[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99766.1

[Show Plain Result]


## Summary of Sequence Search
    1::102
    1::102     5e-47 100%  102 aa  RL21_LACS1 RecName: Full=50S ribosomal protein L21;
    1::102     2e-38  85%  102 aa  RL21_LACF3 RecName: Full=50S ribosomal protein L21;
    1::102     1e-36  72%  102 aa  RL21_LACPL RecName: Full=50S ribosomal protein L21;
    1::102     6e-36  80%  102 aa  RL21_LACRJ RecName: Full=50S ribosomal protein L21;
    1::102     6e-36  80%  102 aa  RL21_LACRD RecName: Full=50S ribosomal protein L21;
    4::104     1e-34  79%  104 aa  RL21_STRU0 RecName: Full=50S ribosomal protein L21;
    1::102     3e-34  75%  102 aa  RL21_PEDPA RecName: Full=50S ribosomal protein L21;
    4::104     1e-33  77%  104 aa  RL21_STRTD RecName: Full=50S ribosomal protein L21;
    4::104     1e-33  77%  104 aa  RL21_STRT2 RecName: Full=50S ribosomal protein L21;
    4::104     1e-33  77%  104 aa  RL21_STRT1 RecName: Full=50S ribosomal protein L21;
    1::102     5e-33  62%  102 aa  RL21_ENTFA RecName: Full=50S ribosomal protein L21;
    1::102     7e-33  77%  102 aa  RL21_LISMO RecName: Full=50S ribosomal protein L21;
    1::102     7e-33  77%  102 aa  RL21_LISMH RecName: Full=50S ribosomal protein L21;
    1::102     7e-33  77%  102 aa  RL21_LISMF RecName: Full=50S ribosomal protein L21;
    4::104     9e-33  77%  104 aa  RL21_STRGC RecName: Full=50S ribosomal protein L21;
    1::102     9e-33  76%  102 aa  RL21_LISMC RecName: Full=50S ribosomal protein L21;
    1::102     1e-32  76%  102 aa  RL21_LISW6 RecName: Full=50S ribosomal protein L21;
    1::102     1e-32  76%  102 aa  RL21_LISIN RecName: Full=50S ribosomal protein L21;
    1::102     1e-32  76%  102 aa  RL21_GEOKA RecName: Full=50S ribosomal protein L21;
    1::102     1e-32  63%  102 aa  RL21_BACSU RecName: Full=50S ribosomal protein L21;AltName:
    1::102     3e-32  75%  102 aa  RL21_GEOTN RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  74%  102 aa  RL21_GEOSW RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACWK RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACHK RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACCZ RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACCR RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACC4 RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACC3 RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACC2 RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACC0 RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACAN RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACAH RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACAC RecName: Full=50S ribosomal protein L21;
    1::102     1e-31  73%  102 aa  RL21_BACAA RecName: Full=50S ribosomal protein L21;
    1::102     2e-31  62%  102 aa  RL21_STACT RecName: Full=50S ribosomal protein L21;
    1::102     2e-31  61%  102 aa  RL21_BACA2 RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAW RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAU RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAT RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAS RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAR RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAN RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAM RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAE RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAC RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAAB RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAA9 RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAA8 RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAA3 RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAA2 RecName: Full=50S ribosomal protein L21;
    1::102     3e-31  61%  102 aa  RL21_STAA1 RecName: Full=50S ribosomal protein L21;
    4::104     3e-31  60%  104 aa  RL21_LACLA RecName: Full=50S ribosomal protein L21;
    1::101     3e-31  73%  102 aa  RL21_BACSK RecName: Full=50S ribosomal protein L21;
    4::104     5e-31  75%  104 aa  RL21_STRMU RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  61%  102 aa  RL21_STAES RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  61%  102 aa  RL21_STAEQ RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  72%  102 aa  RL21_BACCQ RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  72%  102 aa  RL21_BACCN RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  72%  102 aa  RL21_BACC7 RecName: Full=50S ribosomal protein L21;
    1::102     5e-31  72%  102 aa  RL21_BACC1 RecName: Full=50S ribosomal protein L21;
    4::104     6e-31  59%  104 aa  RL21_LACLS RecName: Full=50S ribosomal protein L21;
    4::104     6e-31  59%  104 aa  RL21_LACLM RecName: Full=50S ribosomal protein L21;
    1::102     1e-30  60%  102 aa  RL21_STAS1 RecName: Full=50S ribosomal protein L21;
    1::102     1e-30  67%  102 aa  RL21_BACLD RecName: Full=50S ribosomal protein L21;
    1::102     2e-30  60%  102 aa  RL21_STAHJ RecName: Full=50S ribosomal protein L21;
    1::102     3e-30  71%  102 aa  RL21_LYSSC RecName: Full=50S ribosomal protein L21;
    4::104     4e-30  73%  104 aa  RL21_STRSV RecName: Full=50S ribosomal protein L21;
    1::102     7e-30  58%  102 aa  RL21_OCEIH RecName: Full=50S ribosomal protein L21;
    1::102     9e-30  72%  102 aa  RL21_LACSS RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRZT RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRZJ RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRR6 RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRPN RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRPJ RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRPI RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRP7 RecName: Full=50S ribosomal protein L21;
    4::104     1e-29  71%  104 aa  RL21_STRP2 RecName: Full=50S ribosomal protein L21;
    4::104     2e-29  70%  104 aa  RL21_STRZP RecName: Full=50S ribosomal protein L21;
    1::102     2e-29  65%  102 aa  RL21_BACP2 RecName: Full=50S ribosomal protein L21;
    1::102     2e-28  64%  102 aa  RL21_MACCJ RecName: Full=50S ribosomal protein L21;
    1::102     2e-27  58%  102 aa  RL21_EXISA RecName: Full=50S ribosomal protein L21;
    1::102     7e-27  69%  102 aa  RL21_LACBA RecName: Full=50S ribosomal protein L21;
    1::102     1e-25  56%  102 aa  RL21_EXIS2 RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPZ RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPM RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPG RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPF RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPD RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPC RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRPB RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRP8 RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRP6 RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRP3 RecName: Full=50S ribosomal protein L21;
    4::104     1e-24  66%  104 aa  RL21_STRP1 RecName: Full=50S ribosomal protein L21;
    1::102     3e-24  64%  102 aa  RL21_BACHD RecName: Full=50S ribosomal protein L21;
    4::104     7e-24  64%  104 aa  RL21_STRS7 RecName: Full=50S ribosomal protein L21;
    4::104     7e-24  64%  104 aa  RL21_STREM RecName: Full=50S ribosomal protein L21;
    4::104     7e-24  64%  104 aa  RL21_STRE4 RecName: Full=50S ribosomal protein L21;
    1::103     1e-23  62%  103 aa  RL21_LACDB RecName: Full=50S ribosomal protein L21;
    1::103     1e-23  62%  103 aa  RL21_LACDA RecName: Full=50S ribosomal protein L21;
    1::103     2e-23  64%  103 aa  RL21_ALKOO RecName: Full=50S ribosomal protein L21;
    1::103     4e-23  50%  103 aa  RL21_DESHY RecName: Full=50S ribosomal protein L21;
    1::103     4e-23  50%  103 aa  RL21_DESHD RecName: Full=50S ribosomal protein L21;
    1::94      6e-23  54%  101 aa  RL21_MYCA5 RecName: Full=50S ribosomal protein L21;
    1::103     3e-22  49%  103 aa  RL21_RALEJ RecName: Full=50S ribosomal protein L21;
    1::99      3e-22  48%  100 aa  RL21_MYCCT RecName: Full=50S ribosomal protein L21;
    1::98      4e-22  61%  100 aa  RL21_UREPA RecName: Full=50S ribosomal protein L21;
    1::98      4e-22  61%  100 aa  RL21_UREP2 RecName: Full=50S ribosomal protein L21;
    1::102     4e-22  46%  106 aa  RL21_DICNV RecName: Full=50S ribosomal protein L21;
    1::98      7e-22  61%  100 aa  RL21_UREU1 RecName: Full=50S ribosomal protein L21;
    1::99      9e-22  47%  100 aa  RL21_MYCMS RecName: Full=50S ribosomal protein L21;
    4::104     1e-21  62%  104 aa  RL21_STRA5 RecName: Full=50S ribosomal protein L21;
    4::104     1e-21  62%  104 aa  RL21_STRA3 RecName: Full=50S ribosomal protein L21;
    4::104     1e-21  62%  104 aa  RL21_STRA1 RecName: Full=50S ribosomal protein L21;
    1::94      1e-21  51%   99 aa  RL21_MYCHJ RecName: Full=50S ribosomal protein L21;
    1::94      1e-21  51%   99 aa  RL21_MYCH7 RecName: Full=50S ribosomal protein L21;
    1::103     1e-21  58%  103 aa  RL21_DESAD RecName: Full=50S ribosomal protein L21;
    1::104     2e-21  52%  104 aa  RL21_THICR RecName: Full=50S ribosomal protein L21;
    1::102     2e-21  47%  102 aa  RL21_DESDG RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  60%  103 aa  RL21_LACH4 RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  48%  103 aa  RL21_RALEH RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  59%  103 aa  RL21_LACJO RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  60%  103 aa  RL21_LACAC RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  48%  103 aa  RL21_CUPTR RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  59%  103 aa  RL21_CLOD6 RecName: Full=50S ribosomal protein L21;
    1::103     3e-21  48%  103 aa  RL21_AZOSB RecName: Full=50S ribosomal protein L21;
    1::103     4e-21  48%  103 aa  RL21_RALME RecName: Full=50S ribosomal protein L21;
    1::101     4e-21  50%  103 aa  RL21_DESAP RecName: Full=50S ribosomal protein L21;
    1::103     4e-21  47%  103 aa  RL21_DECAR RecName: Full=50S ribosomal protein L21;
    1::103     4e-21  46%  103 aa  RL21_BORA1 RecName: Full=50S ribosomal protein L21;
    1::94      6e-21  50%   99 aa  RL21_MYCH2 RecName: Full=50S ribosomal protein L21;
    1::101     6e-21  49%  104 aa  RL21_MOOTA RecName: Full=50S ribosomal protein L21;
    1::102     8e-21  46%  102 aa  RL21_DESVM RecName: Full=50S ribosomal protein L21;
    1::103     1e-20  46%  104 aa  RL21_METFK RecName: Full=50S ribosomal protein L21;
    1::99      1e-20  47%   99 aa  RL21_MESFL RecName: Full=50S ribosomal protein L21;
    1::103     1e-20  46%  103 aa  RL21_BORPD RecName: Full=50S ribosomal protein L21;
    1::102     1e-20  59%  102 aa  RL21_FINM2 RecName: Full=50S ribosomal protein L21;
    1::103     2e-20  46%  103 aa  RL21_RALPJ RecName: Full=50S ribosomal protein L21;
    1::103     2e-20  46%  103 aa  RL21_BORPE RecName: Full=50S ribosomal protein L21;
    1::103     2e-20  46%  103 aa  RL21_BORPA RecName: Full=50S ribosomal protein L21;
    1::103     2e-20  46%  103 aa  RL21_BORBR RecName: Full=50S ribosomal protein L21;
    1::103     2e-20  46%  103 aa  RL21_THIDA RecName: Full=50S ribosomal protein L21;
    3::102     2e-20  44%  104 aa  RL21_SYMTH RecName: Full=50S ribosomal protein L21;
    1::99      3e-20  48%  101 aa  RL21_THET8 RecName: Full=50S ribosomal protein L21;
    1::99      3e-20  48%  101 aa  RL21_THET2 RecName: Full=50S ribosomal protein L21;
    1::101     3e-20  48%  103 aa  RL21_LEPCP RecName: Full=50S ribosomal protein L21;
    1::102     3e-20  44%  102 aa  RL21_DESVV RecName: Full=50S ribosomal protein L21;
    1::102     3e-20  44%  102 aa  RL21_DESVH RecName: Full=50S ribosomal protein L21;
    1::103     4e-20  45%  103 aa  RL21_RUTMC RecName: Full=50S ribosomal protein L21;
    1::103     4e-20  46%  103 aa  RL21_RALSO RecName: Full=50S ribosomal protein L21;
    1::101     5e-20  46%  105 aa  RL21_NATTJ RecName: Full=50S ribosomal protein L21;
    1::98      5e-20  47%  100 aa  RL21_MYCGA RecName: Full=50S ribosomal protein L21;
    1::97      5e-20  47%   99 aa  RL21_MYCAP RecName: Full=50S ribosomal protein L21;
    1::102     6e-20  58%  102 aa  RL21_SORC5 RecName: Full=50S ribosomal protein L21;
    1::97      6e-20  49%  100 aa  RL21_MYCS5 RecName: Full=50S ribosomal protein L21;
    1::103     6e-20  47%  103 aa  RL21_BURXL RecName: Full=50S ribosomal protein L21;
    1::103     6e-20  47%  103 aa  RL21_BURPP RecName: Full=50S ribosomal protein L21;
    1::103     6e-20  47%  103 aa  RL21_BURP8 RecName: Full=50S ribosomal protein L21;
    1::103     1e-19  45%  103 aa  RL21_DIAST RecName: Full=50S ribosomal protein L21;
    1::103     1e-19  45%  103 aa  RL21_ACISJ RecName: Full=50S ribosomal protein L21;
    1::103     1e-19  45%  103 aa  RL21_VESOH RecName: Full=50S ribosomal protein L21;
    1::103     1e-19  45%  103 aa  RL21_SHEPA RecName: Full=50S ribosomal protein L21;
    1::103     1e-19  45%  103 aa  RL21_SHEHH RecName: Full=50S ribosomal protein L21;
    1::102     1e-19  47%  102 aa  RL21_MARMS RecName: Full=50S ribosomal protein L21;
    1::102     1e-19  47%  103 aa  RL21_HERAR RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  44%  103 aa  RL21_POLSQ RecName: Full=50S ribosomal protein L21;
    1::102     2e-19  43%  103 aa  RL21_LARHH RecName: Full=50S ribosomal protein L21;
    1::102     2e-19  43%  102 aa  RL21_GEOSM RecName: Full=50S ribosomal protein L21;
    1::104     2e-19  59%  104 aa  RL21_CLOBM RecName: Full=50S ribosomal protein L21;
    1::104     2e-19  59%  104 aa  RL21_CLOBL RecName: Full=50S ribosomal protein L21;
    1::104     2e-19  59%  104 aa  RL21_CLOBK RecName: Full=50S ribosomal protein L21;
    1::104     2e-19  59%  104 aa  RL21_CLOBJ RecName: Full=50S ribosomal protein L21;
    1::104     2e-19  59%  104 aa  RL21_CLOB6 RecName: Full=50S ribosomal protein L21;
    1::102     2e-19  43%  103 aa  RL21_CHRVO RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURVG RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURTA RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURS3 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURPS RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURP6 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURP0 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURMS RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURMA RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURM9 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURM7 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURM1 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURCM RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURCJ RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURCH RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURCC RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURCA RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  46%  103 aa  RL21_BURA4 RecName: Full=50S ribosomal protein L21;
    1::103     2e-19  47%  103 aa  RL21_AZOVD RecName: Full=50S ribosomal protein L21;
    1::103     3e-19  43%  103 aa  RL21_POLNS RecName: Full=50S ribosomal protein L21;
    1::102     3e-19  57%  102 aa  RL21_PHYAS RecName: Full=50S ribosomal protein L21;
    1::104     3e-19  59%  104 aa  RL21_CLOBH RecName: Full=50S ribosomal protein L21;
    1::104     3e-19  59%  104 aa  RL21_CLOB1 RecName: Full=50S ribosomal protein L21;
    1::103     4e-19  44%  103 aa  RL21_SHEPW RecName: Full=50S ribosomal protein L21;
    1::101     4e-19  46%  103 aa  RL21_POLNA RecName: Full=50S ribosomal protein L21;
    1::97      4e-19  58%   99 aa  RL21_ACHLI RecName: Full=50S ribosomal protein L21;
    1::101     5e-19  46%  103 aa  RL21_POLSJ RecName: Full=50S ribosomal protein L21;
    1::100     5e-19  59%  102 aa  RL21_ONYPE RecName: Full=50S ribosomal protein L21;
    1::102     5e-19  43%  102 aa  RL21_GEOBB RecName: Full=50S ribosomal protein L21;
    1::103     5e-19  51%  103 aa  RL21_CLOCE RecName: Full=50S ribosomal protein L21;
    1::103     7e-19  44%  103 aa  RL21_PSYIN RecName: Full=50S ribosomal protein L21;
    1::103     7e-19  57%  103 aa  RL21_CLOBB RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBVY RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBVU RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBHB RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBHA RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBCM RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBCH RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  44%  103 aa  RL21_VIBC3 RecName: Full=50S ribosomal protein L21;
