSFMTLSFLALPVIPELRIT
ADEC_DESDG      LAVACDGRVLASLPLPIAGLMSDAPVEDVLAGLRGVNEAL-ATLGY-KXXXXXXXXXXXXXXVIPSLKLT
ADEC_LEUMM      QVVVNHGK-ITTLPLPIGGLMSDQPFENVIKTNQQLLQAFSEISDVP--FDPFLTLSFMALPVIPSLKIT
ADEC_METBU      ICVVSNGKVVEQLELPFAGLLSTLPAEEVEKKLTDLHKAV-KEIGCALPA-PFITHSFIALPVIPSLRLT
ADEC_MOOTA      MVAVRDGQVLALLPLPIAGLMSDRPVEEVAARLAAVHRA-WQELGC-RLVSPFMTMAXXXXXXXXXXXXT
ADEC3_RHIME     IVLIAGGRELALVELPVAGLMSDQRAEIVAEKASRLVEAM-RACGCKLN-NAYMQHSLLALVVIPELRIS
ADEC_RHOS4      FXXXXXXXXXXXXXXPVGGLMSLRPFEEVRDALVTLREAA-RSLGVTLE-EPFLQLAFLALPVIPHLKIT
ADEC_EDWI9      LCVVADGQVVVHLPLPIAGLMSSRSAAEIADIIDALKQAC-RNCGMTLN-EPFIQMAFLSLPVIPSLKLT
ADEC_METBF      IVVGTADNLID-LPLEVSGLMSTLDGKEVAVRYEQLNEEA-RKLGT-SLMSPFMTLSFMSLLVIPELKLG
ADEC_BDEBA      FAVADQGEIKALVELPIAGLL-SLKSAEEIKDGIADLKTAFRSLGVHLD-EPFIQMAFLALPVIPTLKLT
ADEC1_OENOB     MILVDKNGFTRELPLEIAGLMSDKPYQEVIAKQKSL-KGAFAKISKGIDFDPFLTLSFMALPVIPSLKIT
ADEC_RHOS5      FXXXXXXXXXXXXXXPVGGLMSLRPFEEVRDALVALREAA-RGLGVTLE-EPFLQLAFLALPVIPHLKIT
ADEC_METS4      FVVAEGGAVRAELALPIAGLMSDLPFE---AVRDALHPLREAARGLGCTLEPFLQVAFLPLPMIPHLKIT
ADEC_METMA      IAVGTAENLLD-LPLEVAGLMSTLEGEEVASRYHLLNEEA-RKLGT-SLESPFMTLAFMSLLVIPELKLG
ADEC_ESCF3      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_SILST      ITIFRDGAELALVELPIAGLMSDSPASEVAANAQKLVEAM-QACGCTLN-NAYMQHSLLALVVIPELRIS
ADEC_STAMF      IVVVDEGKIIGELPLRLAGLMSIEEPETVYEKYKKITNELNNGYGL-EFESFFMTLALVALPVIPEIRLT
ADEC_LEUCK      XXXXXXXXQITTLPLAIGGLMSEQSYTTVIQENNTLQAAFSKISHL--NFDPFLTLSFMALPVIPSLKIT
ADEC_METTH      LVAVSDHRV---LQLPVAGLMSDGDVFEVADGFENLN-TFTEQLGSRLSA-PFMTMSFLSLLVIPRLKIG
ADEC_LACPL      IAVVDNEQVLATMPLAIGGLLSAASYQKVAEQLAELKRAYEVISERPLSFDPFITLSFLTLPVIPTLKLT
ADEC_SHISS      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO7I      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOLU      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOL5      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO81      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOUT      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOL6      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOK1      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO45      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOLI      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOLC      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECODH      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOBW      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO8A      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO55      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOSE      LCVVRNGQVQSHLPLPIAGLMSTDTAQLLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECOHS      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO5E      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO57      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC1_CARHZ     VAVVKNGRVLGDLRLPVGGLITDLDGYELSRKIAELHRLTAVELGCTVHA-PFMHLSFLALTTSPKWKIT
ADEC_SHIF8      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_SHIDS      LCVVRNGQVQSYLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_RHILO      VVLFSKGKELALVEMPIAGLMSDERAEIVAAKAEKLTEAM-RKMGCSLN-NAYMQHSLLALVVIPELRIS
ADEC_METJA      FIAAKDGEVVEYLPLPVGGIMGD--DGKYIAEKNALYKKIE---GWSSFENPFLSMSFFSLPVIPELKIT
ADEC1_JANSC     ITLWQDGTERALVELPIAGLMSDRPATEVAAKVTQLVEAM-EAAGCTLN-NAYMQHSLLALVVIPELRIS
ADEC_SHIFL      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ROSDO      IVLFKDGVELALVELPIAGLMSDRPAAEVAAKADKMMQAM-RDCGCTLN-NAYMQHSLLALVVIPELRIS