    1::101     9e-19  44%  103 aa  RL21_VEREI RecName: Full=50S ribosomal protein L21;
    1::101     9e-19  42%  102 aa  RL21_DESDA RecName: Full=50S ribosomal protein L21;
    1::103     9e-19  45%  103 aa  RL21_DELAS RecName: Full=50S ribosomal protein L21;
    1::104     9e-19  57%  104 aa  RL21_CLOTE RecName: Full=50S ribosomal protein L21;
    1::100     9e-19  58%  102 aa  RL21_AYWBP RecName: Full=50S ribosomal protein L21;
    1::103     1e-18  43%  103 aa  RL21_VIBSL RecName: Full=50S ribosomal protein L21;
    1::103     1e-18  43%  103 aa  RL21_VIBPA RecName: Full=50S ribosomal protein L21;
    1::101     1e-18  46%  103 aa  RL21_TERTT RecName: Full=50S ribosomal protein L21;
    1::101     1e-18  45%  103 aa  RL21_SACD2 RecName: Full=50S ribosomal protein L21;
    1::102     1e-18  40%  102 aa  RL21_PELCD RecName: Full=50S ribosomal protein L21;
    1::103     1e-18  42%  103 aa  RL21_ACIF5 RecName: Full=50S ribosomal protein L21;
    1::103     1e-18  42%  103 aa  RL21_ACIF2 RecName: Full=50S ribosomal protein L21;
    1::102     2e-18  50%  103 aa  RL21_THISH RecName: Full=50S ribosomal protein L21;
    1::104     2e-18  51%  104 aa  RL21_SYNWW RecName: Full=50S ribosomal protein L21;
    1::101     2e-18  42%  103 aa  RL21_RHOFD RecName: Full=50S ribosomal protein L21;
    1::103     2e-18  56%  103 aa  RL21_CLONN RecName: Full=50S ribosomal protein L21;
    1::101     2e-18  44%  103 aa  RL21_VARPS RecName: Full=50S ribosomal protein L21;
    1::102     2e-18  43%  102 aa  RL21_PELPD RecName: Full=50S ribosomal protein L21;
    1::103     3e-18  44%  103 aa  RL21_SHESH RecName: Full=50S ribosomal protein L21;
    1::101     3e-18  46%  102 aa  RL21_EUBR3 RecName: Full=50S ribosomal protein L21;
    1::103     3e-18  57%  103 aa  RL21_CLOBA RecName: Full=50S ribosomal protein L21;
    1::103     4e-18  45%  103 aa  RL21_PSEA7 RecName: Full=50S ribosomal protein L21;
    1::103     5e-18  44%  198 aa  RL21_SILST RecName: Full=50S ribosomal protein L21;
    1::102     5e-18  53%  102 aa  RL21_PHYMT RecName: Full=50S ribosomal protein L21;
    1::103     5e-18  43%  103 aa  RL21_IDILO RecName: Full=50S ribosomal protein L21;
    1::103     5e-18  43%  103 aa  RL21_ALTMD RecName: Full=50S ribosomal protein L21;
    1::101     6e-18  47%  193 aa  RL21_SILPO RecName: Full=50S ribosomal protein L21;
    1::103     6e-18  43%  103 aa  RL21_PSEHT RecName: Full=50S ribosomal protein L21;
    1::98      6e-18  52%  100 aa  RL21_MYCPE RecName: Full=50S ribosomal protein L21;
    1::102     6e-18  43%  102 aa  RL21_GEOLS RecName: Full=50S ribosomal protein L21;
    1::103     6e-18  53%  104 aa  RL21_ALHEH RecName: Full=50S ribosomal protein L21;
    1::103     8e-18  43%  103 aa  RL21_SHEWM RecName: Full=50S ribosomal protein L21;
    1::103     8e-18  42%  103 aa  RL21_SHELP RecName: Full=50S ribosomal protein L21;
    1::94      8e-18  47%  131 aa  RL21_RHOSK RecName: Full=50S ribosomal protein L21;
    1::94      8e-18  47%  131 aa  RL21_RHOS4 RecName: Full=50S ribosomal protein L21;
    1::94      8e-18  47%  131 aa  RL21_RHOS1 RecName: Full=50S ribosomal protein L21;
    1::103     8e-18  44%  103 aa  RL21_PSEAE RecName: Full=50S ribosomal protein L21;
    1::103     8e-18  44%  103 aa  RL21_PSEAB RecName: Full=50S ribosomal protein L21;
    1::103     8e-18  44%  103 aa  RL21_PSEA8 RecName: Full=50S ribosomal protein L21;
    1::102     8e-18  42%  103 aa  RL21_NITMU RecName: Full=50S ribosomal protein L21;
    1::100     8e-18  41%  102 aa  RL21_LAWIP RecName: Full=50S ribosomal protein L21;
    1::100     8e-18  41%  102 aa  RL21_LAWIN RecName: Full=50S ribosomal protein L21;
    1::98      1e-17  45%  124 aa  RL21_SINMW RecName: Full=50S ribosomal protein L21;
    1::101     1e-17  44%  102 aa  RL21_PHOLL RecName: Full=50S ribosomal protein L21;
    1::103     1e-17  56%  103 aa  RL21_PELTS RecName: Full=50S ribosomal protein L21;
    1::103     1e-17  41%  103 aa  RL21_KLEP7 RecName: Full=50S ribosomal protein L21;
    1::103     1e-17  41%  103 aa  RL21_KLEP3 RecName: Full=50S ribosomal protein L21;
    1::101     1e-17  48%  115 aa  RL21_COXBU RecName: Full=50S ribosomal protein L21;
    1::101     1e-17  48%  115 aa  RL21_COXBR RecName: Full=50S ribosomal protein L21;
    1::103     1e-17  41%  103 aa  RL21_PECCP RecName: Full=50S ribosomal protein L21;
    1::103     1e-17  44%  103 aa  RL21_HAEDU RecName: Full=50S ribosomal protein L21;
    1::102     1e-17  41%  102 aa  RL21_GEOSF RecName: Full=50S ribosomal protein L21;
    1::101     1e-17  47%  115 aa  RL21_COXBN RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SHIFL RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SHIF8 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SHIDS RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SHIBS RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SHIB3 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_SALSV RecName: Full=50S ribosomal protein L21;
    1::102     2e-17  41%  102 aa  RL21_GEOUR RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ESCF3 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ENT38 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOUT RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOSM RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOSE RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOLU RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOLI RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOLC RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOL5 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOHS RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECODH RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECOBW RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO8A RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO81 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO7I RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO5E RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO57 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO55 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO45 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO27 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_ECO24 RecName: Full=50S ribosomal protein L21;
    1::102     2e-17  40%  102 aa  RL21_DESMR RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  48%  103 aa  RL21_CARHZ RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_VIBFM RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  40%  103 aa  RL21_VIBF1 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALTY RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALTI RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALPB RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALNS RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALHS RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALG2 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALEP RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  39%  103 aa  RL21_SALA4 RecName: Full=50S ribosomal protein L21;
    1::103     2e-17  56%  103 aa  RL21_HELMI RecName: Full=50S ribosomal protein L21;
    1::101     2e-17  54%  103 aa  RL21_ALCBS RecName: Full=50S ribosomal protein L21;
    1::101     3e-17  41%  103 aa  RL21_TREDE RecName: Full=50S ribosomal protein L21;
    1::101     3e-17  55%  107 aa  RL21_THELT RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  41%  103 aa  RL21_SHESR RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  41%  103 aa  RL21_SHESM RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  39%  103 aa  RL21_SALPK RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  39%  103 aa  RL21_SALPA RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  41%  103 aa  RL21_PHOPR RecName: Full=50S ribosomal protein L21;
    1::103     3e-17  40%  103 aa  RL21_ALISL RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPY RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPS RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPP RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPN RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPG RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPE RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPB RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERPA RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  39%  103 aa  RL21_YERP3 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  40%  103 aa  RL21_SHEB9 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  40%  103 aa  RL21_SHEB8 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  40%  103 aa  RL21_SHEB5 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  40%  103 aa  RL21_SHEB2 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  40%  103 aa  RL21_PSEA6 RecName: Full=50S ribosomal protein L21;
    1::103     4e-17  54%  103 aa  RL21_ALKMQ RecName: Full=50S ribosomal protein L21;
    1::103     5e-17  41%  103 aa  RL21_SHESW RecName: Full=50S ribosomal protein L21;
    1::103     5e-17  41%  103 aa  RL21_SHESA RecName: Full=50S ribosomal protein L21;
    1::103     5e-17  41%  103 aa  RL21_SHEPC RecName: Full=50S ribosomal protein L21;
    1::103     5e-17  41%  103 aa  RL21_SHEON RecName: Full=50S ribosomal protein L21;
    1::101     5e-17  42%  102 aa  RL21_PROMH RecName: Full=50S ribosomal protein L21;
    1::102     5e-17  41%  102 aa  RL21_GEOSL RecName: Full=50S ribosomal protein L21;
    1::103     5e-17  38%  103 aa  RL21_ERWT9 RecName: Full=50S ribosomal protein L21;
    1::102     7e-17  40%  104 aa  RL21_THEPX RecName: Full=50S ribosomal protein L21;
    1::102     7e-17  40%  104 aa  RL21_THEP3 RecName: Full=50S ribosomal protein L21;
    1::103     7e-17  39%  103 aa  RL21_SHISS RecName: Full=50S ribosomal protein L21;
    1::103     7e-17  54%  103 aa  RL21_METCA RecName: Full=50S ribosomal protein L21;
    1::103     7e-17  40%  103 aa  RL21_ERWCT RecName: Full=50S ribosomal protein L21;
    1::103     1e-16  40%  103 aa  RL21_NITEU RecName: Full=50S ribosomal protein L21;
    1::101     1e-16  40%  103 aa  RL21_DESAH RecName: Full=50S ribosomal protein L21;
    1::102     1e-16  48%  107 aa  RL21_BUCAP RecName: Full=50S ribosomal protein L21;
    1::103     1e-16  41%  103 aa  RL21_SODGM RecName: Full=50S ribosomal protein L21;
    1::101     1e-16  38%  102 aa  RL21_NEIMF RecName: Full=50S ribosomal protein L21;
    1::101     1e-16  38%  102 aa  RL21_NEIMB RecName: Full=50S ribosomal protein L21;
    1::101     1e-16  38%  102 aa  RL21_NEIMA RecName: Full=50S ribosomal protein L21;
    1::101     1e-16  38%  102 aa  RL21_NEIG1 RecName: Full=50S ribosomal protein L21;
    1::101     2e-16  41%  104 aa  RL21_THEYD RecName: Full=50S ribosomal protein L21;
    1::104     2e-16  44%  104 aa  RL21_FUSNN RecName: Full=50S ribosomal protein L21;
    1::102     2e-16  41%  103 aa  RL21_COLP3 RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  53%  103 aa  RL21_CLOPS RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  53%  103 aa  RL21_CLOPE RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  53%  103 aa  RL21_CLOP1 RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  47%  108 aa  RL21_BUCAT RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  47%  108 aa  RL21_BUCAI RecName: Full=50S ribosomal protein L21;
    1::103     2e-16  47%  108 aa  RL21_BUCA5 RecName: Full=50S ribosomal protein L21;
    1::103     3e-16  54%  103 aa  RL21_CLOTH RecName: Full=50S ribosomal protein L21;
    1::101     3e-16  44%  102 aa  RL21_GEOMG RecName: Full=50S ribosomal protein L21;
    1::102     3e-16  42%  102 aa  RL21_EUBE2 RecName: Full=50S ribosomal protein L21;
    6::106     3e-16  42%  132 aa  RL21_DEHSC RecName: Full=50S ribosomal protein L21;
    1::101     3e-16  44%  103 aa  RL21_CALS8 RecName: Full=50S ribosomal protein L21;
    1::102     4e-16  40%  104 aa  RL21_THEP1 RecName: Full=50S ribosomal protein L21;
    1::100     6e-16  38%  106 aa  RL21_XANOR RecName: Full=50S ribosomal protein L21;
    1::100     6e-16  38%  106 aa  RL21_XANOM RecName: Full=50S ribosomal protein L21;
    1::100     7e-16  37%  106 aa  RL21_XANC5 RecName: Full=50S ribosomal protein L21;
    1::100     7e-16  37%  106 aa  RL21_XANAC RecName: Full=50S ribosomal protein L21;
    1::102     7e-16  40%  104 aa  RL21_THETN RecName: Full=50S ribosomal protein L21;
    3::102     7e-16  42%  115 aa  RL21_SYNP2 RecName: Full=50S ribosomal protein L21;
    1::100     7e-16  37%  105 aa  RL21_STRM5 RecName: Full=50S ribosomal protein L21;
    1::100     1e-15  37%  106 aa  RL21_XANCP RecName: Full=50S ribosomal protein L21;
    1::100     1e-15  37%  106 aa  RL21_XANCB RecName: Full=50S ribosomal protein L21;
    1::100     1e-15  37%  106 aa  RL21_XANC8 RecName: Full=50S ribosomal protein L21;
    1::102     1e-15  39%  104 aa  RL21_THESQ RecName: Full=50S ribosomal protein L21;
    2::103     1e-15  39%  105 aa  RL21_THEMA RecName: Full=50S ribosomal protein L21;
    1::103     1e-15  55%  103 aa  RL21_BREBN RecName: Full=50S ribosomal protein L21;
    1::69      1e-15  54%  123 aa  RL21_RHIME RecName: Full=50S ribosomal protein L21;
    1::103     1e-15  39%  103 aa  RL21_PSEMY RecName: Full=50S ribosomal protein L21;
    1::103     1e-15  39%  103 aa  RL21_NITEC RecName: Full=50S ribosomal protein L21;
    1::103     1e-15  44%  104 aa  RL21_DESOH RecName: Full=50S ribosomal protein L21;
    6::106     1e-15  42%  132 aa  RL21_DEHE1 RecName: Full=50S ribosomal protein L21;
    1::65      2e-15  52%  216 aa  RL21_ROSDO RecName: Full=50S ribosomal protein L21;
    1::69      2e-15  54%  123 aa  RL21_RHISN RecName: Full=50S ribosomal protein L21;
    1::94      2e-15  43%   99 aa  RL21_MYCPU RecName: Full=50S ribosomal protein L21;
    1::101     2e-15  39%  106 aa  RL21_SYNFM RecName: Full=50S ribosomal protein L21;
    1::100     2e-15  37%  102 aa  RL21_STRMK RecName: Full=50S ribosomal protein L21;
    3::102     2e-15  54%  135 aa  RL21_NOSP7 RecName: Full=50S ribosomal protein L21;
    1::101     2e-15  49%  101 aa  RL21_ANADE RecName: Full=50S ribosomal protein L21;
    1::102     3e-15  39%  104 aa  RL21_KOSOT RecName: Full=50S ribosomal protein L21;
    1::101     3e-15  49%  101 aa  RL21_ANASK RecName: Full=50S ribosomal protein L21;
    1::101     3e-15  49%  101 aa  RL21_ANAD2 RecName: Full=50S ribosomal protein L21;
    1::100     4e-15  43%  120 aa  RL21_ROSCS RecName: Full=50S ribosomal protein L21;
    1::101     4e-15  53%  103 aa  RL21_LEGPH RecName: Full=50S ribosomal protein L21;
    1::101     4e-15  53%  103 aa  RL21_LEGPC RecName: Full=50S ribosomal protein L21;
    1::101     4e-15  53%  103 aa  RL21_LEGPA RecName: Full=50S ribosomal protein L21;
    1::103     4e-15  44%  104 aa  RL21_HALHL RecName: Full=50S ribosomal protein L21;
    1::101     4e-15  39%  103 aa  RL21_AMOA5 RecName: Full=50S ribosomal protein L21;
    1::103     4e-15  38%  103 aa  RL21_ACIAC RecName: Full=50S ribosomal protein L21;
    1::68      5e-15  55%  103 aa  RL21_PSEPF RecName: Full=50S ribosomal protein L21;
    1::68      5e-15  55%  103 aa  RL21_PSEF5 RecName: Full=50S ribosomal protein L21;
    1::101     5e-15  47%  105 aa  RL21_DICTD RecName: Full=50S ribosomal protein L21;
    1::103     5e-15  50%  103 aa  RL21_DESPS RecName: Full=50S ribosomal protein L21;
    1::103     6e-15  50%  103 aa  RL21_RHOCS RecName: Full=50S ribosomal protein L21;
    3::102     6e-15  52%  130 aa  RL21_ANAVT RecName: Full=50S ribosomal protein L21;
    3::102     6e-15  52%  130 aa  RL21_ANASP RecName: Full=50S ribosomal protein L21;
    1::103     8e-15  36%  106 aa  RL21_THEM4 RecName: Full=50S ribosomal protein L21;
    3::103     1e-14  45%  130 aa  RL21_CYAP4 RecName: Full=50S ribosomal protein L21;
    1::97      1e-14  43%  129 aa  RL21_OCHA4 RecName: Full=50S ribosomal protein L21;
    1::101     1e-14  52%  103 aa  RL21_LEGPL RecName: Full=50S ribosomal protein L21;
    1::103     2e-14  50%  103 aa  RL21_CLOK5 RecName: Full=50S ribosomal protein L21;
    1::103     2e-14  50%  103 aa  RL21_CLOK1 RecName: Full=50S ribosomal protein L21;
    1::98      2e-14  41%  157 aa  RL21_BARBK RecName: Full=50S ribosomal protein L21;