ADEC_ECOSM      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_ECO24      LCVVRNGQVQSHLPLPIAGLMSTDTAQLLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_DESRM      LVAVENGQVIGVLPLPIGGLMSSLPAEQVMSQIDQLNKKA-EQLGC-DLPAPFMTLSFISLPTVPELGLT
ADEC_METAC      IVVGTAENLLD-LPLEVAGLMSTLDGVEVASRYRLLNEEA-RKLGT-SLESPFMTLAFMSLLVIPELKLG
ADEC_SHIBS      LCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPD--EPFIQMAFLSLPVIPALKLT
ADEC_METS3      FAIV-DGDFEDSLALPIAGLMTNEDSHEVAEKLEKLHKTAADFGCKLD--SPFMTMSFMALLVIPAIKIS
ADEC_FLAPJ      ICAVNGTQNKS-LALPVAGIMSDKDAGKLYQEIDAMAKDLGSTLKA-----PFMTLSFMALLVIPDLKLS
ADEC_METNO      FVVAAGGTVLAELALPIAGLMSDLPFEAVRDALHPLREAA-RTLGLPE---PFLQVAFLPLPVIPHLKIT
ADEC_SILPO      ITIWRDGQELALVELPIAGLMSDSP-XXXXXXXXXXXXXXXXXCGCTLN-NAYMQHSLLALVVIPELRIS
ADEC_SULNB      ICAVTEEE-IEVLSLPIAGLMSDKDGFEVANRYADLDRMVREYFTSLLSA-PFMTLSFMALLVIPELKLS
ADEC_METST      LAAISNQAKLD-VTLPIAGLMSDKPA-KVVANNSAKLNELVSNMGC-ELSSPFTSLSFMALPVVPEVKMT
ADEC_SHEHH      FCVVQQGEVTADLMLPLGGIMSLERSEKIAEQISDLKTAV-KAIGVSLS-EPFVQMSFLSLPVIPSLKMT
ADEC_SALRD      ISAAAEGTQV--LPLPIAGLMSDEPYDVVARRYTRLTDYVRAELGSAMDA-PFMTLSFLSLLVIPQLKLS
ADEC_PARDP      VTVFRDGEELATVALPIAGLMSDRPAAEVAEAAQGIVKAM-QDCGCTLN-NAYMQHSLLALVVIPELRIS
ADEC_DEIGD      XXXXXXXXXRSNLPLPYAGLMSDLPPQEAAARLSEVTAAA-RVLGC-TLPYPVTTLSFLGLSVIPALKLT
ADEC_DEIDV      XXXXSDGEVRASLPLPFAGLMTEAPQEXXXXXXXXXXXXXXXXCTLP---YPVTTLSFLGLTVIPSLKLT
ADEC_BORAP      LCALNNEKTII-IKLPISGLMSTLPAKEIAFQYMKLNDFCKNILGSQLD-DPLMTLSFMSLTVVPHLKIN
ADEC_PARD8      AVSCMDE--VTLLPLPVAGLMSDESLXXXXXXXXXXXXXXXRLKSPMDSLQ--MTLSFMGLLAIPSLKLS
ADEC2_BACSK     CAVVENGEVKAMLELPVGGILSEAPLAELAPKVESFVKAL-TALGY-KHYNPIMSLSTLSLPVSPALKIT
ADEC_BORBU      LCALNNEKTII-MELPISGLMSTLSAERVASQYIKLNDFCKNVLGSRLD-DPLMTLSFMSLTVVPHLKIN
ADEC_META3      FVAVKDGKIIEQVKLNMGGIM-GADGEYIYKKINDIENKT-KNWSIIEXXXXXXXXXXXXXXVIPNLKIT
ADEC_CLOP1      YVVSKNNEVIAKLELPIGGIISDEPIE-IIGEKLGEVRSAMRDLGY-NHMNEIMSFSTLSLPVSPALKIT
ADEC_CLOPE      YVVSKNNEVIAKLELPIGGIISDEPIE-IIGEKLGEVRNAMRDLGY-NHMNEIMSFSTLSLPVSPALKIT
ADEC_ENTFA      YLVASDQQVMATCPLPIGGILSQAPIEQLGASLQKVRQAM-QALGY-QNMNEIMSFSTLSLPVSPAIKVT
ADEC_KLEP3      MALAQQGEILAHVAMPIAGMLSDLPAAELARQ--------------------------------------
ADEC_LACDA      YIAAKGSQIVANAPLPLGGVV-SLEPMSVLGKQISKVRETMVDLGY-KNTNEIMSFSTLSLLVSPTLKIS
ADEC_DEIRA      ----------------------------------------------------------------------
ADEC1_DESPS     QVIVADGEILEFLALPVGGIVSDLEAEEIARQESLLTKAAN-SLGC-DLPDPLMYMFFLPITAIPDYAIT
ADEC1_LACSS     QVVVADGQILSFLPLPIAGIVSDVTPAELAVQEEGILKA-SQAIG-SEVVDPMFYMTFLPITAIPDLAIT
ADEC_KLEP7      MALAQQGEILAHVAMPIAGMLSDLPAAELARQ--------------------------------------
ADEC2_OENOB     YLVVKDKEIVANVQLPIAGIISDEPID-IIGHKLKKVRLAMKDLGYV-NTNEIMXXXXXXXXXXXXIKVS
ADEC_SERP5      MALSQNGEILAQVAMPIAGMLSDLPAAELAQQ--------------------------------------
ADEC2_RHIL3     MAVAKDGRIEAMLPLPLSGLV-------------------------------------------------
ADEC_CENSY      IAVVQKGRVSAMLPLQICGIISSDPFGKV-----------------------------------------
ADEC_METKA      CVGAVAGDRAEFVRLDVAGLMSSSDPEEVKKSYEDVLELIRSSSGV--DWDPFQALSFVTLPVVPELRLT
ADEC_RUBXD      XXXXXXXXXXXXLPLPVAGLMSPEPYEEVARLSREIGRAL-RSAGCRMNY-AFMTISXXXXXXXXXXXXS
ADEC3_RHIL3     VCVVMDGKVTAMVPLPIAGLL----SDKRVHQVADEVKALKLEWEKAGCTIAYMGFNLIPLSVIPEIRIT
ADEC2_RHIEC     LAVAKDGAIQAILPLPLSGLV-------------------------------------------------
ADEC2_AGRT5     MAVASEGKVTAILPLPLSGLVSDAPLEEVARAFEDLREAV------------------------------
ADEC4_RHIME     QVVVDKGEVVEFLHLPIGGIVSDIDPAEMAAFELRLDEAA-RRLGC-DLPWPFMYMFVLQITAIPDYAMT
ADEC_MESSB      VCVVMDGKVTAMVPLPIAGLL----SDKRVTXXXXXXXXXXXXXXXXGCSIPYMGFNLIPLSVIPEIRIT
ADEC2_JANSC     WALVREGQLVATVRYEVGGLMTCRPPAELDAEMQAL----------------------------------
ADEC1_BRAJA     VCVVADGKVRALVPLPIAGLL----SDKRVTXXXXXXXXXXXXXXXXGCTIPYMGFNLIPLSVIPEIRIT
ADEC2_BRAJA     WALVREGELVATVRFEVGGLMSCRSAQALDAEMQAL----------------------------------
ADEC_BRASB      VCVVADGKVRAMVPLPIAGLL----SDKRITEVAEEVKLLKTEWAAAGCTIPYMGFNLIPLSVIPEIRIT
ADEC2_RHIME     XXXXXXXXXXXLLPLPLCGLVSDAP---------------------------------------------
ADEC1_BRASO     WALVREGELAATVRFEVGGLMSCRRAEALDAEMQAL----------------------------------
ADEC2_BRASO     XXXXXXXKVRAMVPLPIAGLL----SDKRVTAVAEEVKLLKKEWAEAGCTIPYMGFNLIPLSVIPEIRIT
Y1085_PICTO     GIVFNGNKNI-RIELKILGIMSDKHSDDVRNITEEFRSTMRGSGYKFD--DPVYSMLFLNSINLPYYRIT
Y637_BACHD      IVLVENGEVISNIPLEIMGLLSSXXXXXXXXXXXXXXXALRERGYEHD--DPIYSLLFFSSTHLPYIRVT
YERA_BACSU      IVLAENGNILHEIPLALCGCASSEAYEDVLEKEQKLRDLLTER--GYEFCDPIYTLLFLQSTHLPYIRIT
Y751_OCEIH      IILVNNGEILTEIPLTLGGSLPNEPMEQMIKYDKQLKDTL-QKYGFA-FYDPVYSLLFLSAFHLPFFRIT
Y3012_BACCR     MVIAEKNEVLHEIALPLLGIMSNLKMRELIQEEKQMVKLLQERGYAHD--DPAFTILFFSATHLPFIRVT
Y3032_BACAN     MVIAEKNEVLHEIALPLLGIMSELKMSELIQKEKKMVNLLQERGYVYN--DPAFTILFFSATHLPFIRVT
HUTI_DEIDV      ----------------------------------------------------------------------
PYRC_GEOLS      ----------------------------------------------------------------------
ALLB_ECOUT      ----------------------------------------------------------------------
ALLB_ECOL6      ----------------------------------------------------------------------
ALLB_ECOL5      ----------------------------------------------------------------------
ALLB_ECOK1      ----------------------------------------------------------------------
ALLB_ECO81      ----------------------------------------------------------------------
ALLB_ECO45      ----------------------------------------------------------------------
ALLB_ECO27      ----------------------------------------------------------------------
PYRC_GEOBB      ----------------------------------------------------------------------
ALLB_SALTY      ----------------------------------------------------------------------
ALLB_SALTI      ----------------------------------------------------------------------
ALLB_SALPK      ----------------------------------------------------------------------
ALLB_SALPB      ----------------------------------------------------------------------
ALLB_SALPA      ----------------------------------------------------------------------
ALLB_SALNS      ----------------------------------------------------------------------
ALLB_SALHS      ----------------------------------------------------------------------
ALLB_SALEP      ----------------------------------------------------------------------
ALLB_SALDC      ----------------------------------------------------------------------
ALLB_SALA4      ----------------------------------------------------------------------
PYRC_GEOSM      ----------------------------------------------------------------------
PYRC_CLOD6      ----------------------------------------------------------------------
ALLB_ENTFA      ----------------------------------------------------------------------
URE12_PSYCK     ----------------------------------------------------------------------
ALLB_SALCH      ----------------------------------------------------------------------
PYRC_THEPX      ----------------------------------------------------------------------
PYRC_THEP3      ----------------------------------------------------------------------
PYRC_ANATD      ----------------------------------------------------------------------
HYDA_RHIRD      ----------------------------------------------------------------------