    1::64      2e-14  49%  104 aa  RL21_NITOC RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIBY RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIBT RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIBS RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIBC RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIB5 RecName: Full=50S ribosomal protein L21;
    1::102     2e-14  52%  103 aa  RL21_ACIB3 RecName: Full=50S ribosomal protein L21;
    1::102     3e-14  39%  103 aa  RL21_SYNAS RecName: Full=50S ribosomal protein L21;
    1::102     3e-14  51%  102 aa  RL21_NITSB RecName: Full=50S ribosomal protein L21;
    1::102     3e-14  38%  103 aa  RL21_METPP RecName: Full=50S ribosomal protein L21;
    1::103     3e-14  39%  103 aa  RL21_CHRSD RecName: Full=50S ribosomal protein L21;
    1::102     3e-14  51%  103 aa  RL21_ACIAD RecName: Full=50S ribosomal protein L21;
    1::101     4e-14  40%  223 aa  RL21_RHILO RecName: Full=50S ribosomal protein L21;
    1::97      4e-14  42%  142 aa  RL21_BRUSU RecName: Full=50S ribosomal protein L21;
    1::97      4e-14  42%  142 aa  RL21_BRUSI RecName: Full=50S ribosomal protein L21;
    1::97      4e-14  42%  142 aa  RL21_BRUME RecName: Full=50S ribosomal protein L21;
    1::97      4e-14  42%  142 aa  RL21_BRUMB RecName: Full=50S ribosomal protein L21;
    1::103     5e-14  45%  104 aa  RL21_ACICJ RecName: Full=50S ribosomal protein L21;
    1::103     7e-14  37%  103 aa  RL21_YERE8 RecName: Full=50S ribosomal protein L21;
    1::103     7e-14  43%  104 aa  RL21_UNCTG RecName: Full=50S ribosomal protein L21;
    1::68      7e-14  49%  105 aa  RL21_RHILW RecName: Full=50S ribosomal protein L21;
    1::68      7e-14  49%  105 aa  RL21_RHIL3 RecName: Full=50S ribosomal protein L21;
    1::68      7e-14  49%  105 aa  RL21_RHIE6 RecName: Full=50S ribosomal protein L21;
    3::103     7e-14  40%  136 aa  RL21_ACAM1 RecName: Full=50S ribosomal protein L21;
    3::103     9e-14  44%  136 aa  RL21_TRIEI RecName: Full=50S ribosomal protein L21;
    1::103     9e-14  38%  103 aa  RL21_TOLAT RecName: Full=50S ribosomal protein L21;
    1::97      9e-14  41%  142 aa  RL21_BRUAB RecName: Full=50S ribosomal protein L21;
    1::97      9e-14  41%  142 aa  RL21_BRUA2 RecName: Full=50S ribosomal protein L21;
    1::97      9e-14  41%  142 aa  RL21_BRUA1 RecName: Full=50S ribosomal protein L21;
    1::94      9e-14  40%  158 aa  RL21_BART1 RecName: Full=50S ribosomal protein L21;
    1::66      9e-14  52%  102 aa  RL21_AZOC5 RecName: Full=50S ribosomal protein L21;
    1::101     1e-13  49%  106 aa  RL21_XYLFT RecName: Full=50S ribosomal protein L21;
    1::100     1e-13  42%  120 aa  RL21_ROSS1 RecName: Full=50S ribosomal protein L21;
    1::99      1e-13  44%  105 aa  RL21_RICPU RecName: Full=50S ribosomal protein L21;
    1::99      1e-13  43%  105 aa  RL21_RICCK RecName: Full=50S ribosomal protein L21;
    1::103     1e-13  38%  103 aa  RL21_PSYCK RecName: Full=50S ribosomal protein L21;
    1::103     1e-13  38%  103 aa  RL21_PSYA2 RecName: Full=50S ribosomal protein L21;
    1::103     1e-13  38%  103 aa  RL21_AZOSE RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICTY RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICRS RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICRO RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICPR RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICFE RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICCN RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICAH RecName: Full=50S ribosomal protein L21;
    1::99      2e-13  43%  105 aa  RL21_RICAE RecName: Full=50S ribosomal protein L21;
    1::68      2e-13  49%  105 aa  RL21_RHIEC RecName: Full=50S ribosomal protein L21;
    1::94      2e-13  39%  100 aa  RL21_MYCPN RecName: Full=50S ribosomal protein L21;
    1::101     2e-13  43%  147 aa  RL21_FLAJ1 RecName: Full=50S ribosomal protein L21;
    1::103     2e-13  36%  103 aa  RL21_MANSM RecName: Full=50S ribosomal protein L21;
    1::97      2e-13  41%  142 aa  RL21_BRUC2 RecName: Full=50S ribosomal protein L21;
    1::98      2e-13  38%  158 aa  RL21_BARHE RecName: Full=50S ribosomal protein L21;
    1::103     2e-13  36%  103 aa  RL21_ACTSZ RecName: Full=50S ribosomal protein L21;
    3::70      3e-13  50%  134 aa  RL21_PELUB RecName: Full=50S ribosomal protein L21;
    1::101     3e-13  50%  101 aa  RL21_MAGSM RecName: Full=50S ribosomal protein L21;
    1::101     3e-13  46%  103 aa  RL21_HAMD5 RecName: Full=50S ribosomal protein L21;
    1::103     3e-13  36%  103 aa  RL21_HAEPS RecName: Full=50S ribosomal protein L21;
    1::100     3e-13  34%  102 aa  RL21_SACEN RecName: Full=50S ribosomal protein L21;
    1::68      3e-13  48%  125 aa  RL21_METSB RecName: Full=50S ribosomal protein L21;
    1::103     3e-13  36%  103 aa  RL21_HAES2 RecName: Full=50S ribosomal protein L21;
    1::103     3e-13  36%  103 aa  RL21_HAES1 RecName: Full=50S ribosomal protein L21;
    1::95      3e-13  41%  100 aa  RL21_DEIRA RecName: Full=50S ribosomal protein L21;
    1::102     3e-13  44%  112 aa  RL21_BUCBP RecName: Full=50S ribosomal protein L21;
    1::101     4e-13  48%  106 aa  RL21_XYLFA RecName: Full=50S ribosomal protein L21;
    1::94      4e-13  41%  100 aa  RL21_RHORT RecName: Full=50S ribosomal protein L21;
    1::102     6e-13  38%  104 aa  RL21_PETMO RecName: Full=50S ribosomal protein L21;
    1::68      6e-13  48%  105 aa  RL21_AGRRK RecName: Full=50S ribosomal protein L21;
    3::102     8e-13  51%  127 aa  RL21_SYNE7 RecName: Full=50S ribosomal protein L21;
    1::103     8e-13  33%  103 aa  RL21_SHEAM RecName: Full=50S ribosomal protein L21;
    1::68      8e-13  45%  103 aa  RL21_SERP5 RecName: Full=50S ribosomal protein L21;
    3::103     8e-13  44%  129 aa  RL21_MICAN RecName: Full=50S ribosomal protein L21;
    3::103     8e-13  45%  136 aa  RL21_CYAP7 RecName: Full=50S ribosomal protein L21;
    1::68      8e-13  49%  104 aa  RL21_AGRVS RecName: Full=50S ribosomal protein L21;
    1::103     1e-12  35%  103 aa  RL21_SHEDO RecName: Full=50S ribosomal protein L21;
    1::102     1e-12  38%  102 aa  RL21_CLOPH RecName: Full=50S ribosomal protein L21;
    1::63      1e-12  48%  171 aa  RL21_CAUCR RecName: Full=50S ribosomal protein L21;
    1::101     1e-12  38%  102 aa  RL21_BIFAA RecName: Full=50S ribosomal protein L21;
    1::103     1e-12  34%  103 aa  RL21_SHEFN RecName: Full=50S ribosomal protein L21;
    1::64      1e-12  56%  100 aa  RL21_MAGSA RecName: Full=50S ribosomal protein L21;
    1::98      1e-12  51%  104 aa  RL21_HELHP RecName: Full=50S ribosomal protein L21;
    2::103     1e-12  37%  121 aa  RL21_GLOVI RecName: Full=50S ribosomal protein L21;
    1::103     1e-12  44%  103 aa  RL21_BEII9 RecName: Full=50S ribosomal protein L21;
    1::68      2e-12  49%  104 aa  RL21_GRABC RecName: Full=50S ribosomal protein L21;
    1::68      2e-12  48%  103 aa  RL21_HAHCH RecName: Full=50S ribosomal protein L21;
    1::95      2e-12  39%  100 aa  RL21_DEIDV RecName: Full=50S ribosomal protein L21;
   18::118     3e-12  34%  125 aa  RL21_SYNS3 RecName: Full=50S ribosomal protein L21;
    1::101     3e-12  37%  102 aa  RL21_BIFA0 RecName: Full=50S ribosomal protein L21;
    1::99      4e-12  42%  105 aa  RL21_RICBR RecName: Full=50S ribosomal protein L21;
    1::99      4e-12  42%  105 aa  RL21_RICB8 RecName: Full=50S ribosomal protein L21;
    1::65      4e-12  43%  258 aa  RL21_JANSC RecName: Full=50S ribosomal protein L21;
    1::102     4e-12  36%  103 aa  RL21_JANMA RecName: Full=50S ribosomal protein L21;
    1::98      4e-12  36%   99 aa  RL21_DEIGD RecName: Full=50S ribosomal protein L21;
    1::101     4e-12  38%  102 aa  RL21_BIFLO RecName: Full=50S ribosomal protein L21;
    1::101     4e-12  38%  102 aa  RL21_BIFLI RecName: Full=50S ribosomal protein L21;
    1::101     4e-12  38%  102 aa  RL21_BIFLD RecName: Full=50S ribosomal protein L21;
    1::103     4e-12  33%  103 aa  RL21_AERS4 RecName: Full=50S ribosomal protein L21;
    1::103     4e-12  33%  103 aa  RL21_AERHH RecName: Full=50S ribosomal protein L21;
    3::102     5e-12  43%  127 aa  RL21_SYNP6 RecName: Full=50S ribosomal protein L21;
    1::103     5e-12  43%  114 aa  RL21_PARUW RecName: Full=50S ribosomal protein L21;
    1::103     5e-12  47%  105 aa  RL21_DESAA RecName: Full=50S ribosomal protein L21;
    4::101     5e-12  47%  106 aa  RL21_CHLCV RecName: Full=50S ribosomal protein L21;
   19::119     6e-12  32%  152 aa  RL21_PROMA RecName: Full=50S ribosomal protein L21;
    1::100     8e-12  34%  101 aa  RL21_CORA7 RecName: Full=50S ribosomal protein L21;
    1::105     1e-11  41%  108 aa  RL21_ORITI RecName: Full=50S ribosomal protein L21;
    1::103     1e-11  36%  223 aa  RL21_MARMM RecName: Full=50S ribosomal protein L21;
    1::99      1e-11  35%  104 aa  RL21_AZOPC RecName: Full=50S ribosomal protein L21;
    1::68      1e-11  46%  104 aa  RL21_AGRT5 RecName: Full=50S ribosomal protein L21;
    1::103     1e-11  34%  103 aa  RL21_ACTP2 RecName: Full=50S ribosomal protein L21;
    1::101     1e-11  41%  105 aa  RL21_BLOPB RecName: Full=50S ribosomal protein L21;
    1::96      1e-11  39%   98 aa  RL21_AQUAE RecName: Full=50S ribosomal protein L21;
    1::103     2e-11  32%  106 aa  RL21_THEAB RecName: Full=50S ribosomal protein L21;
    1::103     2e-11  39%  130 aa  RL21_METEP RecName: Full=50S ribosomal protein L21;
    1::103     2e-11  39%  130 aa  RL21_METC4 RecName: Full=50S ribosomal protein L21;
  100::201     2e-11  48%  220 aa  RK21_ARATH RecName: Full=50S ribosomal protein L21,
    1::99      4e-11  47%  102 aa  RL21_EHRRG RecName: Full=50S ribosomal protein L21;
    4::101     4e-11  46%  106 aa  RL21_CHLAB RecName: Full=50S ribosomal protein L21;
    1::103     4e-11  33%  103 aa  RL21_ACTP7 RecName: Full=50S ribosomal protein L21;
    4::101     5e-11  46%  106 aa  RL21_CHLFF RecName: Full=50S ribosomal protein L21;
    1::103     7e-11  45%  103 aa  RL21_WOLSU RecName: Full=50S ribosomal protein L21;
    1::102     7e-11  35%  105 aa  RL21_TREPS RecName: Full=50S ribosomal protein L21;
    1::102     7e-11  35%  105 aa  RL21_TREPA RecName: Full=50S ribosomal protein L21;
    1::100     7e-11  45%  101 aa  RL21_SULNB RecName: Full=50S ribosomal protein L21;
    1::101     7e-11  36%  103 aa  RL21_MARAV RecName: Full=50S ribosomal protein L21;
    1::102     9e-11  39%  102 aa  RL21_SULDN RecName: Full=50S ribosomal protein L21;
    1::51      9e-11  49%  187 aa  RL21_BDEBA RecName: Full=50S ribosomal protein L21;
    1::98      9e-11  42%  103 aa  RL21_BAUCH RecName: Full=50S ribosomal protein L21;
    1::105     9e-11  36%  105 aa  RL21_BACFR RecName: Full=50S ribosomal protein L21;
    1::105     9e-11  36%  105 aa  RL21_BACFN RecName: Full=50S ribosomal protein L21;
    1::62      1e-10  42%  164 aa  RL21_OLICO RecName: Full=50S ribosomal protein L21;
    4::102     1e-10  32%  103 aa  RL21_NOCFA RecName: Full=50S ribosomal protein L21;
    4::102     1e-10  32%  103 aa  RL21_MYCPA RecName: Full=50S ribosomal protein L21;
    1::94      1e-10  47%  100 aa  RL21_MYCGE RecName: Full=50S ribosomal protein L21;
    4::102     1e-10  32%  103 aa  RL21_MYCA1 RecName: Full=50S ribosomal protein L21;
    1::102     1e-10  41%  102 aa  RL21_CYTH3 RecName: Full=50S ribosomal protein L21;
    1::103     1e-10  45%  103 aa  RL21_CLOB8 RecName: Full=50S ribosomal protein L21;
    1::69      1e-10  47%  103 aa  RL21_CHLAD RecName: Full=50S ribosomal protein L21;
    1::101     2e-10  32%  104 aa  RL21_RHOBA RecName: Full=50S ribosomal protein L21;
    1::103     2e-10  44%  103 aa  RL21_PSEU2 RecName: Full=50S ribosomal protein L21;
    1::103     2e-10  44%  103 aa  RL21_PSE14 RecName: Full=50S ribosomal protein L21;
   21::122     2e-10  30%  129 aa  RL21_PROMM RecName: Full=50S ribosomal protein L21;
    4::102     2e-10  33%  103 aa  RL21_MYCS2 RecName: Full=50S ribosomal protein L21;
    1::103     2e-10  33%  103 aa  RL21_HAEIG RecName: Full=50S ribosomal protein L21;
    1::103     2e-10  33%  103 aa  RL21_HAEIE RecName: Full=50S ribosomal protein L21;
    1::103     2e-10  33%  103 aa  RL21_HAEI8 RecName: Full=50S ribosomal protein L21;
    1::99      2e-10  43%  102 aa  RL21_EHRRW RecName: Full=50S ribosomal protein L21;
    1::66      2e-10  45%  124 aa  RL21_XANP2 RecName: Full=50S ribosomal protein L21;
    1::95      2e-10  47%   96 aa  RL21_SULSY RecName: Full=50S ribosomal protein L21;
    4::102     2e-10  30%  103 aa  RL21_RHOE4 RecName: Full=50S ribosomal protein L21;
   17::118     2e-10  36%  146 aa  RL21_PROM9 RecName: Full=50S ribosomal protein L21;
   25::126     2e-10  30%  133 aa  RL21_PROM3 RecName: Full=50S ribosomal protein L21;
    1::100     2e-10  32%  102 aa  RL21_MYXXD RecName: Full=50S ribosomal protein L21;
    4::102     2e-10  31%  103 aa  RL21_MYCTU RecName: Full=50S ribosomal protein L21;
    4::102     2e-10  31%  103 aa  RL21_MYCBO RecName: Full=50S ribosomal protein L21;
    1::99      2e-10  33%  100 aa  RL21_CORK4 RecName: Full=50S ribosomal protein L21;
    1::98      2e-10  38%  106 aa  RL21_COPPD RecName: Full=50S ribosomal protein L21;
    1::103     3e-10  44%  103 aa  RL21_PSESM RecName: Full=50S ribosomal protein L21;
    1::100     3e-10  30%  101 aa  RL21_CORGL RecName: Full=50S ribosomal protein L21;
    1::100     3e-10  30%  101 aa  RL21_CORGB RecName: Full=50S ribosomal protein L21;
    1::105     3e-10  36%  105 aa  RL21_BACTN RecName: Full=50S ribosomal protein L21;
    4::107     3e-10  32%  114 aa  RK21_STAPU RecName: Full=50S ribosomal protein L21, chloroplastic;
    3::102     3e-10  44%  104 aa  RK21_PORPU RecName: Full=50S ribosomal protein L21, chloroplastic;
   17::117     4e-10  37%  146 aa  RL21_PROM0 RecName: Full=50S ribosomal protein L21;
    1::97      4e-10  39%   97 aa  RL21_PERMH RecName: Full=50S ribosomal protein L21;
    1::101     4e-10  31%  102 aa  RL21_NOCSJ RecName: Full=50S ribosomal protein L21;
    1::103     4e-10  42%  104 aa  RL21_GLUDA RecName: Full=50S ribosomal protein L21;
    1::99      4e-10  42%  102 aa  RL21_EHRCR RecName: Full=50S ribosomal protein L21;
    3::69      4e-10  44%  123 aa  RL21_CYAP8 RecName: Full=50S ribosomal protein L21;
    1::98      4e-10  33%  108 aa  RL21_ACIC5 RecName: Full=50S ribosomal protein L21;
    3::103     5e-10  33%  135 aa  RL21_SYNJA RecName: Full=50S ribosomal protein L21;
    4::102     5e-10  31%  103 aa  RL21_MYCLE RecName: Full=50S ribosomal protein L21;
    4::102     5e-10  31%  103 aa  RL21_MYCLB RecName: Full=50S ribosomal protein L21;
    1::103     5e-10  32%  103 aa  RL21_HAEIN RecName: Full=50S ribosomal protein L21;
    1::63      6e-10  45%  103 aa  RL21_NAUPA RecName: Full=50S ribosomal protein L21;
    1::103     6e-10  39%  127 aa  RL21_BLOFL RecName: Full=50S ribosomal protein L21;
  123::224     6e-10  47%  256 aa  RK21_SPIOL RecName: Full=50S ribosomal protein L21,
   30::129     8e-10  31%  137 aa  RL21_SYNPX RecName: Full=50S ribosomal protein L21;
    1::69      8e-10  40%  104 aa  RL21_METRJ RecName: Full=50S ribosomal protein L21;
    1::62      8e-10  40%  129 aa  RL21_BRAJA RecName: Full=50S ribosomal protein L21;
    1::101     8e-10  40%  103 aa  RL21_BORBZ RecName: Full=50S ribosomal protein L21;
    1::101     8e-10  40%  103 aa  RL21_BORBU RecName: Full=50S ribosomal protein L21;
    3::102     1e-09  39%  111 aa  RL21_THEEB RecName: Full=50S ribosomal protein L21;
    3::103     1e-09  34%  124 aa  RL21_SYNY3 RecName: Full=50S ribosomal protein L21;
    4::102     1e-09  31%  103 aa  RL21_MYCUA RecName: Full=50S ribosomal protein L21;
    4::102     1e-09  31%  103 aa  RL21_MYCMM RecName: Full=50S ribosomal protein L21;
    1::101     1e-09  39%  103 aa  RL21_BORGA RecName: Full=50S ribosomal protein L21;
    1::94      1e-09  35%  163 aa  RL21_BARQU RecName: Full=50S ribosomal protein L21;
    1::103     1e-09  31%  103 aa  RL21_PASMU RecName: Full=50S ribosomal protein L21;
    4::102     1e-09  31%  103 aa  RL21_MYCSS RecName: Full=50S ribosomal protein L21;
    4::102     1e-09  31%  103 aa  RL21_MYCSK RecName: Full=50S ribosomal protein L21;
    4::102     1e-09  31%  103 aa  RL21_MYCSJ RecName: Full=50S ribosomal protein L21;
    4::102     2e-09  30%  103 aa  RL21_RHOSR RecName: Full=50S ribosomal protein L21;
    1::102     2e-09  37%  132 aa  RL21_RHOPB RecName: Full=50S ribosomal protein L21;
    4::102     2e-09  30%  103 aa  RL21_RHOOB RecName: Full=50S ribosomal protein L21;
    1::94      2e-09  37%   99 aa  RL21_MYCMO RecName: Full=50S ribosomal protein L21;