ALLB_ECOSE      ----------------------------------------------------------------------
ALLB_ECOLU      ----------------------------------------------------------------------
ALLB_ECOLI      ----------------------------------------------------------------------
ALLB_ECOLC      ----------------------------------------------------------------------
ALLB_ECOHS      ----------------------------------------------------------------------
ALLB_ECODH      ----------------------------------------------------------------------
ALLB_ECOBW      ----------------------------------------------------------------------
ALLB_ECO8A      ----------------------------------------------------------------------
ALLB_ECO55      ----------------------------------------------------------------------
ALLB_ECO24      ----------------------------------------------------------------------
ALLB_ECOSM      ----------------------------------------------------------------------
PYRC_SOLUE      ----------------------------------------------------------------------
PYRC_CLOCE      ----------------------------------------------------------------------
HUTI_SILST      ----------------------------------------------------------------------
DPYS_SACKL      ----------------------------------------------------------------------
PYRC_LACS1      ----------------------------------------------------------------------
URE1_BACHD      ----------------------------------------------------------------------
PYRC_LACAC      ----------------------------------------------------------------------
PYRC_CLOBA      ----------------------------------------------------------------------
HYDL_ARTAU      ----------------------------------------------------------------------
HYDA_BURPI      ----------------------------------------------------------------------
ALLB_BACSU      ----------------------------------------------------------------------
URE1_STAAW      ----------------------------------------------------------------------
URE1_STAAT      ----------------------------------------------------------------------
URE1_STAAS      ----------------------------------------------------------------------
URE1_STAAR      ----------------------------------------------------------------------
URE1_STAAN      ----------------------------------------------------------------------
URE1_STAAM      ----------------------------------------------------------------------
URE1_STAAE      ----------------------------------------------------------------------
URE1_STAAC      ----------------------------------------------------------------------
URE1_STAAB      ----------------------------------------------------------------------
URE1_STAA9      ----------------------------------------------------------------------
URE1_STAA8      ----------------------------------------------------------------------
URE1_STAA3      ----------------------------------------------------------------------
URE1_STAA2      ----------------------------------------------------------------------
URE1_STAA1      ----------------------------------------------------------------------
PYRC_PELTS      ----------------------------------------------------------------------
NDDD_ALCXX      ----------------------------------------------------------------------
HUTI_SILPO      ----------------------------------------------------------------------
PYRC_CLOBB      ----------------------------------------------------------------------
ATZC_PSESD      ----------------------------------------------------------------------
URE1_STAS1      ----------------------------------------------------------------------
URE1_RHOPB      ----------------------------------------------------------------------
PHNM_ECOLI      ----------------------------------------------------------------------
URE1_STAES      ----------------------------------------------------------------------
URE1_STAEQ      ----------------------------------------------------------------------
PYRC_CORGL      ----------------------------------------------------------------------
PYRC_BACHD      ----------------------------------------------------------------------
HUTI_GEOSW      ----------------------------------------------------------------------
NAGA_BACSH      ----------------------------------------------------------------------
HUTI_DEIRA      ----------------------------------------------------------------------
URE1_CAMLA      ----------------------------------------------------------------------
PYRC_THETN      ----------------------------------------------------------------------
PYRC_LISMO      ----------------------------------------------------------------------
PYRC_LACH4      ----------------------------------------------------------------------
PYRC_LACDB      ----------------------------------------------------------------------
PYRC_LACDA      ----------------------------------------------------------------------
PYRC_CLOAB      ----------------------------------------------------------------------
HYDA_BACST      ----------------------------------------------------------------------
AGAA_ECOLI      ----------------------------------------------------------------------
PYRC_LYSSC      ----------------------------------------------------------------------
PYRC_LISMH      ----------------------------------------------------------------------
PYRC_LISMF      ----------------------------------------------------------------------
PYRC_LISMC      ----------------------------------------------------------------------
HUTI_BACSK      ----------------------------------------------------------------------
PYRC_LISW6      ----------------------------------------------------------------------
PYRC_CARHZ      ----------------------------------------------------------------------
PYRC_ANOFW      ----------------------------------------------------------------------
HUTI_RHORT      ----------------------------------------------------------------------
HUTI_NOCSJ      ----------------------------------------------------------------------
Y2937_MYCBO     ----------------------------------------------------------------------
Y2913_MYCTU     ----------------------------------------------------------------------
URE1_SULTO      ----------------------------------------------------------------------
URE1_GEOKA      ----------------------------------------------------------------------
URE1_ECO5E      ----------------------------------------------------------------------
URE1_ECO57      ----------------------------------------------------------------------
URE1_CORU7      ----------------------------------------------------------------------
PYRC_LISIN      ----------------------------------------------------------------------
HUTI_RHOS4      ----------------------------------------------------------------------
HUTI_RHOS1      ----------------------------------------------------------------------
URE1_SYNJB      ----------------------------------------------------------------------
PYRC_UNCTG      ----------------------------------------------------------------------