    1::104     2e-09  38%  105 aa  RL21_METNO RecName: Full=50S ribosomal protein L21;
    3::69      2e-09  42%  104 aa  RL21_PSEE4 RecName: Full=50S ribosomal protein L21;
    1::41      2e-09  54%  140 aa  RL21_PARDP RecName: Full=50S ribosomal protein L21;
    1::100     2e-09  29%  101 aa  RL21_COREF RecName: Full=50S ribosomal protein L21;
    2::102     2e-09  28%  102 aa  RL21_CLAMS RecName: Full=50S ribosomal protein L21;
    2::102     2e-09  28%  102 aa  RL21_CLAM3 RecName: Full=50S ribosomal protein L21;
    1::99      2e-09  33%  131 aa  RL21_ACIBL RecName: Full=50S ribosomal protein L21;
   14::114     3e-09  28%  121 aa  RL21_SYNSC RecName: Full=50S ribosomal protein L21;
    1::62      3e-09  42%  128 aa  RL21_RHOP2 RecName: Full=50S ribosomal protein L21;
    1::105     3e-09  32%  105 aa  RL21_PORGI RecName: Full=50S ribosomal protein L21;
    1::105     3e-09  32%  105 aa  RL21_PORG3 RecName: Full=50S ribosomal protein L21;
    4::102     3e-09  29%  103 aa  RL21_MYCA9 RecName: Full=50S ribosomal protein L21;
    1::104     3e-09  38%  105 aa  RL21_METS4 RecName: Full=50S ribosomal protein L21;
    1::99      3e-09  33%  100 aa  RL21_CORU7 RecName: Full=50S ribosomal protein L21;
    1::63      3e-09  40%  103 aa  RL21_CHLSY RecName: Full=50S ribosomal protein L21;
    1::63      3e-09  40%  103 aa  RL21_CHLAA RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  41%  102 aa  RL21_CAMJR RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  41%  102 aa  RL21_CAMJJ RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  41%  102 aa  RL21_CAMJE RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  41%  102 aa  RL21_CAMJD RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  41%  102 aa  RL21_CAMJ8 RecName: Full=50S ribosomal protein L21;
    1::102     3e-09  43%  102 aa  RL21_CAMHC RecName: Full=50S ribosomal protein L21;
    3::104     3e-09  42%  104 aa  RK21_PORYE RecName: Full=50S ribosomal protein L21, chloroplastic;
    3::69      4e-09  41%  104 aa  RL21_PSEPK RecName: Full=50S ribosomal protein L21;
    3::69      4e-09  41%  104 aa  RL21_PSEPG RecName: Full=50S ribosomal protein L21;
    3::69      4e-09  41%  104 aa  RL21_PSEP1 RecName: Full=50S ribosomal protein L21;
    1::67      4e-09  37%  146 aa  RL21_NITWN RecName: Full=50S ribosomal protein L21;
    2::101     4e-09  30%  102 aa  RL21_LEIXX RecName: Full=50S ribosomal protein L21;
    1::100     4e-09  30%  101 aa  RL21_CORDI RecName: Full=50S ribosomal protein L21;
    4::102     4e-09  43%  107 aa  RL21_CHLMU RecName: Full=50S ribosomal protein L21;
    3::102     4e-09  37%  104 aa  RK21_GUITH RecName: Full=50S ribosomal protein L21, chloroplastic;
    4::102     4e-09  31%  104 aa  RK21_CYAPA RecName: Full=50S ribosomal protein L21, cyanelle;
    6::101     4e-09  29%  107 aa  RK21_CYAME RecName: Full=50S ribosomal protein L21, chloroplastic;
    3::69      5e-09  41%  104 aa  RL21_PSEPW RecName: Full=50S ribosomal protein L21;
    1::102     5e-09  37%  128 aa  RL21_NITHX RecName: Full=50S ribosomal protein L21;
    1::47      5e-09  49%  104 aa  RL21_GLUOX RecName: Full=50S ribosomal protein L21;
    1::101     5e-09  38%  103 aa  RL21_BORAP RecName: Full=50S ribosomal protein L21;
    1::62      7e-09  39%  128 aa  RL21_RHOPS RecName: Full=50S ribosomal protein L21;
    1::39      9e-09  59%  205 aa  RL21_HYPNA RecName: Full=50S ribosomal protein L21;
    1::99      9e-09  31%  100 aa  RL21_CORJK RecName: Full=50S ribosomal protein L21;
    3::102     9e-09  32%  105 aa  RK21_ODOSI RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::68      1e-08  39%  220 aa  RL21_MESSB RecName: Full=50S ribosomal protein L21;
    1::105     1e-08  33%  105 aa  RL21_BACV8 RecName: Full=50S ribosomal protein L21;
   18::118     1e-08  28%  125 aa  RL21_SYNS9 RecName: Full=50S ribosomal protein L21;
    1::66      1e-08  40%   98 aa  RL21_NOVAD RecName: Full=50S ribosomal protein L21;
    1::103     1e-08  44%  103 aa  RL21_CLOAB RecName: Full=50S ribosomal protein L21;
    4::102     1e-08  43%  107 aa  RL21_CHLTR RecName: Full=50S ribosomal protein L21;
    4::102     1e-08  43%  107 aa  RL21_CHLTB RecName: Full=50S ribosomal protein L21;
    4::102     1e-08  43%  107 aa  RL21_CHLTA RecName: Full=50S ribosomal protein L21;
    4::102     1e-08  43%  107 aa  RL21_CHLT2 RecName: Full=50S ribosomal protein L21;
   62::128     2e-08  35%  172 aa  RM21_DICDI RecName: Full=Probable 39S ribosomal protein L21,
   17::117     3e-08  29%  124 aa  RL21_SYNPW RecName: Full=50S ribosomal protein L21;
    1::68      3e-08  36%  103 aa  RL21_PARL1 RecName: Full=50S ribosomal protein L21;
    1::101     3e-08  44%  103 aa  RL21_BUCCC RecName: Full=50S ribosomal protein L21;
    2::101     3e-08  28%  102 aa  RL21_ARTS2 RecName: Full=50S ribosomal protein L21;
    1::101     3e-08  30%  107 aa  RL21_THERP RecName: Full=50S ribosomal protein L21;
    1::62      3e-08  39%  124 aa  RL21_RHOP5 RecName: Full=50S ribosomal protein L21;
    1::100     3e-08  26%  102 aa  RL21_PROAC RecName: Full=50S ribosomal protein L21;
    2::101     3e-08  28%  102 aa  RL21_ARTCA RecName: Full=50S ribosomal protein L21;
    1::64      4e-08  42%  164 aa  RL21_SPHAL RecName: Full=50S ribosomal protein L21;
    1::98      6e-08  27%  103 aa  RL21_WIGBR RecName: Full=50S ribosomal protein L21;
   29::128     6e-08  38%  136 aa  RL21_SYNR3 RecName: Full=50S ribosomal protein L21;
    1::102     6e-08  29%  104 aa  RL21_SALTO RecName: Full=50S ribosomal protein L21;
    1::102     6e-08  29%  104 aa  RL21_SALAI RecName: Full=50S ribosomal protein L21;
    3::104     6e-08  38%  104 aa  RL21_HELPG RecName: Full=50S ribosomal protein L21;
  140::205     7e-08  41%  270 aa  RM21_ARATH RecName: Full=50S ribosomal protein L21,
    3::104     7e-08  38%  104 aa  RL21_HELPH RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATW RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATT RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATO RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATN RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATM RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATH RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRATF RecName: Full=50S ribosomal protein L21;
    1::103     7e-08  32%  104 aa  RL21_FRAT1 RecName: Full=50S ribosomal protein L21;
    1::63      7e-08  41%  102 aa  RL21_EHRCJ RecName: Full=50S ribosomal protein L21;
    1::101     7e-08  38%  105 aa  RL21_DICT6 RecName: Full=50S ribosomal protein L21;
    4::65      7e-08  41%  108 aa  RK21_CYACA RecName: Full=50S ribosomal protein L21,
    3::104     1e-07  38%  104 aa  RL21_HELPY RecName: Full=50S ribosomal protein L21;
    3::104     1e-07  38%  104 aa  RL21_HELPS RecName: Full=50S ribosomal protein L21;
    1::100     1e-07  26%  105 aa  RL21_FRASN RecName: Full=50S ribosomal protein L21;
    1::65      1e-07  40%  102 aa  RL21_ZYMMO RecName: Full=50S ribosomal protein L21;
    4::109     1e-07  28%  116 aa  RK21_MARPO RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::102     2e-07  39%  102 aa  RL21_CAMFF RecName: Full=50S ribosomal protein L21;
    3::102     2e-07  29%  105 aa  RK21_PHATR RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::64      2e-07  41%  120 aa  RL21_SPHWW RecName: Full=50S ribosomal protein L21;
    1::103     2e-07  29%  106 aa  RL21_FERNB RecName: Full=50S ribosomal protein L21;
    3::104     3e-07  37%  104 aa  RL21_HELPJ RecName: Full=50S ribosomal protein L21;
    3::104     3e-07  37%  104 aa  RL21_HELP2 RecName: Full=50S ribosomal protein L21;
    6::106     3e-07  31%  113 aa  RK21_CHAVU RecName: Full=50S ribosomal protein L21, chloroplastic;
    3::103     4e-07  35%  141 aa  RL21_SYNJB RecName: Full=50S ribosomal protein L21;
    4::27      4e-07  83%   31 aa  RL21_STRTR RecName: Full=50S ribosomal protein L21;Flags:
    3::104     4e-07  37%  104 aa  RL21_HELAH RecName: Full=50S ribosomal protein L21;
    4::64      5e-07  46%  106 aa  RL21_CHLPN RecName: Full=50S ribosomal protein L21;
    2::100     5e-07  38%  106 aa  RK21_GRATL RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::94      6e-07  35%   96 aa  RL21_HYDS0 RecName: Full=50S ribosomal protein L21;
    2::103     1e-06  25%  103 aa  RL21_KOCRD RecName: Full=50S ribosomal protein L21;
    1::101     1e-06  45%  104 aa  RL21_ELUMP RecName: Full=50S ribosomal protein L21;
    1::44      1e-06  43%  127 aa  RL21_BRASB RecName: Full=50S ribosomal protein L21;
    3::102     1e-06  29%  105 aa  RK21_THAPS RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::97      1e-06  43%  100 aa  RL21_WOLTR RecName: Full=50S ribosomal protein L21;
    1::102     1e-06  25%  103 aa  RL21_THEFY RecName: Full=50S ribosomal protein L21;
    1::63      1e-06  37%  106 aa  RL21_STRGR RecName: Full=50S ribosomal protein L21;
    1::63      1e-06  37%  106 aa  RL21_STRGG RecName: Full=50S ribosomal protein L21;
    1::45      1e-06  42%  100 aa  RL21_ANAMM RecName: Full=50S ribosomal protein L21;
    4::109     1e-06  28%  121 aa  RK21_HUPLU RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::91      2e-06  43%   96 aa  RL21_SOLUE RecName: Full=50S ribosomal protein L21;
    1::100     2e-06  24%  105 aa  RL21_FRASC RecName: Full=50S ribosomal protein L21;
    1::103     2e-06  30%  104 aa  RL21_FRAP2 RecName: Full=50S ribosomal protein L21;
    1::107     2e-06  28%  114 aa  RK21_PHYPA RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::63      3e-06  37%  106 aa  RL21_STRAW RecName: Full=50S ribosomal protein L21;
    1::101     3e-06  34%  102 aa  RL21_LEPBP RecName: Full=50S ribosomal protein L21;
    1::101     3e-06  34%  102 aa  RL21_LEPBA RecName: Full=50S ribosomal protein L21;
    3::98      3e-06  26%  110 aa  RK21_GALSU RecName: Full=50S ribosomal protein L21,
    1::63      4e-06  35%  106 aa  RL21_STRCO RecName: Full=50S ribosomal protein L21;
    1::102     5e-06  42%  103 aa  RL21_PSYWF RecName: Full=50S ribosomal protein L21;
    1::48      9e-06  38%  126 aa  RL21_RHOPT RecName: Full=50S ribosomal protein L21;
    1::48      9e-06  38%  126 aa  RL21_RHOPA RecName: Full=50S ribosomal protein L21;AltName:
    2::101     9e-06  22%  103 aa  RL21_KINRD RecName: Full=50S ribosomal protein L21;
   99::164     1e-05  40%  209 aa  RM21_MOUSE RecName: Full=39S ribosomal protein L21, mitochondrial; 
    4::109     1e-05  35%  118 aa  RK21_ZYGCR RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::90      2e-05  28%  104 aa  RL21_TROWT RecName: Full=50S ribosomal protein L21;
    1::33      2e-05  48%   95 aa  RL21_RUBXD RecName: Full=50S ribosomal protein L21;
   18::118     3e-05  25%  139 aa  RL21_PROMT RecName: Full=50S ribosomal protein L21;
   17::117     3e-05  31%  147 aa  RL21_PROM2 RecName: Full=50S ribosomal protein L21;
   18::118     3e-05  25%  139 aa  RL21_PROM1 RecName: Full=50S ribosomal protein L21;
    1::102     3e-05  38%  102 aa  RL21_CAMLR RecName: Full=50S ribosomal protein L21;
    1::90      8e-05  27%  104 aa  RL21_TROW8 RecName: Full=50S ribosomal protein L21;
    1::90      8e-05  39%   99 aa  RL21_NEOSM RecName: Full=50S ribosomal protein L21;
    4::105     8e-05  26%  116 aa  RK21_EMIHU RecName: Full=50S ribosomal protein L21, chloroplastic;
    1::105     1e-04  36%  105 aa  RL21_PARD8 RecName: Full=50S ribosomal protein L21;
   99::164     1e-04  37%  209 aa  RM21_BOVIN RecName: Full=39S ribosomal protein L21, mitochondrial; 
    1::44      1e-04  41%   99 aa  RL21_ANAPZ RecName: Full=50S ribosomal protein L21;
    4::111     1e-04  28%  118 aa  RK21_PSINU RecName: Full=50S ribosomal protein L21, chloroplastic;
   13::79      1e-04  38%  127 aa  RK21_ADICA RecName: Full=50S ribosomal protein L21,
   95::160     5e-04  34%  205 aa  RM21_HUMAN RecName: Full=39S ribosomal protein L21, mitochondrial; 
    1::97      5e-04  42%  100 aa  RL21_WOLPP RecName: Full=50S ribosomal protein L21;
    1::69      5e-04  34%  104 aa  RL21_OPITP RecName: Full=50S ribosomal protein L21;
   17::118     6e-04  29%  146 aa  RL21_PROMP RecName: Full=50S ribosomal protein L21;
    1::93      6e-04  37%   96 aa  RL21_PELLD RecName: Full=50S ribosomal protein L21;
    1::102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
RL21_LACS1      MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
RL21_LACF3      MYAIIVTGGKQYKVEAGQAIYVEKLDAQAGDKVTFDKVVFVGGDDTKIGTPFVDGASVEGTVDKQGXXXX
RL21_LACPL      MYAIIVTGGKQYKVEAGQAIYVEKLDAAAGDKVTFDQVVFVGGDTTKVGTPTVDGATVEGTVEKQGRDRK
RL21_LACRJ      MYAIIVTGGKQYKVEEGASIYVEKLDAKEGDKVTFDQVIFVGGDDTKIGTPVVDGASVEGTVDKQGXXXX
RL21_LACRD      MYAIIVTGGKQYKVEEGASIYVEKLDAKEGDKVTFDQVIFVGGDDTKIGTPVVDGASVEGTVDKQGXXXX
RL21_STRU0      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKTVVGTPIVEGATVVGTVEKQGXXXX
RL21_PEDPA      MYAIIKTGGKQLKVEEGQSVFVEKLNVAEGEKVTFDQVLFVGGESTKVGSPVVEGASVAGTVEKQGXXXX
RL21_STRTD      -YAIIKTGGKQVKVEVGQAIYVEKINAEAGSEVTFNEVVLVGGDKTVVGTPVVEGATVVGTIEKQGXXXX
RL21_STRT2      -YAIIKTGGKQVKVEVGQAIYVEKINAEAGSEVTFNEVVLVGGDKTVVGTPVVEGATVVGTIEKQGXXXX
RL21_STRT1      -YAIIKTGGKQVKVEVGQAIYVEKINAEAGSEVTFNEVVLVGGDKTVVGTPVVEGATVVGTIEKQGXXXX
RL21_ENTFA      MYAIIKTGGKQVKVEVGQAIYVEKLNVEAGEKVVFDEVILVGGESTKVGAPTVAGATVEGTVEKHGKQKK
RL21_LISMO      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVVTFDKVLFVGGDSAKVGVPFVEGATVTAKVEKQGRAXX
RL21_LISMH      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVVTFDKVLFVGGDSAKVGVPFVEGATVTAKVEKQGRAXX
RL21_LISMF      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVVTFDKVLFVGGDSAKVGVPFVEGATVTAKVEKQGRAXX
RL21_STRGC      -YAIIKTGGKQVKVEVGQAIYVEKLNVEAGQDVTFDEVVLVGGEKTVVGTPLVAGATVVGTVEKQGXXXX
RL21_LISMC      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVITFDKVLFVGGDSAKVGVPFVEGATVTAKVEKQGRAXX
RL21_LISW6      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVVTFDKVLFVGGDSAKVGVPFVDGATVTAKVEKQGRAXX
RL21_LISIN      MYAIIETGGKQIKVEAGQEIYVEKLAGEVGDVVTFDKVLFVGGDSAKVGVPFVDGATVTAKVEKQGRAXX
RL21_GEOKA      MYAIIETGGKQLKVEEGQEIYIEKLDANEGDTVTFDKVLFVGGETVKIGNPTVEGATVTARVQKHGRQXX
RL21_BACSU      MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGNPTVEGATVTAKVEKQGRAKK
RL21_GEOTN      MYAIIETGGKQLKVQEGQEIYIEKLDANEGDTVTFDKVLFVGGETVKIGNPTVEGATVTAKVQKHGRQXX
RL21_GEOSW      MYAIIETGGKQIKVEEGQEIYIEKIDAQEGETVTFDKVLFVGGETVKIGNPTVEGATVTAKVQKHGRQXX
RL21_BACWK      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACHK      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACCZ      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACCR      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACC4      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACC3      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACC2      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACC0      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACAN      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACAH      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACAC      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_BACAA      MYAIIETGGKQIKVEAGQAIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKQGRXXX
RL21_STACT      MFAIIETGGKQIKVEEGQEIYVEKLDVNEGDAFTFDKVLFVGGDAVKVGAPTVEGATVSATVNKQGRGKK
RL21_BACA2      MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDSVKVGNPTVAGATVTAKVEKQGRAKK
RL21_STAAW      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAU      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAT      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAS      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAR      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAN      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAM      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAE      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAC      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAAB      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAA9      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAA8      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAA3      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAA2      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_STAA1      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_LACLA      -YAIIKTGGKQLKVEEGSVIYVEKLNVEAGQTVTFDEVIFVGGETTKVGAPLVEGATVVGEVEKHGKQKK
RL21_BACSK      MYAIIETGGKQIKVEEGQEIYVEKLDAEAGEEVSFDKVLFVGGESAKVGAPFVEGASVTGTVEKHGRNXX
RL21_STRMU      -YAIIKTGGKQVKVEVDQAIYVEKLDVEAGAEVTFDQVVLVGGDKTVVGTPIVQGATVVGTVEXXXXXXX
RL21_STAES      MFAIIETGGKQIKVEEGQEIYVEKLNANEGDSFTFDKVLFVGGDSVKVGAPTVEGASVTATVNKQGRGKK
RL21_STAEQ      MFAIIETGGKQIKVEEGQEIYVEKLNANEGDSFTFDKVLFVGGDSVKVGAPTVEGASVTATVNKQGRGKK
RL21_BACCQ      MYAIIETGGKQIKVEAGQEIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKHGRXXX
RL21_BACCN      MYAIIETGGKQIKVEAGQEIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKHGRXXX
RL21_BACC7      MYAIIETGGKQIKVEAGQEIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKHGRXXX
RL21_BACC1      MYAIIETGGKQIKVEAGQEIYIEKLDVEAGETVTFDKVLFVGGENVKVGSPVVEGATVTAKVEKHGRXXX
RL21_LACLS      -YAIIKTGGKQVKVEEGSVIYVEKLNVEAGQTVTFDEVIFVGGETTKVGAPLVEGATVVGEVEKHGKQKK
RL21_LACLM      -YAIIKTGGKQVKVEEGSVIYVEKLNVEAGQTVTFDEVIFVGGETTKVGAPLVEGATVVGEVEKHGKQKK
RL21_STAS1      MFAIIETGGKQVKVEEGQEIFVEKLDVNEGDSFTFDKVLFVGGDAVKVGAPTVEGASVTATVQKQGRGKK
RL21_BACLD      MYAIIQTGGKQIKVEEGQTVYVEKLAAEAGETVTFDNVLFVGGENVKVGSPTVEGATVTGKVEKQGRAKK
RL21_STAHJ      MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDSFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKK
RL21_LYSSC      MYAIIETGGKQIKVEAGQEIYVEKLGVEADEVVTFDKVLFVGGENVKVGAPFVDGATVTAKVVKEGRXXX
RL21_STRSV      -YAIIKTGGKQVKVEVGQAIYVEKLNAEAGQDVTFDEVVLVGGENTVVGTPLVAGASVVGTVEXXXXXXX
RL21_OCEIH      MYAIIETGGKQIKVVEGQEIYVEKVTADVNESVTFDKVLFIGGDDVKVGAPLIDGATVTAKVEKHGRQKK
RL21_LACSS      MYAIIKTGGKQYKVEAGQAIYVEKLTAEAGEKVTFDQVILVGGETTKVGTPNIDGVTVDGTVEKQGREXX
RL21_STRZT      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRZJ      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRR6      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRPN      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRPJ      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRPI      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRP7      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRP2      -YAIIKTGGKQVKVEVGQAVYVEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_STRZP      -YAIIKTGGKQVKVEVGQAVYIEKLNVEAGQEVTFNEVVLVGGENTVVGTPLVAGATVVGTVEXXXXXXX
RL21_BACP2      MYAIIETGGKQVKVEEGQTVYIEKLAAEAGETVTFENVLFVGGDTVKVGNPSVAGATVTAKVEKQGRGKK
RL21_MACCJ      MFAIIETGGKQLKVEQGQEIWVEKLNAEEGSTFTFDQVLMVGGETVKVGSPVVEGATVTAKVEKHGRGKK
RL21_EXISA      MYAIIKTGGKQIKVEAGQEIYIEKLDADVEGTVEFGEVLFVGGDDVKVGAPLVEGAKVVGTVVKHGRAKK
RL21_LACBA      MYAIIVTGGKQYKVEAGQAVYVEKLNVEAGEKVTFDQVVFVGGDTPKIXXXXXXXXXXXXXXEKQGLEXX
RL21_EXIS2      MYAIIKTGGKQVKVEAGQEIYVEKLNADVDSTVEFGEVLILGGDDVKVGAPLVEGAKVVATVIKHARAKK
RL21_STRPZ      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPM      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPG      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPF      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPD      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPC      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRPB      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRP8      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRP6      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRP3      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRP1      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEVTFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_BACHD      MYAIIETGGKQVKVEEGQEIYIEKLDAEAGESVNFXXXXXXXXXXXXXXSPYVEGASVTAKVEKHGRGXX
RL21_STRS7      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEITFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STREM      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEITFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_STRE4      -YAIIKTGGKQVKVEVGQAIYVEKIDAEAGAEITFNEVVLVGGDKXXXXXXXXXXXXXXXXXEKQGXXXX
RL21_LACDB      MYAVIKTGGKQYKVAEGESIFVEKLDVQAGEEVVFDQVILVNGDDVKVGTPLVEGAKVVASVDKQGXXXX
RL21_LACDA      MYAVIKTGGKQYKVAEGESIFVEKLDVQAGEEVVFDQVILVNGDDVKVGTPLVEGAKVVASVDKQGXXXX
RL21_ALKOO      MYAIIETGGKQYRVQEGDTLFVEKLDANQGDIVTIDSVLAVSKDNLTVGAPMVAGAKVEAKVLEQGXXXX
RL21_DESHY      MYAVIETGGKQFRVEEGKVLFVEKLDANVGDTVTIDKVLLVEKDGAVVGTPVVDGAKALLKVVEHGKGEK
RL21_DESHD      MYAVIETGGKQFRVEEGKVLFVEKLDANVGDTVTIDKVLLVEKDGAVVGTPVVDGAKALLKVVEHGKGEK
RL21_MYCA5      MFAIIETGGKQIIVKAGDTIFIEKIEGKEGDKVSFDKVLAI-NDK--IGTPYLENAAVLAAIEKQGKAKK
RL21_RALEJ      MYAVVKTGGKQYKVAAGEKLKVEQIPADIGAEITLDQVLAVGGDQIKFGTPLVSGASVKATVISQGRHDK
RL21_MYCCT      MFAIIKTGGKQVKVEPGQEIFIEKIKGEVNDKIAFDEILMIDGQ---IGTPTIEGAKVLGTIVKQGKAKK
RL21_UREPA      MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGS---VGTPFVKNAVVNATVXXXXXXXX
RL21_UREP2      MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGS---VGTPFVKNAVVNATVXXXXXXXX
RL21_DICNV      MFAVIETGGKQYKVKPGQRLRVESLAGEVGDKIAFDKVLLVAGEEVSVGAPYVAGGSVQATIANHGRHKK
RL21_UREU1      MFAIFQTGGKQYKVQQGEKIYVEKLDLEVGSKISFDQVIMVEGS---VGTPFVKNAVVNATVLXXXXXXX
RL21_MYCMS      MFAIIRTGGKQIKVEQGQEIFIEKIKGEVNDKIAFDEILMIDGK---IGTPTIKGAKVLGTIIKQGKAKK
RL21_STRA5      -YAIIKTGGKQVKVEVGQAIYVEKLDVEAGAEVTFNEVVLVGGETTKXXXXXXXXXXXXXXXEXXXXXXX
RL21_STRA3      -YAIIKTGGKQVKVEVGQAIYVEKLDVEAGAEVTFNEVVLVGGETTKXXXXXXXXXXXXXXXEXXXXXXX
RL21_STRA1      -YAIIKTGGKQVKVEVGQAIYVEKLDVEAGAEVTFNEVVLVGGETTKXXXXXXXXXXXXXXXEXXXXXXX
RL21_MYCHJ      MFAIIKTGGRQLKVEKDQTIFVEKIDKNEGETITFTDILFINGK---IGTPYVENASVTGIIEKQGKAKK
RL21_MYCH7      MFAIIKTGGRQLKVEKDQTIFVEKIDKNEGETITFTDILFINGK---IGTPYVENASVTGIIEKQGKAKK
RL21_DESAD      MYAIIETGGKQFRVEEGLELNVQKMDAEAGTKVDLDKILLIGGEDVKIGAPYVEGAKVSCTVVEHGXXXX
RL21_THICR      MYAVIKTGGKQYRVREGQILRVESLGANEGDKVEFDQVMMVGGADVKLGAPLVEGAKVAATVTANGRGKK
RL21_DESDG      MYAIIETGGKQFRVEEGCKIFVEKLAADAGSEIAIDKVLMLGGDKFAVGAPYVENAKVTAEVIEHGRGEK
RL21_LACH4      MYAIIKTGGKQYKVAEGDSVFVEKLDAEEGSSVTFDEVILVNGDDVKVGTPLVDGAKVTAXXXXXXXXXX
RL21_RALEH      MYAVVKTGGKQYKVAAGEKLKVEQIPADIGAEITLDQVLAVGGDQIKFGTPLVSGASVKATVISQGRHDK
RL21_LACJO      MYAVIKTGGKQYKVAKGDSVFVEKLEVKPGDEVTFDEVILVNGKSTKIGTPXXXXXXXXXXXXXXXXXXX
RL21_LACAC      MYAIIKTGGKQYKVAEGDSVFVEKLDAAEGSEVTFDEVILVNGDDVKVGTPLVDGAKVTAXXXXXXXXXX
RL21_CUPTR      MYAVVKTGGKQYKVAAGEKLKVEQIPADIGAEITLDQVLAVGGDQIKFGTPLVSGASVKATVISQGRHDK
RL21_CLOD6      MYAIVKTGGKQYKVSEGDVLFVEKLEANAGDVVTLNEVLACSKDELKLGSPVVEGASVQAKVVEQGXXXX
RL21_AZOSB      MYAVIKTGGKQYRVAAGEKIKVEQIPADVGSEITIDQVLMVGGESVKIGTPVVSGAAVKATVVSHGRHDK
RL21_RALME      MYAVVKTGGKQYKVAAGEKLKVEQIPADIGAEITLDQVLAVGGDQIKFGTPLVSGASVKATVIAQGRHDK
RL21_DESAP      MYAIIETGGKQLCVREGDTVRVEKLAVEDGAEVVFDRVLLVSTEEGLIGRPLVLGARVTGRVQKQGRARK
RL21_DECAR      MYAVIKTGGKQYRVSAGQKLKVEQIPADVGAEVTLDQILMVGGESVKIGAPFLAGATVKCTVVSHGRHDK
RL21_BORA1      MYAVVKTGGKQYRVAAGEKLKVEQIPADIGQEITLDQVLSVGGDQLKVGTPLVAGAVVKATVLAHGRHDK
RL21_MYCH2      MFAIIKTSGRQLKVEKDQTIFVEKIDKNEGETITFTDILFINGK---IGTPYVENASVTGIIEKQGKAKK
RL21_MOOTA      MYAIIMTGGKQYRVSEGDTLRVEKLPAEVGEKVVLDKVLAVGGADLKVGNPYVEGAKVTASVQAQDKAPK
RL21_DESVM      MYAIIETGGKQFRVEEGAKIFVEKLVAEAGSEIVIDKVLMLGGGAFSVGAPYVEGAKVTAEVVEHGRGEK
RL21_METFK      MYAVIKTGGKQYRVAAGDKLKVEKLAGEVGSEITLDKVLLVSGDNTTIGSPLVQGASVQAKVVAHGRGDK
RL21_MESFL      MFAIIKTGGKQIKVEAGMEIFIEKLEGELNTEVTFEEVLMVDGK---FGSPLVQGAKVTGTIVKQGKGKK
RL21_BORPD      MYAVVKTGGKQYRVAAGEKLKVEQIPADIGQEITLDQVLSVGGDQLKVGTPLVAGAVVKATVLAHGRHDK
RL21_FINM2      MFAIIKTGGKQYKVSEGDIIKVEKIEAEAGDKIEFDQVLMVAGDDVKVGSPVVEGAKVSAEVLDQXXXXX
RL21_RALPJ      MYAVVKTGGKQYKVAAGEKLKVEQIPADVGAEITLDQVLAVGGDQLKVGAPLVSGAAVKATVISHGRHDK
RL21_BORPE      MYAVIKTGGKQYRVATGEKLKVEQIPADIGQEITLDQVLSVGGDQLKVGTPLVSGAVVKATVLAHGRHDK
RL21_BORPA      MYAVIKTGGKQYRVATGEKLKVEQIPADIGQEITLDQVLSVGGDQLKVGTPLVSGAVVKATVLAHGRHDK
RL21_BORBR      MYAVIKTGGKQYRVATGEKLKVEQIPADIGQEITLDQVLSVGGDQLKVGTPLVSGAVVKATVLAHGRHDK
RL21_THIDA      MYAVIKTGGKQYRVSAGDKLKIEKLEAEVGSEITFDQVLMVGGADIKMGAPLLRGATVSATVLNQARGDK
RL21_SYMTH      -YAIVETGGKQYRVQEGDTLRVEKLTAGEGETVVFDKVLAISRDKVTVGTPYIEGAKVTAKVAAHGKGPK
RL21_THET8      MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELP-VLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKK
RL21_THET2      MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELP-VLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKK
RL21_LEPCP      MYAVIKTGGKQYKVAAGEKIKVEQIAAEVGQEIVIDQVLALGGADLKIGTPLVEGATVTATVLAQGRHDK
RL21_DESVV      MYAIIETGGKQFRVEEGSKIFVEKLASEAGSEIVIDKVLMLGGGDVKVGAPYVENAKVTAEVVEHGRGEK
RL21_DESVH      MYAIIETGGKQFRVEEGSKIFVEKLASEAGSEIVIDKVLMLGGGDVKVGAPYVENAKVTAEVVEHGRGEK
RL21_RUTMC      MYAVIKTGGQQFRVEQGTTLKIEKLEIESGKKVTFKEVLMVAGDNVRVGTPFVPKVTVEAKIISQGKEKK
RL21_RALSO      MYAVVKTGGKQYKVAAGEKLKVEQIPADVGAEITLDQVLAVGGDQLKVGAPLVSGAAVKATVISHGRHDK
RL21_NATTJ      MYAVIETGGKQYKVSEGDVLEIEKLSQETEEQVTFDKVLLVKDDENVVGTPVLEEAQVEGTVLEHGKGEK
RL21_MYCGA      MFAVIASGSKQYRVKLNDEIYVEKLNSQVGEKIVFDKVYFV---NNTFGKPFVKGASVTCEVLKQGRQKK
RL21_MYCAP      MIAIIETGGKQILVKEGETIFIEKIEGAEGSKVTFDKVLLLDNK---IGKPYVESAKVIGEIQKQGKAKK
RL21_SORC5      MYAVIKTGGKQYRVAEGQKLRVEKLVGNAGDKVTFSEVLLVGGDSPKIGKPLVSGASVAAEITGQDXXXX
RL21_MYCS5      MFAIIETGGKQILVKEGDSIYVEKLEGQEKSEVKFDKVLAV---NDVFGKPYVTGAVVHGTIEKQGKAKK
RL21_BURXL      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSQGRHAK
RL21_BURPP      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSQGRHAK
RL21_BURP8      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSQGRHKK
RL21_DIAST      MYAVIKTGGKQYRVAAGEKIKVEQIAAEVGQEIVIDQVLAVGGAELKVGTPLVSGATVKATVVAHGKHDK
RL21_ACISJ      MYAVIKTGGKQYRVAAGEKIKVEQIAAEVGQEIVIDQVLAVGGAELKVGTPLVSGATVKATVVAHGKHDK
RL21_VESOH      MYAVIKTGGQQFKVKQGTILKIEKLEIEPGKKVTFKEVLIVSGDDIQVGTPFVSKVTVEAKIISQGKGKK
RL21_SHEPA      MYAVFQSGGKQHRVEAGHTVRLEKLEVATGETIEFDQVLLVADGETVVGAPLVEGGKVVAEVISHGRADK
RL21_SHEHH      MYAVFQSGGKQHRVEAGHTVRLEKLEVATGETIEFDQVLLVADGETVVGAPLVEGGKVVAEVISHGRADK
RL21_MARMS      MFAVIKTGGKQYRVEEGQTLKVEKLAVEEGGAIQFDDVLLVNGDDVKVGAPVVEGAKVTAEVVAHGRGDK
RL21_HERAR      MYAVIKTGGKQYKVVAGEKFKVEQIPADIGSEITLDQVLALGAGETIFGAPLVEGATVLATVVSHGRHDK
RL21_POLSQ      MYAVIKTGGKQYKVAAGEKLKIEQIPAEIGSEITLDQVLAVGGASLKLGDPLVNGAAVMATVVSQGRHDK
RL21_LARHH      MYAVVKTGGKQYRVAVGEKLKVEQIPADIDSQIVLEEVLMVGGDEVKVGTPLVAGATVKATVVSHGRGEK
RL21_GEOSM      MYAVVKTGGKQYKVSEGDFLKVEKLEGAVGDTVEFSEILMVGGDKVVIGTPLVPSASVVGKIVEQGKDKK
RL21_CLOBM      MYAVVVTGGKQYKVAEGDVLFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CLOBL      MYAVVVTGGKQYKVAEGDVLFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CLOBK      MYAVVVTGGKQYKVAEGDVLFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CLOBJ      MYAVVVTGGKQYKVAEGDVLFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CLOB6      MYAVVVTGGKQYKVAEGDVLFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CHRVO      MYAVIKTGGKQYKVAIGEKLKVEQIPADVDSQIVLEEVLMIAGEQVVVGAPLVSGATVKATVVSHGRGEK
RL21_BURVG      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURTA      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURS3      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURPS      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURP6      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURP0      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURMS      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURMA      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURM9      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURM7      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIQFGTPLVSGASVKATVVSHGRHAK
RL21_BURM1      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURCM      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURCJ      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURCH      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURCC      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURCA      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_BURA4      MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGGESIKFGTPLVSGASVKATVVSHGRHAK
RL21_AZOVD      MYAVIVTGGKQYKVAEGEFLKIEKLEVGTGESVTFDRVLLVGGDDVKIGAPVVDGAKVTAEVVGQGRHDK
RL21_POLNS      MYAVIKTGGKQYKVAAGEKLKIEQIPAEIGSEITLDQVLAVGESASLLGDPLVNGAAVMATVVSQGRHDK
RL21_PHYAS      MFAIIRTGGKQLRVSEGQEIFVEKLPINPEQNYEFKEVLAVYGEKSILGQPYVEGAKVQAQVIKNDRAXX
RL21_CLOBH      MYAVVVTGGKQYKVAEGDILFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_CLOB1      MYAVVVTGGKQYKVAEGDILFVEKLTADVDSTVELDNVLLVGKDETVVGKPMVEGAKVTAKVLAQGXXXX
RL21_SHEPW      MYAVFQSGGKQHRVEAGHTVRLEKLEVATGETIEFDQVLLVADGETVVGAPLVEGGKVVAEVVSHGRAEK
RL21_POLNA      MYAVIKTGGKQYKVAAGEKIKVEQIAADVGQEIVIDQVLAVGGSSIKVGTPLVSGATVTVTVLSHGRHDK
RL21_ACHLI      MFAIIQTGGKQVKVTEGQEIYVEKLDVEAGDTFEFTEVL-ATSDK--IGHPYVEGAKVVAEVIKQGRQRK
RL21_POLSJ      MYAVIKTGGKQYKVAAGEKIKVEQIAADVGQEIVIDQVLAVGGSAIKVGTPLVSGATVTVTVLSHGRHDK
RL21_ONYPE      MFAIIKTGGKQFRVFEGQEIYVEKLNVEPETTYQFQEVLAVGGSNPVLGTPFVKDAKVTAQVIKHDRAXX
RL21_GEOBB      MYAVVKTGGKQYKVSEGDFLKVEKLEGAVGDTVEFSEILMVGGDKVVIGTPLVPSASVVGKIVEQGKDKK
RL21_CLOCE      MYAIIMTGGKQYKVQEGDVVFLEKLAAEEGSSVTFDKVLAVSKEGNLFGAPVLESASVSGKVLNHGKGEK
RL21_PSYIN      MYAVIQSGGKQHRVAVEQTLRLEKLDVEAGETIEFDKVLLVANAEDVVGIPYVEGSKVTAEVVAHGRGNK
RL21_CLOBB      MYAVLATGGKQYRVQEGDVIYVEKLDAEVDSTVELTEVLAVANDEGIVGAPVVEGAKVTAKVLAQGXXXX
RL21_VIBVY      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBVU      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBHB      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBHA      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBCM      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBCH      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VIBC3      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKVVAEVVQHGRGDK
RL21_VEREI      MYAVIKTGGKQYRVAAGENIKVEQIAADVGQEIVIDQVLAVGGAELKVGTPLVSGASVKATVVAHGKRDK
RL21_DESDA      MYAIIETGGKQYRVEEGSKIVVEKLAAQAGSEISLDKVLMVGGAECKVGAPYLAGAAVTAEVVDHGRGPK
RL21_DELAS      MYAVIKTGGKQYRVAAGEKIKVEQIAADVGQEVVIDQVLAVGGAEIKVGTPLVSGASVKATVVAHGKHDK
RL21_CLOTE      MYAVVVTGGKQYKVTEGDVLFVEKLDAEVDAAIELDNVLAISKDEFVVGKPVVEGAKVTAKVLKQGXXXX
RL21_AYWBP      MFAIIKTGGKQFRVSEGQEIYVEKLNVEPETTYQFQEVLAVGGSNPVLGVPFVKDAKVTAQVIKHDRAXX
RL21_VIBSL      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEEIAVGAPLVEGGKVTAEVVQHGRGDK
RL21_VIBPA      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVNGEDIKVGAPLVEGGKIVAEVVQHGRGDK
RL21_TERTT      MYAVIAAGGKQHRVEEGEVLRLEKIEVATGETVDFDQVLLVGGADVKIGTPVVEGAKVTAEVVSHGRADK
RL21_SACD2      MYAVFIAGGKQHRVEEGEVLRLEKIEVATGESVDFDQVLLVTGDDVKIGAPYVEGAKVTAEVVSHGRADK
RL21_PELCD      MYAVIKTGGKQYKVSEGDLVKIEKIEGAVGDTIELDEVLMVGGEEVKIGTPLLPGAKVTARIVQQGKDKK
RL21_ACIF5      MYAVIENGGKQYRVTVGDKLRLERMEMEPGAELALDRVLMVGGDDVQVGRPLVEGAAVKATVLSQGRAKK
RL21_ACIF2      MYAVIENGGKQYRVTVGDKLRLERMEMEPGAELALDRVLMVGGDDVQVGRPLVEGAAVKATVLSQGRAKK
RL21_THISH      MYAVIATGGKQYRVAQGDVLRVEKLDAEAGATVEFDNVLLVGGDDVKVGTPNVEGGKVTATVKAHGRGEK
RL21_SYNWW      MYAIIESGGKQYKVAEGSVIKVEKLDVAAGEKLTLDQVLFFGNGNVKIGNPLVAGVRVIAEVMEQGKHKK
RL21_RHOFD      MYAVIKTGGKQYRVAAGEKIKVEQIAADVGQEIVFNEVLAVGGAELKVGTPLVSGATVSVTVLAHGKHDK
RL21_CLONN      MYAVVQTGGKQYRVQEGDVLFVEKLNAEVDSNVELTEVLAVNKDKLVVGAPVVEGAKVVAKVLKQGXXXX
RL21_VARPS      MYAVIKTGGKQYRVASGEKIKVEQIAADVGQEIVIDQVLAVGGSEIKIGTPLVSGATVTVTVLSHGKHDK
RL21_PELPD      MYAVIKTGGKQYKVAEGEFLKVEKLVGEVGDSVEFGEVLMIGGEKIVVGAPHVAGATVTAKIAVQGKDKK
RL21_SHESH      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGDTVEFDQVLLVADGETVVGAPLVAGGKVVAEVVSHGRAEK
RL21_EUBR3      MYAIIATGGKQYKVSEGDIITIEKLGVEAGEKVTFXXXXXXXXXXXXXXXPTVAGATVEASVVKEGRAKK
RL21_CLOBA      MYAVLATGGKQYRVQEGDVIYVEKLDAEVDSTVELTEVLAVNGEGIKVGAPVVEGAKVTAKVLAQGXXXX
RL21_PSEA7      MYAVIVTGGKQHKVTEGEFLKVEKLDIATGEAIDFDRVLLVNGDDVKIGLPVVEGAKVTAEVVSHGRHDK
RL21_SILST      MFAVLKTGGKQYKVQAGDMLRVEKLAADAGETVQFNDVLMIGGDAPVVGAPFVSGAAVQAEVVEQIKGDK
RL21_PHYMT      MFAIIKNGSKQFRVFEGQEIFVEKISLMEKSNYEFKEILAIGGKNNILGQPFVSGAKVQAQIIKHGRAXX
RL21_IDILO      MYAVFQSGGKQHRVSEGQIVRLEKLEAATGDVVEFDQVLMVSGNDVNIGAPFVSGGKVKAEVIDHGRGDK
RL21_ALTMD      MYAVFQSGGKQHRVAEGQTVRLEKIEVAPGETVEFDKVLMVNGDDVKIGTPIVAGGKVTAEVVTHGRGDK
RL21_SILPO      MFAVLKTGGKQYKVQAGDVLRVEKLAADAGEKVQFNDVLMLGGDAPVVGAPLVDGAAVQAEVIDQIKGEK
RL21_PSEHT      MYAVFQSGGKQHRVTEGQTIRLEKLDVETGAAVEFDSVLLVAGEKIEIGVPFVNGGKITAEVVSHGRGEK
RL21_MYCPE      MFAIFEVGSKQYKVQKGDVIYVEKQDKKVGESISFDKVLMV---DATIGKPYIKNATVSCKVEXXXXXXX
RL21_GEOLS      MYAVIKTGGKQYKVAEGDFLKVEKLDNIVGDTIEFGEVLMIGGDAVKVGAPLVAGASVTAKVAVQGRDKK
RL21_ALHEH      MYAVIKTGGKQYKVSEGDVLRVEKLAGEAGASVEFDQVLMVGGDDVKVGAPTVEGGKVTAEVLGQGRARK
RL21_SHEWM      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETVEFDQVLLVADGETVVGAPLVEGGKVVAEVVSHGRDEK
RL21_SHELP      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETIEFDQVLLVADGETVVGAPLVEGGKVVAEVISHGRGEK
RL21_RHOSK      MFAVLKTGGKQYKVQAGDVLRVEKLACEAGDKIQFNDILMVGGDSVTVGAPFVAGAAVQAEVIAQIKGEK
RL21_RHOS4      MFAVLKTGGKQYKVQAGDVLRVEKLACEAGDKIQFNDILMVGGDSVTVGAPFVAGAAVQAEVIAQIKGEK
RL21_RHOS1      MFAVLKTGGKQYKVQAGDVLRVEKLACEAGDKIQFNDILMVGGDSVTVGAPFVAGAAVQAEVIAQIKGEK
RL21_PSEAE      MYAVIVTGGKQHKVTEGEFLKVEKLDVATGEAIDFDRVLLVNGEDVKIGLPVVEGAKVTAEVVSHGRHDK
RL21_PSEAB      MYAVIVTGGKQHKVTEGEFLKVEKLDVATGEAIDFDRVLLVNGEDVKIGLPVVEGAKVTAEVVSHGRHDK
RL21_PSEA8      MYAVIVTGGKQHKVTEGEFLKVEKLDVATGEAIDFDRVLLVNGEDVKIGLPVVEGAKVTAEVVSHGRHDK