PYRC_STRPN      ----------------------------------------------------------------------
PYRC_DESRM      ----------------------------------------------------------------------
PKSL_BACSU      ----------------------------------------------------------------------
ENO_ANAVT       ----------------------------------------------------------------------
ALN2_DICDI      ----------------------------------------------------------------------
ALLB_BACSK      ----------------------------------------------------------------------
URE1_PROVU      ----------------------------------------------------------------------
URE1_PROMH      ----------------------------------------------------------------------
URE1_BRAJA      ----------------------------------------------------------------------
PYRC_STRR6      ----------------------------------------------------------------------
HUTI_RHOSK      ----------------------------------------------------------------------
ENO_ANASP       ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DKGLVDVEKNAFVSNELD
ADEC_LACS1      DKGLVDVEKNAFVSNELD
ADEC2_DESPS     DMGLFDVTKFDFISLE--
ADEC2_LACSS     DKGLVDVTK---------
ADEC2_CARHZ     DLGLVDV-----------
ADEC_DESVH      DRGLFDVRTFSFTT----
ADEC_DESVV      DRGLFDVRTFSFTT----
ADEC_CLOBB      DTGLFE------------
ADEC_CLOBA      DTGLFEFKR---------
ADEC_CLOAB      DKGVFDVVNFKFL-----
ADEC_DEHE1      DLGLVDV--NAF------
ADEC_BACHD      DQGLFDVTSFSFIDQQV-
ADEC_BACP2      TKGLFDV-----------
ADEC_OCHA4      DRGLVDVDKFAFVGN---
ADEC_KOSOT      NQGLVDVINNNFVS----
ADEC_BRUSU      DRGLVDVDKFEFVGN---
ADEC_OCEIH      DQGLFDFKTFSHINVEVE
ADEC_BRUAB      DRGLVDVDKFEFVGN---
ADEC_BRUA2      DRGLVDVDKFEFVGN---
ADEC_BRUME      DRGLVDVDKFEFVGN---
ADEC_PETMO      CDGLYDVENHIFVS----
ADEC_DEHSB      DLGLVDVKTFKLIPQE--
ADEC_BACLD      TEGLFDVK----------
ADEC_DEHSC      DLGLVDVKTFKLIPQE--
ADEC_LISW6      DQGLFDFATFQIIPNEVN
ADEC_CLOD6      DLGLFDVEEFKFI-----
ADEC_BACA2      AAGLFDVK----------
ADEC1_BACSK     SKGLFDVNAFAFV-----
ADEC_LISMO      DQGLFDFATFQIISNEVN
ADEC_LYSSC      DTGLFDV-----------
ADEC_LISMF      DQGLFDFATFQIISNEVN
ADEC1_RHIME     DRGLVDVDR---------
ADEC_LISIN      DQGLFDFATFQIIPNEVN
ADEC_THEAB      DKGLIDVEKQKIV-----
ADEC_GEOKA      DQGLFDVNKWEFIPVE--
ADEC_ARCFU      DLGLVDVEAFRVVDLQAD
ADEC_DESAA      DKGLVDVNLFNFVS----
ADEC_THEM4      DKGLIDVENQKIV-----
ADEC_RHISN      DRGLVDVDKFALI-----
ADEC1_RHIEC     DRGMVDVDKFALI-----
ADEC_BACSU      TTGLFDVKSFQHIS----
ADEC1_AGRT5     DMGMVDVDRFALI-----
ADEC1_RHIL3     DRGMVDVDKFALI-----
ADEC_METB6      DRGLFD------------
ADEC_DESHY      TRGLYDAVEQKFI-----
ADEC_DESHD      TRGLYDVVDQEFI-----
ADEC_CLOBL      NRGLVDCNKFEFVS----
ADEC_CLOB1      NRGLVDCNKFEFVS----
ADEC_GLUOX      DFGMIDVRTMSFV-----
ADEC_CLOB6      NRGLVDCNKFEFVS----
ADEC_CLOBM      NRGLVDCNKFEFVS----
ADEC_METMJ      ERGVFDV-----------
ADEC_SYNFM      DLGLIDVSTFSPVS----
ADEC_RHOSK      DRGMVDVDR---------
ADEC_RHOS1      DRGMVDVDR---------
ADEC_METTP      DRGLVDVRE---------
ADEC_DESDG      DKGLVDVHK---------
ADEC_LEUMM      DQGLFDFEKFDFIT----
ADEC_METBU      DMGLFDVDKFSLVS----
ADEC_MOOTA      NRGLVD------------
ADEC3_RHIME     DVGLIDVTR--FESTEV-
ADEC_RHOS4      DRGMVDVDR---------
ADEC_EDWI9      SLGLYDVDHFRF------
ADEC_METBF      DKGLFDVTKFEFV-----
ADEC_BDEBA      DRGLVNVTNFSFIPLQVE
ADEC1_OENOB     DQGLFDFDQFKFI-----
ADEC_RHOS5      DRGIVDVDR---------
ADEC_METS4      DRGLVDVDR---------
ADEC_METMA      DKGLFDVTKFEFV-----
ADEC_ESCF3      SQGLFDGEKFAFTTLEV-
ADEC_SILST      DLGLVDV-----------
ADEC_STAMF      DKGLVDVRK---------
ADEC_LEUCK      DQGLFDFNTFSFIN----
ADEC_METTH      DRGLFDVEK---------
ADEC_LACPL      ARGLFDYATFDFI-----
ADEC_SHISS      SQGLFDVEKFAFTTLEV-
ADEC_ECO7I      SQGLFDGEKFAFTTLEV-
ADEC_ECOLU      SQGLFDGEKFAFTTLEV-
ADEC_ECOL5      SQGLFDGEKFAFTTLEV-
ADEC_ECO81      SQGLFDGEKFAFTTLEV-
ADEC_ECOUT      SQGLFDGEKFAFTTLE--
ADEC_ECOL6      SQGLFDGEKFAFTTLEV-
ADEC_ECOK1      SQGLFDGEKFAFTTLE--
ADEC_ECO45      SQGLFDGEKFAFTTLE--
ADEC_ECOLI      SQGLFDGEKFAFTTLEV-
ADEC_ECOLC      SQGLFDGEKFAFTTLEV-
ADEC_ECODH      SQGLFDGEKFAFTTLEV-
ADEC_ECOBW      SQGLFDGEKFAFTTLEV-
ADEC_ECO8A      SQGLFDGEKFAFTTLEV-
ADEC_ECO55      SQGLFDGEKFAFTTLEV-
ADEC_ECOSE      SQGLFDGEKFAFTTLEV-
ADEC_ECOHS      SQGLFDGEKFAFTTLEV-
ADEC_ECO5E      SQGLFDGEKFAFTTLEV-
ADEC_ECO57      SQGLFDGEKFAFTTLEV-
ADEC1_CARHZ     DQGLIDVNSFAII-----
ADEC_SHIF8      SQGLFDGEKFAFTTLEV-
ADEC_SHIDS      SQGLFDGEKFAFTTLEV-
ADEC_RHILO      DVGLIDV-----------
ADEC_METJA      DKGLV-------------
ADEC1_JANSC     DLGLVDV-----------
ADEC_SHIFL      SQGLFDGEKFAFTTLEV-
ADEC_ROSDO      DLGLVDVRTFEFI-----
ADEC_ECOSM      SQGLFDGEKFAFTTLEV-
ADEC_ECO24      SQGLFDGEKFAFTTLEV-
ADEC_DESRM      DCGLIHVLEHRII-----
ADEC_METAC      DKGLFDVTKFEFV-----
ADEC_SHIBS      SQGLFDGEKFVFTTLEV-
ADEC_METS3      DKGLFDCINFEFI-----
ADEC_FLAPJ      DKGLFSGNTFSFV-----
ADEC_METNO      DRGLVDVDR---------
ADEC_SILPO      DLGLIDV-----------
ADEC_SULNB      DKGLFDGRSFHFIDS---
ADEC_METST      TNGLFNVNTHQFI-----
ADEC_SHEHH      VKGLFDVDQFKFVSLRVD
ADEC_SALRD      DRGLFDGAAFEFVDRFVD
ADEC_PARDP      DLGIVDVTR---------
ADEC_DEIGD      PRGLLDV-----------
ADEC_DEIDV      PRGLLDVE----------
ADEC_BORAP      DKGLFDVDSFCFL-----
ADEC_PARD8      NKGLFNSETFQFTS----
ADEC2_BACSK     DFGLIDVNNGQVV-----
ADEC_BORBU      DKGLFDVDSFCFV-----
ADEC_META3      DFGLIKNNK---------
ADEC_CLOP1      DKGLIDVKKGSIVS----
ADEC_CLOPE      DKGLIDVKKGSIVS----
ADEC_ENTFA      DFGMMDTKSQRF------
ADEC_KLEP3      ------------------
ADEC_LACDA      DKGIFEVK----------
ADEC_DEIRA      ------------------
ADEC1_DESPS     DVGPVD------------
ADEC1_LACSS     DLGNVD------------
ADEC_KLEP7      ------------------
ADEC2_OENOB     DKGIFDVK----------
ADEC_SERP5      ------------------
ADEC2_RHIL3     ------------------
ADEC_CENSY      ------------------
ADEC_METKA      DRGLVKVE----------
ADEC_RUBXD      DRGLVEVGEEGF------
ADEC3_RHIL3     DKGLV-------------
ADEC2_RHIEC     ------------------
ADEC2_AGRT5     ------------------
ADEC4_RHIME     DLGVVD------------
ADEC_MESSB      DKGLVLVPEMEIV-----
ADEC2_JANSC     ------------------
ADEC1_BRAJA     DKGLV-------------
ADEC2_BRAJA     ------------------
ADEC_BRASB      DKGLV-------------
ADEC2_RHIME     ------------------
ADEC1_BRASO     ------------------
ADEC2_BRASO     DKGLV-------------
Y1085_PICTO     SSGIVEVKTRKII-----
Y637_BACHD      QRGIYDVHK---------
YERA_BACSU      PRGIFDVMK---------
Y751_OCEIH      QKGLLDVK----------
Y3012_BACCR     PIGLYDVKSSKVVA----
Y3032_BACAN     FIGLYDVKSGKVVASPVN
HUTI_DEIDV      ------------------
PYRC_GEOLS      ------------------
ALLB_ECOUT      ------------------
ALLB_ECOL6      ------------------
ALLB_ECOL5      ------------------
ALLB_ECOK1      ------------------
ALLB_ECO81      ------------------
ALLB_ECO45      ------------------
ALLB_ECO27      ------------------
PYRC_GEOBB      ------------------
ALLB_SALTY      ------------------
ALLB_SALTI      ------------------
ALLB_SALPK      ------------------
ALLB_SALPB      ------------------
ALLB_SALPA      ------------------
ALLB_SALNS      ------------------
ALLB_SALHS      ------------------
ALLB_SALEP      ------------------
ALLB_SALDC      ------------------
ALLB_SALA4      ------------------
PYRC_GEOSM      ------------------