RL21_NITMU      MYAVIKTGGKQYRVENGLKLKIEQVPVEIGSELLIDQVLMVAGDNISLGKPLVSGASVKATVLEQGRHDK
RL21_LAWIP      MYAIIEAGGKQFCVEEGSKIFVSKIDAEVGTEIFFDKIFMIGGSSPQIGTPYINNAKVIAKVLEHGRDKK
RL21_LAWIN      MYAIIEAGGKQFCVEEGSKIFVSKIDAEVGTEIFFDKIFMIGGSSPQIGTPYINNAKVIAKVLEHGRDKK
RL21_SINMW      MFAVIKTGGKQYRVAANDVITIEKLDGAAGDKIEFTEILMVGGADATIGAPFVEGAVVSAEVVDHGRAKK
RL21_PHOLL      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETVEFDQVLMVNGDDIKIGAPVVEGVKIKAEVVAHGRGEK
RL21_PELTS      MYAIIETGGKQYRVREGDTLYVEKLPAGAGETVEADRVLAVIKDEVMIGTPSVENAKVFLKVERHGRGXX
RL21_KLEP7      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFAEVLMIAGEEIKIGVPFVEGGVIKAEVVAHGRGEK
RL21_KLEP3      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFAEVLMIAGEEIKIGVPFVEGGVIKAEVVAHGRGEK
RL21_COXBU      MYAIIKTGGKQYRVTEGQMLKVEKLAQDVGQSVKFDDVLMVAGDELHIGTPSVKDAAVTAEVVDQGRQAK
RL21_COXBR      MYAIIKTGGKQYRVTEGQMLKVEKLAQDVGQSVKFDDVLMVAGDELHIGTPSVKDAAVTAEVVDQGRQAK
RL21_PECCP      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFDQVLMVNGEEIKIGVPFVDGGKIKAEVVAHGRGEK
RL21_HAEDU      MYAIFQSGGKQHRVSEGQVVRLEKLELATGEKVEFDSVLMVNGEDIKIGAPVVAGAKVMAEVVAQGRGDK
RL21_GEOSF      MYAVVRTGGKQYKVSEGDFLKVEKLEGAVGDTVNLSEVLMVGGDKVAIGTPLVPSASVVGKIVEQGKDKK
RL21_COXBN      MYAIIKTGGKQYRVTEGQMLKVEKLAQDVGQSVKFDDVLMVAGDELHIGTPSVKDAAVTAEVVDQGRQAK
RL21_SHIFL      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SHIF8      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SHIDS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SHIBS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SHIB3      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALSV      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMVNGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_GEOUR      MYAVVRTGGKQYKVSEGDFLKVEKLEGAVGDTVELSEVLMVGGDKVAIGTPLVPSASVVGKIVEQGKDKK
RL21_ESCF3      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ENT38      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOUT      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOSM      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOSE      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOLU      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOLI      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOLC      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOL5      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOHS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECODH      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECOBW      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO8A      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO81      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO7I      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO5E      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO57      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO55      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO45      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO27      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_ECO24      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_DESMR      MYAIVMAGGKQYKVQEGATITVDLLAAEAGSEYVLDKVLMIGGGEAKIGAPYVAGAAVTCQVAGHVKGKK
RL21_CARHZ      MYAIIQTGGKQYKVAEGDKIFVEKLNAEPGSIVTINEVLAVVKDGSIAGNPYVEGAKVNLKVVRHGKGRK
RL21_VIBFM      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDNVLMINGEEITVGAPLVAGGKVTAEVVQHGRGDK
RL21_VIBF1      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDNVLMINGEEITVGAPLVAGGKVTAEVVQHGRGDK
RL21_SALTY      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALTI      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALPB      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALNS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALHS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALG2      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALEP      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_SALA4      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_HELMI      MFAIIETGGKQYKVQQGDVLKVEKLEANPGDVVEIDRVFAVSKDELKVGAPTVEGAKVLLKVEDHGXXXX
RL21_ALCBS      MYAVIKTGGKQYRVEEGDVVRIEKIEVATGESVDFDQVLLVNGDDVKVGQPMLDGAKVTAEVLEQGXXXX
RL21_TREDE      MYALIEYKGKQYKAEKGAKLVVDKLSAESGSKIDIDTVLLISGDKVTVGTPYVSGAKVSATVGDSFRERK
RL21_THELT      MYAIIETGGKQYKVSEGDTIAVEKLSVKQGEQIVFERILHLSTDGTVIGQPYVEGCTVKGTVLSHEXXXX
RL21_SHESR      MYAVFQSGGKQHRVAPGHTVRLEKLEVATGSTVEFDQVLLIAGEKVHVGAPLVAGGKVVAEVVSHGRGEK
RL21_SHESM      MYAVFQSGGKQHRVAPGHTVRLEKLEVATGSTVEFDQVLLIAGEKVHVGAPLVAGGKVVAEVVSHGRGEK
RL21_SALPK      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGIPFVDGGVIKAEVVAHGRGEK
RL21_SALPA      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFAEVLMINGEEVKIGIPFVDGGVIKAEVVAHGRGEK
RL21_PHOPR      MYAVFQSGGKQHRVSEGQTLRLEKLEAETGANVEFDCVLLVNGEEVTVGAPFVTGGKVTAEVVTHGRGDK
RL21_ALISL      MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVDFDNVLMINGEEITVGAPLVAGGKVTAEVVQHGRGDK
RL21_YERPY      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPS      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPP      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPN      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPG      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPE      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPB      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERPA      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_YERP3      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMINGEEINIGAPLVDGGKIKAEIIAHGRGEK
RL21_SHEB9      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETIEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGDK
RL21_SHEB8      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETIEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGDK
RL21_SHEB5      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETIEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGDK
RL21_SHEB2      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETIEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGDK
RL21_PSEA6      MYAVFQSGGKQHRVAEGQTVRLEKIEVAPGESVEFGDILMVSGEDVKIGTPFVSGGKVTAEVVTHGRGEK
RL21_ALKMQ      MYAIIETGGKQYRVQEGDTLFVEKLEASKDDVVTIDNVLAVSKDGSLIGSPIXXXXXXXXXXXXQXXXXX
RL21_SHESW      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGSTVEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGEK
RL21_SHESA      MYAVFQSGGKQHRVAPGHTVRLEKLEVATGSTVEFDQVLLIAGEKVHVGAPLVAGGKVVAEVVSHGRGEK
RL21_SHEPC      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGSTVEFDQVLLIADGETVVGAPLVAGGKVVAEVVSHGRGEK
RL21_SHEON      MYAVFQSGGKQHRVAPGHTVRLEKLEVATGSTVEFDQVLLIAGEKVHVGAPLVAGGKVVAEVVSHGRGEK
RL21_PROMH      MYAVFQSGGKQHRVSEGQTIRLEKLEVATGETIEFDTVMMVAGDNIQIGAPILEGVKVKAEVVAHGRGEK
RL21_GEOSL      MYAVIRTGGKQYKVSEGDFLKVEKLEGAVGDTVELKDVLMVGGETVAIGTPLVPSASVVGRIVDQGKDKK
RL21_ERWT9      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETIEFDQVLMINGEDVKIGAPLVSGGVIKAEIVAHGRGDK
RL21_THEPX      MYAIIETGGKQYMVREGDVLVVEKLNYPEGEVISFDKILAVSKENVEFGKPYLENVKVNAKIIEHGKGPK
RL21_THEP3      MYAIIETGGKQYMVREGDVLVVEKLNYPEGEVISFDKILAVSKENVEFGKPYLENVKVNAKIIEHGKGPK
RL21_SHISS      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFAEVLMINGEEVKIGVPFVDGGVIKAEVVAHGRGEK
RL21_METCA      MYAVIQTGGKQYRVQPGDKVKVESLDAEAGQEVAFEKVLLIQSDDGVIGQPFVSGGKVTGTVVAHGXXXX
RL21_ERWCT      MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFDLVLMVNGEEIKIGVPYVDGGKIKAEVVAHGRGEK
RL21_NITEU      MYAVIKTGGKQYRVEVGNKLKVETLPAEVGSDIQLDQVLMIAGEAISAGAPLLDQAKVSATVVSHGRHDK
RL21_DESAH      MYAVIKTGGKQYKVQEGDTLRVEKLEGTENGEIEFDVLMFSDGENVTLGQPAIEDAIVKGHILEQGKGKK
RL21_BUCAP      MYAVFMSGGKQYRVKKNQIIQLEKLNNSPGSIIEFDKILMISAKKEVIGEPFLKGTKIKAHVENHGRLXX
RL21_SODGM      MYAVLQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQVMMINGDDIQIGGPFVTGGKITAEVVAHGRGDK
RL21_NEIMF      MYAVVKTGGKQYKVSVGEKLKVEQIPAELDSQIELTEVLMIAGESVKVGAPFIEGAKVTAKVVAHGRGEK
RL21_NEIMB      MYAVVKTGGKQYKVSVGEKLKVEQIPAELDSQIELTEVLMIAGESVKVGAPFIEGAKVTAKVVAHGRGEK
RL21_NEIMA      MYAVVKTGGKQYKVSVGEKLKVEQIPAELDSQIELTEVLMIAGESVKVGAPFIEGAKVTAKVVAHGRGEK
RL21_NEIG1      MYAVVKTGGKQYKVSVGEKLKVEQIPAQLDSQIELTEVLMIAGESVKVGAPFIEGAKVTAKVVAHGRGEK
RL21_THEYD      MYAIIETGGKQFRVKSGDIVKIEKLNIEPGQEVIFDKVLFKGNEGLKIGNPYIEGVKVKAEVIDEKKDKK
RL21_FUSNN      MYAVIKTGGKQYKVTEGDVLKVEKLNAEVNTTVELTEVLLVGGDNAVVGKPLVEGAKVVVEVLSQGKGPK
RL21_COLP3      MYAVFQSGGKQHRVTEGQTVRLEKLELEVGATVEFDNVLMINGDNINVGAPYVAGGKVVAEVVTQARAPK
RL21_CLOPS      MYAVLTTGGKQYRVQEGDVLFVEKLNAEVDSTVELTEVLAVAKDGEIVGAPVVEGAKVVAKVLAQGXXXX
RL21_CLOPE      MYAVLTTGGKQYRVQEGDVLFVEKLNAEVDSTVELTEVLAVAKDGEIVGAPVVEGAKVVAKVLAQGXXXX
RL21_CLOP1      MYAVLTTGGKQYRVQEGDVLFVEKLNAEVDSTVELTEVLAVAKDGEIVGAPVVEGAKVVAKVLAQGXXXX
RL21_BUCAT      MYAVFISGGKQYRVVKNQIIRLEKLNSPLGTTIEFDKILMLDKDSIKIGTPFVEGGTIKAHIQNHGRLXX
RL21_BUCAI      MYAVFISGGKQYRVVKNQIIRLEKLNSPLGTTIEFDKILMLDKDSIKIGTPFVEGGTIKAHIQNHGRLXX
RL21_BUCA5      MYAVFISGGKQYRVVKNQIIRLEKLNSPLGTTIEFDKILMLDKDSIKIGTPFVEGGTIKAHIQNHGRLXX
RL21_CLOTH      MYAVIETGGKQYKVQEGDVLFIEKLANEEGSTVTFXXXXXXXXXXXXFGTPFVSNASVTAKVLCHXXXXX
RL21_GEOMG      MYAVVRTGGKQYKVSEGDFLKVEKLEGAVGDTIELKDILMVGGETVKIGTPLVPSASVVGKIVEQGKDKK
RL21_EUBE2      MYAIIATGGKQYTVSEGDTIRVEKLAVNAGDTVTFDQVLFVNNGEAKVGEPXXXXXXXXXXXXXXXRDKK
RL21_DEHSC      IYAIIESGGKQYKVTPGQLVEVDLLDLAEGDSIELDKVLMLNDGETVIGSPTISGAKVTATVAGHIKGDK
RL21_CALS8      MYAIIETGGKQYKVQEGDVLKVEKLKADVDSVVKIDKVLAISSDDFVVGKPYVDGAYVEAKVLEHAKDKK
RL21_THEP1      MYAIVETAGRQYRVEEGKILYTEKQDYSPGDEIVFDRVVFVRKDEVLVGKPYVEGAKVVGKVLEHAKARK
RL21_XANOR      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTVLMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_XANOM      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTVLMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_XANC5      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_XANAC      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_THETN      MYAIIETGGKQYMVREGDVLKVEKLNYPEGEVIALDKVLAVSFENVEFGKPYLENVKVTAKVLEHGKGPK
RL21_SYNP2      -YAIIETGGKQVRVEPGRFYDIERLDVDVDGNHTIEKVLLISDDNGVVGQPYIDGATVEGTVVDQRRAKK
RL21_STRM5      MYAVLVTGGKQYRVAQGEKLRIEKLEVEVGSEIKFDNILLLGDSDGIKIGDALSGAAVTATVLSQGRADK
RL21_XANCP      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_XANCB      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_XANC8      MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTAKVVAHGRADK
RL21_THESQ      MYAIVETAGRQYRVEEGKILYTERQDYSPGDEIVFDRVVFVRKDEVLVGKPYVEGAKVVGKVLEHAKARK
RL21_THEMA      LYAIVETAGRQYRVEEGKILYTEKQDYSPGDEIVFDRVVFVRKDEVLVGKPYVEGAKVVGKVLEHAKARK
RL21_BREBN      MYAIIETGGKQYKVEEGAVLFIEKLADVEGEVVTFDKVLLVSKDXXXXXXXXXXXXXXXXXXEKHGXXXX
RL21_RHIME      MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEFTEILMVGGADATIGAPFVEGAVVSAEVVDQGRA--
RL21_PSEMY      MYAVIVTGGKQYKVTEGEFLKIEKLELATGEAVTFDRVLLIGGDDVKIGAPXXXXXXXXXXXXSQGRHDK
RL21_NITEC      MYAVIKTGGKQYRVQIGNKLKVETLPVEVGSDIQLDQVLMVAGEIVSTGAPLLDQAKVSATVISHGRHDK
RL21_DESOH      MYAVIATGGKQYRVEKDEVLRLEKLPGQVGDTVSFDQILFSDGESVSVGTPVLGNVTVSGKIVEQDRAKK
RL21_DEHE1      IYAIIESGGKQYKVTPGQLVEVDLFDLAEGDSIELDKVLMLNDGETVIGSPTVPGAKVTATVAGHIKGDK
RL21_ROSDO      MFAVLKTGGKQYKVQAGDMLRVEKLAADAGETVQFNEVLMLGGENTVVGAPFVKDAGVQAEVVDQ-----
RL21_RHISN      MFAVIKTGGKQYRVAADDVITIEKLEGVAGDKIEFTEILMVGGADATIGAPFVEGAVVSAEVVDQGRA--
RL21_MYCPU      MYAIIEVGGKQLLVKEQEVIFTEKIEGNAGEKVEFDKVLLF-GDK--VGRPYLEKVKVIGEIQKQSKHKK
RL21_SYNFM      MYAVLKSGGRQYEVRPGQVVKVEKLLGEVGDKVTLDQVLFSDGTDIQVGQPVLANIAVQGQIVEQGRHRK
RL21_STRMK      MYAVLVTGGKQYRVAQGEKLRIEKLEVEVGSEIKFDNILMLGDSDGVKLGDALKGAAVTAKVLSQGRADK
RL21_NOSP7      -YAIIETGGKQIRVEPGRFYDIELLPTEPDEKVTIDSVLLVQHDGAVIGQPLVTGATVEGTVMRHYRGRX
RL21_ANADE      MYAVIRTGGKQYRVAQGDRVKIEKLAGDVGGKVNFDVLLVGGEGEAKVGKPTLAGVTVEGEIVAQGXXXX
RL21_KOSOT      MYAIIEASGKQYKVEEGITLFTEKLDFAEGDQVVFDRVLLLKDDSGVVGKPYLENVKIVGKVVRHGRGKK
RL21_ANASK      MYAVIRTGGKQYRVAQGDRVKIEKLAGDVGGKVNFDVLLVGGEGEAKVGTPTLAGVTVEGEIVAQDXXXX
RL21_ANAD2      MYAVIRTGGKQYRVAQGDRVKIEKLAGDVGGKVNFDVLLVGGEGEAKVGTPTLAGVTVEGEIVAQDXXXX
RL21_ROSCS      MYAIVRDRGMQYRVEEGQTLRIALLDAEPGSAIELGEVLLIGGEMPLVGAPTVDGAKVLATVLGEEKGDK
RL21_LEGPH      MYAVIKTGGKQYTVKEGDVLKIEMLPENVGNEIKFSEVMLVDGDKVTCGTPFVAKATVKAEVLDHGXXXX
RL21_LEGPC      MYAVIKTGGKQYTVKEGDVLKIEMLPENVGNEIKFSEVMLVDGDKVTCGTPFVAKATVKAEVLDHGXXXX
RL21_LEGPA      MYAVIKTGGKQYTVKEGDVLKIEMLPENVGNEIKFSEVMLVDGDKVTCGTPFVAKATVKAEVLDHGXXXX
RL21_HALHL      MYAVIRSGGKQYRVSEGDVLRVEKLPAEVGETVQFDDVLMVGGSEVKIGTPHVEGGSVKAEVLEQDRHRK
RL21_AMOA5      MYAIVEIAGKQFKVTKDLYIYTPKMDQEAGSSVSFDKILLLQNDQDIVGDPTVAGAKIEGKVIEHVKGDK
RL21_ACIAC      MYAVIKTGGKQYRVASGEKIKVEQIAADVGQEIVIDQVLAVGGAELKVGTPLVSGXXXXXXXXXHGKHDK
RL21_PSEPF      MYAVIVTGGKQYKVAEGEYLKIEKLEVATGESVTFDRVLLVNGDDVNIGAPVVAGATVKAEVISQGR---
RL21_PSEF5      MYAVIVTGGKQYKVAEGEYLKIEKLEVATGESVTFDRVLLVNGDDVNIGAPVVAGATVKAEVISQGR---
RL21_DICTD      MFVVVETGGKQYKVSVGSMVNVEKLKANVGDEVVLDKVLLVGEDEVIIGQPYVEGAKVIAKVVRQDKYPK
RL21_DESPS      MYAIVRTGGKQYQVACGDQLRVEKLEGNVGDSLDLDVLMLVDGDNVQVGQPVLENAKVVAKIAEQXXXXX
RL21_RHOCS      MFAVIRTGGKQYKVANGDVIKVEKLVADAGATVTLDDVLMVSAGKTTIGTPVVQGAAVTAEVVAQSRGPK
RL21_ANAVT      -YAIIETGGKQVRVEPGRFYDIELLSAEPDEKVTIESVLLVQNDEVTIGQPLVAGATVQGTVLRHLRGRX
RL21_ANASP      -YAIIETGGKQVRVEPGRFYDIELLSVEPDEKVTIDSVLLVQNDEVTIGQPLVAGATVQGTVLRHLRGRX
RL21_THEM4      MYAIVESGGKQYRVEPGKVFFTERILGKEGEAITLDKVLMVKTDKLLVGKPYLENVSITGTIVEHGRARK
RL21_CYAP4      -YAIVATAGKQFRVEPGRFYDVDRMNVEPEQTVSLDQVLLVDGDTIAVGQPLVEGATVEATVMQHLRGRK
RL21_OCHA4      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGAIVTAEVVEQGRARK
RL21_LEGPL      MYAVIKTGGKQYTVKEGDVLKIEMLPENVGNEIKFSEVMLVDGDKVTCGAPFVAKATVKAEVLDHGXXXX
RL21_CLOK5      MYAVVATGGKQYKVSEGDIIYVEKLEAEVDSTIELDKVLMINKDELVVGKPVVEXXXXXXXXXXXXXXXX
RL21_CLOK1      MYAVVATGGKQYKVSEGDIIYVEKLEAEVDSTIELDKVLMINKDELVVGKPVVEXXXXXXXXXXXXXXXX
RL21_BARBK      MFAVIKTGGKQYRVVANQVLKVEKIVGNAGDVVNFSDVLMVGGDNAIIGAPIVADASVTAEIIGQERARK
RL21_NITOC      MYAVIKTGGKQYRVQEGDTLRVEKINADEGATITLDEVLLVANEDNIVGAPYIEGGKVSATVK-------
RL21_ACIBY      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_ACIBT      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_ACIBS      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_ACIBC      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_ACIB5      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_ACIB3      MYAVIQSGGKQHRVVEGETLKVELLKAESGATITFDDVLMVNGDNIQIGAPVVAGAKVTAEVIGHGXXXX
RL21_SYNAS      MYAVIKTGGKQHRVSEGDLLTVEKLAGSKGDSVVFDDVLMVAKEGEIVGKPVLEGAKVVGEIVAQVKGPK
RL21_NITSB      MYAIIKNGGKQYKVKEGDIICFDKMGLEPKTKVEFKEVLAVDNGELKVGTPFVEGAVVEGEVINEXXXXX
RL21_METPP      MYALIKTGGKQYKVAAGEKIKVEQIAADVGQEIVIDQVLAVGGADLKVGTPLXXXXXXXXXXXXHGRHDK
RL21_CHRSD      MYAVIKSGGKQYRVQEGQTLKLEKLEVATGETXXXXXXXXXXXXXXXXGAPLVEGAKVTAEVVSHGRGEK
RL21_ACIAD      MYAVIQSGGKQHRVVEGETLKVELLKAETGSTITFDDVLMVSGESVQIGAPVVAGAKVTAEVVGHGXXXX
RL21_RHILO      MFAVIKTGGKQYRVAANDLLKIEKVEANVGDIVEIGHVLAHGGENVTFGAPFVDGALVTAEVVEQGKNRT
RL21_BRUSU      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGALVTAEVVEQGRGRK
RL21_BRUSI      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGALVTAEVVEQGRGRK
RL21_BRUME      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGALVTAEVVEQGRGRK
RL21_BRUMB      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGALVTAEVVEQGRGRK
RL21_ACICJ      MFAVIRTGGKQYRVVPDAVLKVEKLEAEAGSTVTFTDVLAIGGEQGVLGKPVVEGATVTATVIAQDKLDT
RL21_YERE8      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGEAVEFDQVLMINGEEINIGAPLXXXXXXXXXXXXHGRGEK
RL21_UNCTG      MYAIIKTGGKQYKVEKGVSLVVEKLKGVEGQEVILREVLLLAGEKLTVGKPIIESARVVAKVVSQKRGPK
RL21_RHILW      MFAVIKTGGKQYRVAANDVLTIEKLEATAGDSIEFTEVLVIGGADAAIGAPFVTGASVKAEVVEQNR---
RL21_RHIL3      MFAVIKTGGKQYRVAANDVLTIEKLEATAGDSIEFTEVLVIGGADAAIGAPFVTGASVKAEVVEQNR---
RL21_RHIE6      MFAVIKTGGKQYRVAANDVLTIEKLEAAAGDSIEFTEVLVIGGADAAIGAPFVTGASVKAEVVEQNR---
RL21_ACAM1      -FAIIETGGKQLKVEPGRYYDVDRLADDPDTKLSLNQVLLVDGNEATVGQPLVKGATVEVTVMQHRRDRK
RL21_TRIEI      -YAIIETGGKQLRVEAGRFYDIDLLSGSEGDRISINNVLLVQNDGDVIGQPLVEGALIEGTIMKHLRGKK
RL21_TOLAT      MYAVILSGGKQHRVAEGQVLRLEKLEAATGAAVEFDKVLMVNGDDVKVGAPYXXXXXXXXXXXXXXRGDK
RL21_BRUAB      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGSLVTAEVVEQGRGRK
RL21_BRUA2      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGSLVTAEVVEQGRGRK
RL21_BRUA1      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGSLVTAEVVEQGRGRK
RL21_BART1      MFAVIKTGGKQYRIVANQVVKVEKVIGNAGDVVEFNDVLMVGQESAVIGTPVVADARVTAEILEQARGRK
RL21_AZOC5      MFAVIKTGGKQYRVATNDVITVEKLEAAAGESVTF-PVLLLSGETTLVGAPLVEGASVTAEVVEQTR---
RL21_XYLFT      MYAVLVTGGKQYRVVQGETLRVEKLDVETGGDVTFNSVLLMGGSDGIHVGEALKDASVTAKVVAHGXXXX
RL21_ROSS1      MYAIVRDRGMQYRVEEGQALDIALLDAEPGSEIELGDVLLIGGEQPRVGTPTVDGAKVVATVLGTIKGDK
RL21_RICPU      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQVLMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICCK      MFAVIKAGGKQYKVDRNSVIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_PSYCK      MYAVIKTGGKQHRXXXXXXXXXXXXXAETGETIKFEDVLMIVDGETVIGQPIVEGASXXXXXXXHGRGEK
RL21_PSYA2      MYAVIKTGGKQHRXXXXXXXXXXXXXAETGETIKFEDVLMIVDGETVIGQPIVEGASXXXXXXXHGRGEK
RL21_AZOSE      MYAVIKTGGKQYRVAAGEKIKVEQIPADVGSEITIDQVFMVGGESVKIXXXXXXXXXXXXXXXXHGRHDK
RL21_RICTY      MFAVIKAGGKQYKVDRNSVIKIEKIDGELGSKVQFDQILMIGSKPSFIGTPIVKGAIVTAEITNQLKDNK
RL21_RICRS      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICRO      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICPR      MFAVIKAGGKQYKVDRNSVIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAIVTAEITNQLKDNK
RL21_RICFE      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICCN      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICAH      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RICAE      MFAVIKAGGKQYKVDRNSIIKVEKIDGELGSKIQFDQILMIGSKPSFIGTPIVKGAVVTAEITNQLKDNK
RL21_RHIEC      MFAVIKTGGKQYRVAANDVLTIEKLEASAGDSIEFTEVLVIGGADAAIGAPFVAGASVKAEVVDQTR---
RL21_MYCPN      MHAIVVCGSKQYLVHENDTFFVEKLEAPVGKEIQLDKVLMLDEK---IGAPYLEKARVVCVVEKHGLQRK
RL21_FLAJ1      MYAIVEIAGQQFKVSKDLKVYVHRLANEEGSKVSFDKVLLLDDNGNVLGAPAIEGASVEAKVLQHLKGDK
RL21_MANSM      MYAVFQSGGKQHRVSEGQVVRLEKLEKATGETVEFDSVLMVNGEDVKIGAPXXXXXXXXXXXXXQGRGDK
RL21_BRUC2      MFAVIKTGGKQYRVAANDLIKVEKVAGEAGDIVEFAEVLMVG---STIGAPTVAGALVTAEVVEQSRGRK
RL21_BARHE      MFAVIKTGGKQYRVVANQVVRVEKIIGNAGDVVEFNDILMAGEDNAIIGAPVVRDALVTAEIIEQARARK
RL21_ACTSZ      MYAVFQSGGKQHRVSEGQVVRLEKLELATGETVEFDSVLMVNGEDVKIGAPXXXXXXXXXXXXXQGRGDK
RL21_PELUB      -YAIIQTGGKQYKVKAGEILKIERLDSKPETKIEFKEILAYGDDKTIVGSPVVEGAKVEADLVENGK---
RL21_MAGSM      MYAVIRTGGKQYKVSQGDVLRVETVAGDAGGEVIFDDVLMVGGDEGLKVGEATEGAKVTGTIIRQMRDXX
RL21_HAMD5      MYAVFQSGGKQHRVTEGETVRLEKLSNVTGEKINFNQVLMISDGETIVGAPLINGGLVQAEVMAHGXXXX
RL21_HAEPS      MYAVFQSGGKQHRVSEGQVVRLEKLEVATGEKVEFDSVLMVNGEDVKIGTPXXXXXXXXXXXXXXXRGEK
RL21_SACEN      MYAIVKTGGKQYKVAVGDVVEVEKLEGEPGSEVTFPALLLVDGSDVTADADALAKVSVTGKLVEQTKGPK
RL21_METSB      MFAVIKTGGKQYNVSADDTITVMALPGEKGDAVSFDTVLMFGGEQSTLGAPFIEGASVVGEIVEQKR---
RL21_HAES2      MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVMIVNGEDIKIGTPXXXXXXXXXXXXSQGRGEK
RL21_HAES1      MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVMIVNGEDIKIGTPXXXXXXXXXXXXSQGRGEK
RL21_DEIRA      MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVEL-KALFVGGEQTVFGED-AGKYTVQAEVVEHGRGKK
RL21_BUCBP      MYAIFKSGGKQHKVIKGQTIRLEKINQSIGTQIKFKKILMCNGTHITIGKPHIHNNFILANIINHGRHXX
RL21_XYLFA      MYAVLVTGGKQYRVVQGETLRVEKLDVETGSDVTFNSVLLMGSSDGIHVGEALKDASVTAKVVAHGXXXX
RL21_RHORT      MFAVIKTGGKQYKVAENDVIDIEKLEADEGATVEFDSVLALG---DTVGLPTIAGAKVTGEVLSQFRGEK
RL21_PETMO      MYAIVYFNGKQYKVEKDQVIYTEKVDVDPGNEVVLDKVIYLSEEEKKAGKPYVEGAKVITEVVEHGKDRK
RL21_AGRRK      MFAVIKTGGKQYRVAANDVLTIEKLEVVAGDTVEFTEVLVIGGADAAIGAPFVKGASVKAEVVEHNR---
RL21_SYNE7      -YAIIEASGKQLWVEPGRFYDLDRLDADLDQSLTLDKVLLVQDEAPQIGQPYVAGATVQVTVLSHPRGXX
RL21_SHEAM      MYAVFQSGGKQHRVAEGHTVRLEKIEVATGETIEFDQVLLVAGENVKVGAPLXXXXXXXXXXXXXXRGEK
RL21_SERP5      MYAVFQSGGKQHRVSEGQTIRLEKLDIATGEAVEFDQILMINGEDIKIGVPYVDGGKIKAEVVAHGR---
RL21_MICAN      -YAIIETGGKQIRVEPGRYYDIELLPVDEQSTHTIDKVLLIHDEDDIIGQPFIEGATVEGTVIQHRRGKK
RL21_CYAP7      -YAIIETGGKQLKVQPGRFYDIELLHVDPETSHTIDKVLLVSHDNEVVGQPFVEGATVEGTILRHFRGRK
RL21_AGRVS      MFAVIKTGGKQYRVAANDVLTIEKLEAEAGAIVEFTEILVVGGADATIGAPFVAGATVKAEVVEHNR---
RL21_SHEDO      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGATVEFDQVLLIADGETVVGAPLXXXXXXXXXXXXXXRGEK
RL21_CLOPH      MYAIIATGGKQYKVAEGDIIKVEKLGVEAGATVSFDXXXXXXXXXXXXXXPXXXXXXXXXXXXEEGKNKK
RL21_CAUCR      MYAVIKTGGKQYRVQAGDLLVVEKLEGEPGAAVAFGEVLMLGGEAVTVGAPTVDGAVVSGTL--------
RL21_BIFAA      MYAIVKAGGHQEKVEVGDVILVNRLNAKKGDTVEFPAALVVDGSKVILGAKDLAKLTVKAVVNDEAKGPK
RL21_SHEFN      MYAVFQSGGKQHRVAEGHTVRLEKLEVATGETVEFDQVLLIADGETVVGAPLXXXXXXXXXXXXXXRGEK
RL21_MAGSA      MFAVIQTGGKQYKVASGDVIRVEKLAGEAGAEVVLDQVLMV-GDK--IGVPVVAGASVKATVVAQAR---
RL21_HELHP      MYAIFKNGGKQYKVVEGSIILLDKMSLEPKSKVELNEVLIVDGDKTDVGTPFVKGAKIEAEVINEXXXXX
RL21_GLOVI      VYAIVETGGKQVLVQPGRFYXXXXXXXXXXXXXTFDKVLLVGG--AVVGRPTVEGAAVQGRILQHGKAAK
RL21_BEII9      MFAVIKTGGKQYSVAADDIITVMTLQGEPGDAVTFDSVLMLAGEEPKIGAPFIAGATVSGEIVEQTRGPK
RL21_GRABC      MFAVIRTGGKQYRVTPNAVLKVEKLEAEPGSTITFTDVLAVGGENLTIGAPVVAGASVTATVIAQDR---
RL21_HAHCH      MYAVIVSGGKQHRVKEGERLKLEKIEVETGGVVEFDKVLLVNGDDVKVGAPVVEGAKVTAEVVAHGR---
RL21_DEIDV      MFAIIQTGGKQYRVQEGDVIRVENLKGEAGDKLDLTP-LFVGGDQALFGDA-VSNFVVNAEVVEHGRGPK
RL21_SYNS3      -YAIVEASGQQFWVQPNRYYDLDRLHADVDAKITLDKVLLVNGDAATIGKPYVQGASVELKVMAHRRGQK
RL21_BIFA0      MYAIVKAGGHQEKVEVGDTILVNRLDAKNGETVEFPVALVVDGEKVIIAAADLAKISVKAVVNDDAKGPK
RL21_RICBR      MFAVIKAGGKQYKVDQNSVIKVEKIEGELGSKIQLNQVLMMGSKPSFIGTPLVKGAVVTAEITNQLRDNK
RL21_RICB8      MFAVIKAGGKQYKVDQNSVIKVEKIEGELGSKIQLNQVLMMGSKPSFIGTPLVKGAVVTAEITNQLRDNK
RL21_JANSC      MFAVMKTGGKQYKVQAGDKLRVXXXXXXXXXXVQFNEILMLGGDNVTVGAPLVEGAAVQANVIEQ-----
RL21_JANMA      MYAVIKTGGKQYKVVAGEKFKVEQIPADIGSEITLDQVLALGAGETIFXXXXXXXXXXXXXXXSHGRHDK
RL21_DEIGD      MFAIIQSGGKQYRVQEGDVVRVETLKGEAGDKLEL-KPILVGGNDTLLGDEAAR-FTVNAEIVEHGLGKK
RL21_BIFLO      MYAIVKAGGHQEKVEVGDVILVNRLDAKKGDTVEFPVSLVVDGDKVTLAAADLAKVSVKAVVNDEAKGPK
RL21_BIFLI      MYAIVKAGGHQEKVEVGDVILVNRLDAKKGDTVEFPVSLVVDGDKVTLAAADLAKVSVKAVVNDEAKGPK
RL21_BIFLD      MYAIVKAGGHQEKVEVGDVILVNRLDAKKGDTVEFPVSLVVDGDKVTLAAADLAKVSVKAVVNDEAKGPK
RL21_AERS4      MYAVFQSGGKQHRVAEGQIVRLEKLNVETGATIDFNEVLMVAGDTFKVGAPFXXXXXXXXXXXXHGRGEK
RL21_AERHH      MYAVFQSGGKQHRVAEGQIVRLEKLNVETGATIDFNEVLMVAGDTFKVGAPFXXXXXXXXXXXXHGRGEK
RL21_SYNP6      -YAIIEASDKQLWVEPGRFYDLDRLDADLDQSLTLDKVLLVQDEAPQIGQPYVAGATVQVTVLSHPRGRK
RL21_PARUW      MYAIIKTGGKQYRVQEGDIIDVELLNTDPGAQVEFGEVLFADGAKTQIGKPGIPNFLVYXXXXXXXXXXX
RL21_DESAA      MYAVIATGGKQYKVGEGEIVRVEKLPGEVGDTVRLDQVLFSDGENVKVGQPTVENVAVDAQIVEQGXXXX
RL21_CHLCV      -YAIIQTGSKQYQVSEGDVIDVELLDGSEGQEIVFDQVLFTDGSKVSLGTPIVKDAVVKGQLLSQVRGEK
RL21_PROMA      -YAIVETSGTQFWLEADRYYDIDRINANVDETVTLDKVLLINDQKGAIGKPYIKGASVQLKVMAHKRGPK
RL21_CORA7      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGSSVALTPVLLVDGATVKSKAADLEKVSVSAEIVEQGKGPK
RL21_ORITI      MFAVIKTGSKQYRVAKDSIIKIEKIDGEPGSTIEFKEVLMIGSKPSFIGTPIVKGASVTAQILNQLRNQK
RL21_MARMM      MFAVIKTGGKQYRVAAGDEIRIEKLEGAAGDTLDLGDVLMLGSEAGVVGSPTIDGAQVIGELLDTNRARK
RL21_AZOPC      MYAIVEIQGQQFKVEKDQKLYVNHFEAKEGVPIIFNKVLLVDNDGFIIGNPLIKGAKVEVSILRSLVKGD
RL21_AGRT5      MFAVIKTGGKQYRVAADAVLTIEKLEAEAGATVEFTEVLVIGGADAQFGAPFVKGAIVKAEVVEHNR---
RL21_ACTP2      MYAVFQSGGKQHRVSEGQVVRLEKLEIATGEKVEFDSVLMVNGEDXXXXXXXXXXXXXXXXXXXQGRGDK
RL21_BLOPB      MYAVFQTGSKQYRVVEGQVIHIERIDLEVGNQVEFNQILLIDSNECLIGSPFIKKGRIIAEIIAQSLNQX
RL21_AQUAE      MYAVIKTGGKQYKVEKGMKLKVEKLPYEVGQTVEFEALMLRKDDGSI---EFNKGKVI-AEVKAHGRGKK
RL21_THEAB      MYAIVESGGKQFRVEPGKVFFTERXXXXXXXXXXLDKVLMVKTDKVLVGKPYLENVEIKGTIVEHGRARK
RL21_METEP      MFAVIKTGGKQYRVAANDVITVATLEGEAGAAVTFDVLLFTDGDATQVGTPLLSGIGVTGEIVQHGRTRK
RL21_METC4      MFAVIKTGGKQYRVAANDVITVATLEGEAGAAVTFDVLLFTDGDATQVGTPLLSGIGVTGEIVQHGRTRK
RK21_ARATH      IFAVIMVGGRQYIVFPGRYLYTQRLDANVDDQIVLNKVLLVGTKTTYIGKPVVTNATVHAVVESQGLNDX
RL21_EHRRG      MFAIIETGGKQYKVKEHDIIRIEKLNASVGEEVTLSKVILTGVDNEVI---FTQNASVTASVLEQCRNDK
RL21_CHLAB      -YAIIQTGSKQYQVSEGDIIDVELLDVSEGQEIVFDQVLFTDGSKVSLGTPTVKNAVVKGELLSRVRGEK
RL21_ACTP7      MYAVFQSGGKQHRVSEGQVVRLEKLEIATGEKFEFDSVLMVNGEDXXXXXXXXXXXXXXXXXXXQGRGDK
RL21_CHLFF      -YAIIQTGNKQYQVSEGDVIDVELLDVSEGQEVVFEQVLFTDGSKASLGTPTVSNAVVKGEMLSRVRGEK
RL21_WOLSU      MYAIVKNGGKQYKVQEGDIVLFDKMSLEPKSKVELNEVLLCKDDNLILGTPFVEGAKIEIEVINEDXXXX
RL21_TREPS      MYALIEYKGKQYKVERGSSIVVDNIEVAPGGCIDVREVLMIGGEGTRIGSPYLEGVGVRAVVGECFRSRK
RL21_TREPA      MYALIEYKGKQYKVERGSSIVVDNIEVAPGGCIDVREVLMIGGEGTRIGSPYLEGVGVRAVVGECFRSRK
RL21_SULNB      MYAIIKASGQQFKVQEGDIICFDNMGLEPKSAVEFKEVLAVDNGELTVGTPFVEGAVVKGEVINEGXXXX
RL21_MARAV      MYAVIVSGGKQHRXXXXXXXXXXXXXXXXXXSVEFDRVLLVAGDDVKVGAPVVEGAKVTAEVVSHGRHDK
RL21_SULDN      MYAIIKNGGKQYKVQEGDILLFDRMTLEPKATFEIKEVLAVNAGELKMGAPFLEGAVVTAEVINEGRDKK
RL21_BDEBA      MYAIIRTGGKQYKVQAGDVVQVDKLEQALGAEFEINEVLMVGGESTAVGQP-------------------
RL21_BAUCH      MYAIFQSGGKQYQVKEGQTIRLEKLNVATGSTIEFHDIMMINDDNIYIGDPILHNSKITAKVIAHGRSKK
RL21_BACFR      MYAIVEINGQQFKAEAGQKLFVHHINAENGATVEFDKVLLVDKDGNVVGAPTVDGAKVVCQIVSSLVKGD
RL21_BACFN      MYAIVEINGQQFKAEAGQKLFVHHINAENGATVEFDKVLLVDKDGNVVGAPTVDGAKVVCQIVSSLVKGD
RL21_OLICO      MFAVIKTGGRQFRVVPNDVLEIGKITGDVGTIVQLGEVMAVGGDTPVLGFPFIEGASVAAEI--------
RL21_NOCFA      -YAIVKTGGKQYKVAVGDLVKVEKIEGEPGAAVELSPVLVVDGXXXXXXXXXXXKRSVTAELVEQTKGPK
RL21_MYCPA      -YAIVKTGGKQYKVAVGDVVKVEKLDSEPGSNVSLPVALVVDGAKVTSDAAALAKVAVTGEVLEHTKGPK
RL21_MYCGE      MHAIVVCGAKQYLVHENESIFVEKLAGKVGQEIQLDKVLML---DEKIGKPYLEKAKVVCVIEXXXXXXX
RL21_MYCA1      -YAIVKTGGKQYKVAVGDVVKVEKLDSEPGSNVSLPVALVVDGAKVTSDAAALAKVAVTGEVLEHTKGPK
RL21_CYTH3      MYAIVEIGGKQYKVEKDHFIYVYRLEGAEGSAVTFDNVLLLANNQYQVGAPSVAGASVSGKILEHLKDDK
RL21_CLOB8      MYAVLATGGKQYRVQEGDVIYVEKLNADVDSTVELNEVLAVGTEEGIXXXXXXXXXXXXXXXXXXXXXXX
RL21_CHLAD      MYAIIRDRGMQYRVEPGQVLTIDLLKAEPGSQIELGEVLLVGGEQVKIGSPLVEGAVVRAEVEKKG----
RL21_RHOBA      MYAIFVDGGRQYRVEPGMELDVDYRDIAAGENLKFETVLAVGADGLKLGAPTLDGVSVSASVLGMSQDKK
RL21_PSEU2      MYAVIVTGGKQYKVAPGEYLKIEKLEIATGESVTFDRVLLVGGDDVNIGXXXXXXXXXXXXXXSQGRHDK
RL21_PSE14      MYAVIVTGGKQYKVAPGEYLKIEKLEIATGESVTFDRVLLVGGDDVNIGXXXXXXXXXXXXXXSQGRHDK
RL21_PROMM      -YAIVEASGQQFLLQPNRYYDLDRLQAAVDDTVTLEKVLLIGKNDATVGQPYVKGASVELKVMDHRRGPK
RL21_MYCS2      -YAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKADDLAKVAVTAEVLEHTKGPK
RL21_HAEIG      MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSVLMVNGEDXXXXXXXXXXXXXXXXXXXQGRGEK
RL21_HAEIE      MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSVLMVNGEDXXXXXXXXXXXXXXXXXXXQGRGEK
RL21_HAEI8      MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSVLMVNGEDXXXXXXXXXXXXXXXXXXXQGRGEK
RL21_EHRRW      MFAIIETGGKQYKVKEHDIIRIEKLNASVGEEVTLSKVIALTGVNNEV--IFTQNASVTASVLEQCRNDK
RL21_XANP2      MFAVIKANGKQYRVAAADEITIDHLDAEVGSVFTF-PVLMLGGATVAIGAPHVDGATVTGEVVEQTR---
RL21_SULSY      MYAIVKTGGKQYKAEPGRLLKVEKLCANEGETVEL-PAICVRLDNGELKT---EG-KVKATVVKHDKHKK
RL21_RHOE4      -YAIVKTGGKQYKVAVGDLVKVEKIEGEPGTAVSLAPVLVVDGSDLTTDAAKLAKVAVTSEIVEHTKGPK
RL21_PROM9      LYAIAETSGQQFWFEVNRYYDIDRLNAKEKDKITLEKILLLKDKNSIIGKPYVKDAKIELEVVSHKRDKK
RL21_PROM3      -YAIVEASGQQFWLQPNRYYDLDRLQAAVDDTVTLENVLLIGKNDTTVGQPYVKGASVELKVMDHRRGPK
RL21_MYXXD      MYAVIRTGGKQYRVAEGDVVRIEKIAGDVGAEVTFTEILLVGGSESKVGQPTXXXXXXXXXXLAQDKHRR
RL21_MYCTU      -YAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDAKALAKVAVTGEVLGHTKGPK
RL21_MYCBO      -YAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDAKALAKVAVTGEVLGHTKGPK
RL21_CORK4      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGSSVALSPVLLVDGASITSGDD-LSSVAVNAEIVEHTKGPK
RL21_COPPD      MYALLEIRGKQYKVKENSTILVPGWEEIKPEEV---KVLMVKDENTVVGTPFVEGAEIELEPVKQIRTKK
RL21_PSESM      MYAVIVTGGKQYKVAPGEYLKIEKLEIATGESVTFDRVLLVGGDDVNIGXXXXXXXXXXXXXISQGRHDK
RL21_CORGL      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGASVALTPVLLVDGADVTTAADKLASVSVNTEIVEHTKGPK
RL21_CORGB      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGASVALTPVLLVDGADVTTAADKLASVSVNTEIVEHTKGPK
RL21_BACTN      MYAIVEINGQQFKAEAGQKLFVHHIEAENGSTVEFEKVLLVDKDGNVVGAPTVEGAKVVCQVISNLVKGD
RK21_STAPU      -YAIIEAGGEQLQVQPGRRLNVPVTEFWENRKIVFSRVLMIRSESTFLGKPWLEHATVNGRIFHPRRGNK
RK21_PORPU      -YAIIEASGKQLWIEEGRYYDLNHIPVEPGQSIILGKVLLLNKDGHVLGHPCIEGAVIKATVMRHLRGXX
RL21_PROM0      LYAIAETSGQQFWFEVDRYYDIDRLNAKEKDKITLEKVLLLDKDSISVGKPYVKDAKIELEVVSHKRDKK
RL21_PERMH      MFAVIKTGGKQYRVEPGMLLKVEKLPADVGETVEIEASLI----KDDQGNIKTEG-KVEAEVVEHGKHKK
RL21_NOCSJ      MYAIVRAGAKQQKVAVGDVIEIDQVETAAGEKVTLPVVLVVDGETVTSDAKKLDKASVTAEVLGGTKGPK
RL21_GLUDA      MFAVIRTGGKQYRVSPDTVLKVEKLDAEAGATVTFTDVLAVGGESTTIGAPLXXXXXXXXXXIAQDRLDT
RL21_EHRCR      MFAIVETGGKQYKVKEQDVIKIEKLNASVGEEVTLDKVIALADVNNNI--VFTHNAIVTASVLEQCRNDK
RL21_CYAP8      -YAIIEAGGQQLKVEPGRFYDINYLGVDPDSDYTIDKVLLINEDDITVGQPYVEGATVEGTIVEHRR---
RL21_ACIC5      MYAVIRTGGKQYRVAPGDVLKIETAAANQDGQIEFSEVLAFSGETGSVVKP--GAAKVLASVEGEGRGDK
RL21_SYNJA      -YAIVETSGKQLWVEPGRFYDVDRLGTEENSPLALSQVLLINHEQVTLGHPYVPEAVVRARVLQHRRGNK
RL21_MYCLE      -YAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTTNAKALAKVAVTGKVLEHTKGPK
RL21_MYCLB      -YAIVKTGGKQYKVAVGDVVKIEKLDFEPGAKVSLPVTLVVDGATVTTNAKALAKVAVTGKVLEHTKGPK
RL21_HAEIN      MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSLMVVNGEDXXXXXXXXXXXXXXXXXXXQGRGEK
RL21_NAUPA      MYAVIKHGGKQYKVSVGDVLELDRIEAEPKSSIELNEVLLVKGDDTKIGAPTVEGAKVVAEV--------
RL21_BLOFL      MYAVFQIGSKQYYVRTGQVIFIDRVKLDIGNQIEFNQVLLIRDMKNIIGNPFIQNGKIIADILDHSLGXX
RK21_SPIOL      IFAVVVIGSRQYIVIPGRWIYTQRLKATVNDKIVLNKVLLVGTKSTYIGTPIVTNAAVHAVVEEQLLXXX
RL21_SYNPX      -YAIVEASGTQMWVQANRYYDVDRLHAEVDETIKLENVLMVKDSKTTLGQPFVKDATVALKVMAHRRGPK
RL21_METRJ      MFAVIKTGGKQYRVAANDTITIASLAGEAGEAVTFGEVLLFGAGATQVGAPTLSGISVTGEIVRHGR---
RL21_BRAJA      MFAVIKTGGRQYRVAPDDVLEVGKIEGEVGSIVQLNEVLVVGGDTPILGLPTVAGASVAVEV--------
RL21_BORBZ      MYALVEINGKQYKAIEGEFLKIDKISPVEKDKLEFNSVLLINKDGEVIGKPYVVNSLIRCTYKEXXXXXX
RL21_BORBU      MYALVEINGKQYKAIEGEFLKIDKISPVEKDKLEFNSVLLINKDGEVIGKPYVVNSLIRCTYKEXXXXXX
RL21_THEEB      -YAIIETGGKQLRVEPGRFYDVERLPIEPEGTIDLEQVLLVQTDSQVVGQPYVSGAVVSGTVMEHRRGPK
RL21_SYNY3      -YAIIEIGGTQIRVEPGRFYEINHLDAAPEDSXXXXXXXXXXGDNVTIGQPYVAGATVEGEILSHRRGRK
RL21_MYCUA      -YAIVKTGGKQYKVAVGDVVKVEKLESEPGAKVSLPVALVVDGAAVTSDADALAKVAVTGEVLEHVKGPK
RL21_MYCMM      -YAIVKTGGKQYKVAVGDVVKVEKLESEPGAKVSLPVALVVDGAAVTSDADALAKVAVTGEVLEHVKGPK
RL21_BORGA      MYALVEINGKQYKAIEGEFLKIDKISPIEKDKLEFNSVLLINKDGEIIGKPYVANSLIRCTYKEXXXXXX
RL21_BARQU      MFAVIKTGGKQYHXXXXXXXXXXXXIGNAGDVVEFNDILMVGQDNTIIGAPVVADALVTAEIIKQARARK
RL21_PASMU      MYAVFQSGGKQHRVSEGQVVRLEKLEVATGETVEFDSVMIVNGEDXXXXXXXXXXXXXXXXXXXXXRGDK
RL21_MYCSS      -YAIVKTGGKQYKVAVGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKAEDLAKVAVTGEVLEHTKGPK
RL21_MYCSK      -YAIVKTGGKQYKVAVGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKAEDLAKVAVTGEVLEHTKGPK
RL21_MYCSJ      -YAIVKTGGKQYKVAVGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKAEDLAKVAVTGEVLEHTKGPK
RL21_RHOSR      -YAIVKTGGKQYKVAVGDLVKVEKIEGEPGTAVSLAPVLVVDGSDLTTDADKLAKISVTGEVVEHTKGPK
RL21_RHOPB      MFAVIKTGGRQYRVVPDDVLEIGKIAGDVGTIIQLGEVLMLGGDTPVLGLPTVAGATVAAEVLQHKRGPK
RL21_RHOOB      -YAIVKTGGKQYKVAVGDLVKVEKIEGEPGTAVSLAPVLVVDGSDLTTDADKLAKISVTGEVVEHTKGPK
RL21_MYCMO      MFAIIETGGKQILVKKDDFIFIEKIEGEAGQN---XXXXXXXXXXXXIGTPFLKNATVTXXXXXXXXXXX
RL21_METNO      MFAVIKTGGKQYRVAANDVITIAKLEGEAGTAVTFGEVLLYGEGATQVGAPTVSGISVAGEIVAQKRGPK
RL21_PSEE4      -YAVIVTGGKQYKVAEGEFLKIEKLEVATGESVTFDRVLLVNGDDVTIGXXXXXXXXXXXXXXSQGR---
RL21_PARDP      MFAVLKTGGKQYRVQAGDVLRVEKLNAEAGDKVQFNDVLMI-----------------------------
RL21_COREF      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGASVALTPVLLVDGADVTTAADKLASVSVNTEIVEHTKGPK
RL21_CLAMS      VYAVVRAGGRQEKVEVGTIVTMDRVKNQQSGKVVLPAVLLVDGDTITTDAAKLADVTVSAEILNDLRGPK
RL21_CLAM3      VYAVVRAGGRQEKVEVGTIVTMDRVKNQQSGKVVLPAVLLVDGDTITTDAAKLADVTVSAEILNDLRGPK
RL21_ACIBL      MYAVIRAGSKQFRVSPGDVIKVDSAPHSESGKLEIADVLAVSNGQGKFGSP--ENATVTAEILGDGRGDK
RL21_SYNSC      -YAIVEASGTQIWLQPNRYYDIDRLQAEVDDTIKLENVLLVDGKGTTLGQPYVKDATVSLKVMAHRRGPK
RL21_RHOP2      MFAVIKTGGRQYRVVPEDVLEVGKIEGDVGTIVQLGEVLMLGGDTPLIGLPTVAGASVAAEV--------
RL21_PORGI      MYVIVDIQGQQMKVEQGRRLFVHHIDVESGASVEFDKVLLVDNNGAIVGSPLVEGAKVVCEVLTPLVKGD
RL21_PORG3      MYVIVDIQGQQMKVEQGRRLFVHHIDVESGASVEFDKVLLVDNNGAIVGSPLVEGAKVVCEVLTPLVKGD
RL21_MYCA9      -YAIVKTGGKQYKVAVGDLVKVEKIDSEPGSSVQLPVALVVDGATVTTDADKLAKVAVTGEIVEHTKGPK
RL21_METS4      MFAVIKTGGKQYRVAANDVITIGKLEGDAGTAVTFGEVLLYGDGATKVGAPTVAGVSVAGEIVAQTRGPK
RL21_CORU7      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGSAVALTPVLVVDGADLTSGDK-LENVAVNAEIVEHVRGPK
RL21_CHLSY      MYAIIRDRGMQYRVEPGQVLTIDLISAEPGSQIELGEVLLVGAEQVKVGSPLVEGAVVRAEV--------
RL21_CHLAA      MYAIIRDRGMQYRVEPGQVLTIDLISAEPGSQIELGEVLLVGAEQVKVGSPLVEGAVVRAEV--------
RL21_CAMJR      MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKELKVGAPFVAGAKVVLEVINHGXXXX
RL21_CAMJJ      MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKELKVGAPFVAGAKVVLEVINHGXXXX
RL21_CAMJE      MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKELKVGAPFVAGAKVVLEVINHGXXXX
RL21_CAMJD      MYAIIKHSGKQYKVSVGDDLKLDHFEAESKASIEVSEVLAINDKELKVGAPFVAGAKVVLEVINHGXXXX
RL21_CAMJ8      MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKELKVGAPFVAGAKVVLEVINHGXXXX
RL21_CAMHC      MYAIIKHSGKQYKVSEGDLLNLDHFAAEKKSIVEITDVLAINDGSLKVGAPFVEGAKVVLEVVNEGXXXX
RK21_PORYE      -YAIIEASGTQLWIEEGRYYDLNHIPVDPGQSIILGKVLLLNKNGEVLGRPCIEGVTIKATVMRHLRGXX
RL21_PSEPK      -YAVIVTGGKQYKVAEGEFLKIEKLEVATGESVTFDRVLLVNGEEVTIGXXXXXXXXXXXXXXSQGR---
RL21_PSEPG      -YAVIVTGGKQYKVAEGEFLKIEKLEVATGESVTFDRVLLVNGEEVTIGXXXXXXXXXXXXXXSQGR---