PYRC_CLOD6      ------------------
ALLB_ENTFA      ------------------
URE12_PSYCK     ------------------
ALLB_SALCH      ------------------
PYRC_THEPX      ------------------
PYRC_THEP3      ------------------
PYRC_ANATD      ------------------
HYDA_RHIRD      ------------------
ALLB_ECOSE      ------------------
ALLB_ECOLU      ------------------
ALLB_ECOLI      ------------------
ALLB_ECOLC      ------------------
ALLB_ECOHS      ------------------
ALLB_ECODH      ------------------
ALLB_ECOBW      ------------------
ALLB_ECO8A      ------------------
ALLB_ECO55      ------------------
ALLB_ECO24      ------------------
ALLB_ECOSM      ------------------
PYRC_SOLUE      ------------------
PYRC_CLOCE      ------------------
HUTI_SILST      ------------------
DPYS_SACKL      ------------------
PYRC_LACS1      ------------------
URE1_BACHD      ------------------
PYRC_LACAC      ------------------
PYRC_CLOBA      ------------------
HYDL_ARTAU      ------------------
HYDA_BURPI      ------------------
ALLB_BACSU      ------------------
URE1_STAAW      ------------------
URE1_STAAT      ------------------
URE1_STAAS      ------------------
URE1_STAAR      ------------------
URE1_STAAN      ------------------
URE1_STAAM      ------------------
URE1_STAAE      ------------------
URE1_STAAC      ------------------
URE1_STAAB      ------------------
URE1_STAA9      ------------------
URE1_STAA8      ------------------
URE1_STAA3      ------------------
URE1_STAA2      ------------------
URE1_STAA1      ------------------
PYRC_PELTS      ------------------
NDDD_ALCXX      ------------------
HUTI_SILPO      ------------------
PYRC_CLOBB      ------------------
ATZC_PSESD      ------------------
URE1_STAS1      ------------------
URE1_RHOPB      ------------------
PHNM_ECOLI      ------------------
URE1_STAES      ------------------
URE1_STAEQ      ------------------
PYRC_CORGL      ------------------
PYRC_BACHD      ------------------
HUTI_GEOSW      ------------------
NAGA_BACSH      ------------------
HUTI_DEIRA      ------------------
URE1_CAMLA      ------------------
PYRC_THETN      ------------------
PYRC_LISMO      ------------------
PYRC_LACH4      ------------------
PYRC_LACDB      ------------------
PYRC_LACDA      ------------------
PYRC_CLOAB      ------------------
HYDA_BACST      ------------------
AGAA_ECOLI      ------------------
PYRC_LYSSC      ------------------
PYRC_LISMH      ------------------
PYRC_LISMF      ------------------
PYRC_LISMC      ------------------
HUTI_BACSK      ------------------
PYRC_LISW6      ------------------
PYRC_CARHZ      ------------------
PYRC_ANOFW      ------------------
HUTI_RHORT      ------------------
HUTI_NOCSJ      ------------------
Y2937_MYCBO     ------------------
Y2913_MYCTU     ------------------
URE1_SULTO      ------------------
URE1_GEOKA      ------------------
URE1_ECO5E      ------------------
URE1_ECO57      ------------------
URE1_CORU7      ------------------
PYRC_LISIN      ------------------
HUTI_RHOS4      ------------------
HUTI_RHOS1      ------------------
URE1_SYNJB      ------------------
PYRC_UNCTG      ------------------
PYRC_STRPN      ------------------
PYRC_DESRM      ------------------
PKSL_BACSU      ------------------
ENO_ANAVT       ------------------
ALN2_DICDI      ------------------
ALLB_BACSK      ------------------
URE1_PROVU      ------------------
URE1_PROMH      ------------------
URE1_BRAJA      ------------------
PYRC_STRR6      ------------------
HUTI_RHOSK      ------------------
ENO_ANASP       ------------------