RL21_PSEP1      -YAVIVTGGKQYKVAEGEFLKIEKLEVATGESVTFDRVLLVNGEEVTIGXXXXXXXXXXXXXXSQGR---
RL21_NITWN      MFAVIKTGGRQYRVVPDDVLEIGKIAGEVGTIVQLGEVLVLGGDTPVLGAPTVAGASIAAEVLQHKR---
RL21_LEIXX      VYAVVRAGGRQEKVEVGTIVTMDRVKDGENGTIELAAVLLVDGDKITSDAKSLSKVTVTATVLEDLRGPK
RL21_CORDI      MYAIVKTGGKQYKVAEGDFVKVEKIEGEPGSSVALTPILLVDGADVTTKAADLAKVSVTAEIVEAVKGPK
RL21_CHLMU      -YAVVQTGNKQYQVRKGDVIDVELLDSEENKEVLFQEVLFVDGEKASVGSPTVGNAVVKGELISFVRGEK
RK21_GUITH      -YAIIEASGKQFWVEPGRFYDFNSLNVEPGDKIALTRVLLINDNGNIVGKPCLDNVKVEATVLGHLRGQK
RK21_CYAPA      -YAIIDIAGKQLWVEPKRYYSVNKINVEIGKKIALQRILLLSGEKIKIGQPFLNGISINAIILRHFLAPK
RK21_CYAME      -YAIVETCGKQYWFQPGRYYDINFINAEPGDKIIFHRVLWLQHQQLLIGRPFLPNTHVEATILQHLKSKK
RL21_PSEPW      -YAVIVTGGKQYKVAEGEFLKIEKLEIATGESVTFDRVLLVNGEEVTIGXXXXXXXXXXXXXXSQGR---
RL21_NITHX      MFAVIKTGGRQYRVVPDDVLEIGKIAGDVGTIVQLGEVLVLGGDTPVLGLPTVAGASVAAEVLQHKRGPK
RL21_GLUOX      MYAVIRTGGKQYRVAPESILKVEKLEAEAGSTITFTDVLMVGGEGTL-----------------------
RL21_BORAP      MYALVEINGKQYKAVEGEFLKIDKISPIEKEKLEFNSVLLINKDGEIIGKPYVINSSIKCTYXXXXXXXX
RL21_RHOPS      MFAVIKTGGRQYRVVPDDVLEVGKIEGEVGTIVQLGEVLMLGGDTPQLGLPTIAGASVAAEV--------
RL21_HYPNA      MFAVIKTGGKQYKVAEGDTIVIERLAAAAGETVTFDSVL-------------------------------
RL21_CORJK      MYAIVKTGGKQYKVAEGDLVKVEKIEGEPGSSVALTPVLVVDGANVTTGDK-LASVNVNAEIVEHVRGPK
RK21_ODOSI      -YAIVEISGRQFWIETGKYYDFNRIPTELGKEITLNRVLLLNNEEILIGKPYLESVTVKGKILEHLRGRK
RL21_MESSB      MFAVIKTGGKQYRVAANDTLLIERIAGEVGEIVQIGNVLAVGGENVTIGAPFXXXXXXXXXXXXQGR---
RL21_BACV8      MYVIVEINGQQFKAEEGKKLFVHHINAENGATVEFEKVLLVDNNGTVVGAPTVEGAKVVCEVVSPLVKGD
RL21_SYNS9      -YAIVEASGTQIWLQTNRYYDLDRLQADVDETLKLDNVLLVKDSKTTLGQPYVKDASVELKVMAHRRGPK
RL21_NOVAD      MFAIVRTGGKQYRVAAGDKIAVEKLAGEAGDKITLGEVLLAGGDSLADAAKVTVSAEIIAQAKSE-----
RL21_CLOAB      MYAVIATGGKQYKVQEGDAIYVEKIAAEVDSTIELNEVLAVSEDGLVLXXXXXXXXXXXXXXXXXXXXXX
RL21_CHLTR      -YAVIQTGNKQYQVRKGDVIDVELLDSEENKEVLFQDVLFTDGEKASVGAPTVGNAVVKGELVSFVRGEK
RL21_CHLTB      -YAVIQTGNKQYQVRKGDVIDVELLDSEENKEVLFQDVLFTDGEKASVGAPTVGNAVVKGELVSFVRGEK
RL21_CHLTA      -YAVIQTGNKQYQVRKGDVIDVELLDSEENKEVLFQDVLFTDGEKASVGAPTVGNAVVKGELVSFVRGEK
RL21_CHLT2      -YAVIQTGNKQYQVRKGDVIDVELLDSEENKEVLFQDVLFTDGEKASVGAPTVGNAVVKGELVSFVRGEK
RM21_DICDI      -FAVVHISGKQYKVIEGDIIMTDKIQVDVGEHIVLDKVLLVGKNETIIGKPIISNFKVHAYIEEQAK---
RL21_SYNPW      -YAIVEASGQQFWLQPNRYYDLDRLQADVDATVTLDNVLLVDATGTTLGKPYVKDASVELKVMAHRRGPK
RL21_PARL1      MFAVIRTGGKQYRVAKDDVLEVERNGGEAGDKIDLEVLMLGGGGTLKVGAPLVDGAKVKAEIVEHTR---
RL21_BUCCC      MYAILLDRNKQYKVTCGKIIRLEKIKMNIGEXXXXXXXXXLSKDKSFIGKPILSDVYIEGLISKHGREXX
RL21_ARTS2      VYAIVRAGGRQEKVSVGDFVTLNRVPGGAGSTIELPALLLVDGDKVTSAAADLAKVTVTAEILQDLRGPK
RL21_THERP      MYAVVRTGSKQYRVRVGDVIEVEKLPVEPGQAVTLEEVLLVERDXXXXXXXXXXXXXXXXXXXDQVKGPK
RL21_RHOP5      MFAVIKTGGRQYRVVPDDVLEIGKIAGDVGTIVQLGEVLVLGADTPVLGVPTVAGASVAAEV--------
RL21_PROAC      MYAIVRSGGRQHKVAVGDVVEIDKVADEAGSSIELTPLLVVDGESVTSDKDVLGKVKVTAEVLGETKGPK
RL21_ARTCA      VYAIVRAGGRQEKVSVGDFVTLNRVAGGAGSTIELPALLLVDGDKITTAAADLAKVTVTAEILQDLRGPK
RL21_SPHAL      MFAIVRTGGKQYRVAAGDKIAVEKIEGEAGDTVSLGDVLLAGDGGEV---KDAKGLTVSAEIIAQTR---
RL21_WIGBR      MYAIFKINGVQYKAKSGSVVCLNKISGDIGSTIEIKKIMALFNDEKIIGQPFIKNSRIIATIKKHINGKK
RL21_SYNR3      -YAIVEASGQQFWLQPNRYYDFDRLEGEVGDKVSLKEVLLVSGKAASLGQPYVKDAVVNLKVLAHRRGPX
RL21_SALTO      MYAIVKTGGKQYKVAEGDVIEVEKLAGTPGXXXXXXXXXXXXXXXXXXXXXKLAKVEVSGEIAAHTKGPK
RL21_SALAI      MYAIVKTGGKQYKVAEGDVIEVEKLAGAPGXXXXXXXXXXXXXXXXXXXXXKLAEVEVSGEIAAHTKGPK
RL21_HELPG      -YAIFKHGGKQYKVVEGDIVLLDKMDKEPKXXXXXXXXXXXSKEKLSFGKPFVNGAKIEAEVINEGRSKK
RM21_ARATH      VFAIVQIGSHQFKVSNGDSIFTEKLKFCDNDKLELTKVLLLGASQTIIGRPILPDATVHAVVEE------
RL21_HELPH      -YAIFKHGGKQYKVVEGDIVLLDKMDKEPKXXXXXXXXXXXSKEKLSFGKPFVNGAKIEAEVINEGRGKK
RL21_FRATW      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATT      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATO      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATN      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATM      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATH      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRATF      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_FRAT1      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAAGEVKIGAPTXXXXXXXXXXXXQGRHKK
RL21_EHRCJ      MFAVVETGGKQYKVKEQDVIRIEKLNASVGEEVTLSNVIALTDVNNNI--VFTQSATVTASVLEQ-----
RL21_DICT6      MFVVVETGGKQYKLSVGSTVRVEKLQANXXXXXXXXXXXXXXXXXXXIGQPYVEGAKVIAEVVKQDKYPK
RK21_CYACA      -YAIVKASGRQLWFEPGKYYNINYVHANPGDKIIFYKVLLLNTNSLLIGKPFVEKVEVHATI--------
RL21_HELPY      -YAIFKHGGKQYKVVEGDIVLLDKMDKEPKXXXXXXXXXXXSKEKLSCGKPFVNGAKIEAEVINEGRGKK
RL21_HELPS      -YAIFKHGGKQYKVVEGDIVLLDKMDKEPKXXXXXXXXXXXSKEKLSCGKPFVNGAKIEAEVINEGRGKK
RL21_FRASN      MYAVVASGGKQHRVAVGDVVDVELLSGEPGAAVNLPAVLLVDGESVTHDADALASXXXXXXXXXXXKGPK
RL21_ZYMMO      MFAIVRTGGKQYRVAAGDKIVVEKIAGEAGTTVSLEDVLLAGEGADL---QPVKGLTVSAEIIAQAKA--
RK21_MARPO      -YAIIETGGQQLRVEPGRFYNIRHFELEQNTKILIYRVLMIRQESTIMGHPWLKGAIVKGRILHSCLEKK
RL21_CAMFF      MYAIIKHGGKQYKVSEGDFLNLDHFEAEAKSNVEIDEVLAVNDGSLKVGAPFIXXXXXXXXXXXXXXXXX
RK21_PHATR      -YAIVEISGRQFWIETGKYYDFNRIPTELGKQITLNRVLLLNNEEILIGKPYLDSVKIKGKILEHLRGKK
RL21_SPHWW      MFAIVRTGGKQYRVAAGDKIVVEKLPGEAGSTVSLGDVLLAGEGAEL---KDVKGLTVSAEIIAQAK---
RL21_FERNB      MYAIVENGGKQYKVEVGHLLHTEKMNGGXXXXXXXXXXXXXXXXXXXXGKPYLTNVTITGIVVEHARARK
RL21_HELPJ      -YAIFKHGGKQYKVVEGDIVLLDKMNKEPKXXXXXXXXXXXSKEKLSCGKPFVNGAKIEAEVINEGRSKK
RL21_HELP2      -YAIFKHGGKQYKVVEGDIVLLDKMNKEPKXXXXXXXXXXXSKEKLSFGKPFVNGAKIEAEVINEGRGKK
RK21_CHAVU      -YAIIQMGGQQLQVQTGR--FYDTCDLKPDTKIIIYKVTMIHNSQLVIGKPWLHNAMIKGRILHSYRDNK
RL21_SYNJB      -YAIVETGGKQLWVEPGRFYEVDRLEVEENSPFDLSRVLLINHEQITLGHPYVSEAVVRARVLQHRRGDK
RL21_STRTR      -YAIIKTGGKQVKVEVGQAIYVEKI---------------------------------------------
RL21_HELAH      -YAIFKHGGKQYKVVEGDIVLLDKMNKEPKXXXXXXXXXXXSKEKLSCGKPFVNGAKIEVEVINEGRAKK
RL21_CHLPN      -YAVIQTGSKQYQVRSGDVIDVELLGEVASDKVIFQDVLFVDGTKASLGSPTIANAQVKA----------
RK21_GRATL      LYAIIEADGKQMWIEPGKYYDVNYIPGEPGDYIQFNKVLVLRQENDIVGKPCIQXXXXXXXXXXXXXXXX
RL21_HYDS0      MYAVIETGSKQYLVKEGDVLKVEKLPFGENEEIELPALNIV-KDGTV-----KFGGKVKAKVLSTAKDKK
RL21_KOCRD      VYAIVRAGGRQEKVSVGDLVTLDRVAGEAGSTVELPALLLVDGDKVTSDSKTLADVKVTAEIIEDLRGPK
RL21_ELUMP      MYAIIETGGKQYWVKPGQNLQVERLNAEVGANVEV-KVLWANDAESADAKAGTDSAKVTAQVVRHLRGXX
RL21_BRASB      MFAVIKTGGKQYRVAPDDVLEIGKIDGEPGTIVQLNEVLVVGGD--------------------------
RK21_THAPS      -YAIVEISGRQFWIETGKYYDLNRIPTELEKEIILNRVLLANNDEILIGKPYLDSVKVKGKILEHLRGRK
RL21_WOLTR      MFAVIETGGKQYLVKKGSVIXXXXXXXXXXXXXXIDKAVCLSGN----GLSYLTDATVKAEVLEQCRGEX
RL21_THEFY      MYAIVRAGGRQEKVSVDDVVTIDRVAKEAGDTLNLEPLLVVDNGKVVSDAAELNKYQVTAEVLGEVTGPK
RL21_STRGR      MYAIVRSGGRQHKVAVGDIVEVDKISAKVGDTVELSTLLVVDGDAVTSDPWVLDGIKVTAEI--------
RL21_STRGG      MYAIVRSGGRQHKVAVGDIVEVDKISAKVGDTVELSTLLVVDGDAVTSDPWVLDGIKVTAEI--------
RL21_ANAMM      MFAVVEAGGKQYKVKESYVIKVELMDVSVGEKVKLDSLATFGGKK-------------------------
RK21_HUPLU      -YAVIETGGEQLRVEPGRFYDVRHFNLGPNSKILIYRVLMICDESTIIGHPWLKGAMIKGRILHSRLDNK
RL21_SOLUE      MHAIIETGGKQYRVAPGDVIRVEKLAGDIGSEIELPKAAFKEGGELVSG-------KVTGTIVGADRAAK
RL21_FRASC      MYAVVASGGKQHRVAVGDVVDVELLSGEPGAAVNLPALLLVDGESVTHDADALXXXXXXXXXXXXXKGPK
RL21_FRAP2      MYAIIKNGGKQYXXXXXXXXXXXXFDLGIGEKVEFDTVLMTAEGEVKIGAPIXXXXXXXXXXXXXXRNKK
RK21_PHYPA      MYAIIETGGEQLRVEPGRFYDIRHFXXXXXTKILIYRVLMIRNETTIIGQPWLKNAVIKGRILHSHLENK
RL21_STRAW      MYAIVRSGGRQHKVAVGDIVEVDKISAQVGDTVELSTLLVVDGDAVTSDPWVLAGIKVQAEV--------
RL21_LEPBP      MFAIIELGAKQFKVSPDQVFVAEKTGNTVGSTVETKVLLLSDNNKVNIGSPALSGAKVTLKVLEDCKGEK
RL21_LEPBA      MFAIIELGAKQFKVSPDQVFVAEKTGNTVGSTVETKVLLLSDNNKVNIGSPALSGAKVTLKVLEDCKGEK
RK21_GALSU      -YAIIENSGRQFFTEPGKFIDINHIKAEVGDIIYFNRVLLLKSNNLIIGYPFINNIKVKAKILKHFKDKK
RL21_STRCO      MYAIVRSGGRQHKVAVGDIVEVDKISGKVGDTVELSTLLVVDGDAVTSDPWVLAGIKVQAEI--------
RL21_PSYWF      MYAVIKSGGKQHRVNVDXXXXXXXXXXXXXXTIKIEDVLMVDGDDYKIGQPXXXXXXXXXXXXXHGRGXX
RL21_RHOPT      MFAVIKTGGRQYRVVPEDVLEVGKIDGDVGSIIQLGEVLVLGGDTPVL----------------------
RL21_RHOPA      MFAVIKTGGRQYRVVPEDVLEVGKIDGDVGSIIQLGEVLVLGGDTPVL----------------------
RL21_KINRD      VYAIVRAGGRQEKVAVGDVLTIDRVPVASGETLQLQPLLLVDGETVTHDASALXXXXXXXXXXXXXXXPK
RM21_MOUSE      LFAVVHFASHQWKVTAEDLILIEELDIKCGERIRLEKVLLVGADNTLLGKPLLELVRVEATV--------
RK21_ZYGCR      -YAIIEAGGEQLQVEPGRFYNIRHLSLRQNTKLLLYRVLMIRHQSTVLGNPWVQNATVKGRILDARRDDK
RL21_TROWT      MFAVVKASGFQRLVEVGSVISIDPTNVDSGGFVHFPVLLLVDGAEVVSDPDKLRLARVSAKFLRKLRGPK
RL21_RUBXD      MYAVVKSGGKQYRVRQGDELLVERLAGEVGDRV-------------------------------------
RL21_PROMT      -YAIVEASGKQFWLQPNRYYDFDRCQAEVDDVLTLENVXXXXXXXXXXXXPYVKDAKVEIKVLEHRRGPK
RL21_PROM2      LYAIAETSGQQFWFEVNRYYDIDRLKAKEXXXXXXXXXXXXXXXXSIVGKPYVKDAKIELEVVSHKRDKK
RL21_PROM1      -YAIVEASGKQFWLQPNRYYDFDRCQAEVDDVLTLENVXXXXXXXXXXXXPYVKDAKVEIKVLEHRRGPK
RL21_CAMLR      MYAIIKHSGKQYRVSQGDELKLDRFXXXXXXXXXXXXXLAVCDKELKVGAPFVAGAKVVLEVIAHGXXXX
RL21_TROW8      MFAVVKASGFQRLVEVGSVISIDPTNVDSGGFVHLPVLLLVDGAEVVSDPDKLRLARVSAKFLRKLRGPK
RL21_NEOSM      MLAVVEQGSKQYLVRKGQVISVEKISAEPGKEVEISCVKCVLDEE---ARPHFGVGTVKAKVLAQERGEK
RK21_EMIHU      -YAIVEACGKQMWIEEGKFYDFDKLPFSKGDVFSLSDILLVKDDSAEIGQPYLDKYSVELRVLQHFSGPK
RL21_PARD8      MYVIVEINGQQFKAEQGKKLFVHHINAESGAVVEFDKVLLVDNNKVVVLSPLVKGDKVLVFHKKRRKG--
RM21_BOVIN      LFAVVHFASHQWKVTSEDLILIEKLDIACGERIRMEKVLLVGADDTLLGRPLLDLVRVEATV--------
RL21_ANAPZ      MFAVVETGGKQYKVKEQDVIKVELLKAGIGEKVLLKSLATFNND--------------------------
RK21_PSINU      -YAIIETGGEQLRVEPGR-FYDARCFASANAKILIHRVLMIRRESTTLGHPWLRNAIVRGRILHSCYGEK
RK21_ADICA      -YAIIDIGGKQLRVQPGRFYFPSNLNTRGSDKVSMGRVLLIDGSKIDIGSPWLANAVVKGRI--------
RM21_HUMAN      LFAVVHFASRQWKVTSEDLILINELDLACGERIRLEKVLLVGADNTLLGKPLLDLVRVEATV--------
RL21_WOLPP      MFAVIETGGKQYLVKKGSIIKVERLQAXXXXXXXXXXXXCVSNN----GLSCSSNAVVKAEVLEQCXXXX
RL21_OPITP      MKATIKTQGQQFTVSEGDILTVNRYNTEAGATVEISEVLATGGENFRVGTPTLAGAIVSAKILENKR---
RL21_PROMP      LYAIAETSGQQFWFEVDKYYDIDRLNAXXXXXXXXXXXXXXXXXXNILGQPYVKNAKIELEVVSHKRDKK
RL21_PELLD      MQALIEISDKQYLVKKGDTLFVPRQQTAIGDTMEISSMATIDGANTVLN----PAVSVKAKVLGHXXXXX


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXHQHTKQGHRQPYTKVVIDAINA
RL21_LACS1      XXXXXXXXXXHQHTKQGHRQPYTKVVIDAINA
RL21_LACF3      XXXXXXXXXXHTHTKQGHRQPYTKVTIDAINA
RL21_LACPL      VVTFKYKAKKGQHTKKGHRQPYTKVTIDTINA
RL21_LACRJ      XXXXXXXXXXHTHTKQGHRQPYTKVTINKINA
RL21_LACRD      XXXXXXXXXXHTHTKQGHRQPYTKVTINKINA
RL21_STRU0      XXXXXXXXXXGSHRKQGHRQPYTKIVIDAINA
RL21_PEDPA      XXXXXXXXXXNQHTKTGHRQPYTKVMIDSINA
RL21_STRTD      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRT2      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRT1      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_ENTFA      VVTFQYKPKKHSHRKQGHRQPYTKVMIEAINA
RL21_LISMO      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_LISMH      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_LISMF      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_STRGC      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_LISMC      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_LISW6      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_LISIN      XXXXXXXXXXXXXXXQGHRQPYTKLTIDAINA
RL21_GEOKA      XXXXXXXXXXNYRRKQGHRQPYTKVVIEKINA
RL21_BACSU      ITVFRYKPKKNVHKKQGHRQPYTKVTIEKINA
RL21_GEOTN      XXXXXXXXXXNYRRKQGHRQPYTKVVIEKINA
RL21_GEOSW      XXXXXXXXXXNYRRKQGHRQPYTKVVIEKINA
RL21_BACWK      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACHK      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACCZ      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACCR      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC4      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC3      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC2      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC0      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACAN      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACAH      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACAC      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACAA      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_STACT      ITVFTYRRRKDSKRKKGHRQPYTKLTIDKINA
RL21_BACA2      ITVFRYKPKKNVHKKQGHRQPYTKLTIEKINA
RL21_STAAW      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAU      ITVFTYKRRKNSXRKKGHRQPYTKLTIDKINA
RL21_STAAT      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAS      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAR      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAN      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAM      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAE      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAC      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAAB      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAA9      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAA8      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAA3      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAA2      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_STAA1      ITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
RL21_LACLA      VVTFQYKPKKHSHRKQGHRQPYTKVVIKSVNA
RL21_BACSK      XXXXXXXXXXNYRRKQGHRQPYTKVVIGKIN-
RL21_STRMU      XXXXXXXXXXXSHRKQGHRQPYTKVVIKAINA
RL21_STAES      ITVFTYKRRKDSKRKKGHRQPYTKLTIDKINA
RL21_STAEQ      ITVFTYKRRKDSKRKKGHRQPYTKLTIDKINA
RL21_BACCQ      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACCN      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC7      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_BACC1      XXXXXXXXXXXXXXXQGHRQPYTKLVVEAINA
RL21_LACLS      VVTFQYKPKKHSHRKQGHRQPYTKVVIKSVNA
RL21_LACLM      VVTFQYKPKKHSHRKQGHRQPYTKVVIKSVNA
RL21_STAS1      ITVFTYKRRKDSKRKKGHRQPYTKLTIDKINA
RL21_BACLD      ITVFXXXXXXXXXXXQGHRQPYTKVVIEKINA
RL21_STAHJ      ITVFTYKRRKDSKRKKGHRQPYTKLTIDKIKA
RL21_LYSSC      XXXXXXXXXXNYRRKQGHRQPYTKLVVEAINA
RL21_STRSV      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_OCEIH      IDVHKFKPKKNYHRKQGHRQPYTKLVIDKINA
RL21_LACSS      XXXXXXXXXXXXXXXXXXRQPYTKVMIDAINA
RL21_STRZT      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRZJ      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRR6      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRPN      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRPJ      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRPI      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRP7      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRP2      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_STRZP      XXXXXXXXXXXSHRKQGHRQPYTKVVINAINA
RL21_BACP2      ITVFXXXXXXXXXXXQGHRQPYTKVVIEKINA
RL21_MACCJ      ITVFXXXXXXXXXXXQGHRQPYTKLVIEAINA
RL21_EXISA      ITVFKMKAKKNYRRKQGHRQPYTKVRIEKIEA
RL21_LACBA      XXXXXXXXXXGQHTKKGHRQPYTKVVVDAINA
RL21_EXIS2      ITVFKMKAKKNYRRKQGHRQPYTKVRIEKIEA
RL21_STRPZ      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPM      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPG      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPF      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPD      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPC      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRPB      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRP8      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRP6      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRP3      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_STRP1      XXXXXXXXXXGSHRKQGHRQPYTKVVINAINA
RL21_BACHD      XXXXXXXXXXNYRRKQGHRQPYTKVVIEKINA
RL21_STRS7      XXXXXXXXXXGSHRKQGHRQPYTKVVINAIKA
RL21_STREM      XXXXXXXXXXGSHRKQGHRQPYTKVVINAIKA
RL21_STRE4      XXXXXXXXXXGSHRKQGHRQPYTKVVINAIKA
RL21_LACDB      XXXXXXXXXXXXXXXXGHRQPYTKVTVKSIEA
RL21_LACDA      XXXXXXXXXXXXXXXXGHRQPYTKVTVKSIEA
RL21_ALKOO      XXXXXXXXXXDYRRKQGHRQPYTKLVIEKINA
RL21_DESHY      IIVFKMKSKKNYRRKQGHRQPYTKVVVEAIQA
RL21_DESHD      IIVFKMKSKKNYRRKQGHRQPYTKVVVEAIQA
RL21_MYCA5      IVVYRHNAKSTHKRKLGHRQPYTRVKI-----
RL21_RALEJ      VKIFKMRRRKHYQKRQGHRQNYTELRIEAINA
RL21_MYCCT      IRVIRYHPKKNVNKIYGHRQPYTKVKIEEISA
RL21_UREPA      XXXXXXXXXXHHLKRQGHRQPYTQLVIDSIS-
RL21_UREP2      XXXXXXXXXXHHLKRQGHRQPYTQLVIDSIS-
RL21_DICNV      VTIIKFRRRKHSMKRQGHRQNYTEIVIDTIN-
RL21_UREU1      XXXXXXXXXXHHLKRQGHRQPYTQLVIDSIS-
RL21_MYCMS      IRVIRYHPKKNVNKIYGHRQPYTKVKIDEISA
RL21_STRA5      XXXXXXXXXXXXHRKQGHRQPYTKVVINAINA
RL21_STRA3      XXXXXXXXXXXXHRKQGHRQPYTKVVINAINA
RL21_STRA1      XXXXXXXXXXXXHRKQGHRQPYTKVVINAINA
RL21_MYCHJ      IVVYRHNPKSTHKRKLGHRQLFTKVKI-----
RL21_MYCH7      IVVYRHNPKSTHKRKLGHRQLFTKVKI-----
RL21_DESAD      XXXXXXXXXXXSQTKQGHRQDYTRIKVEAIQA
RL21_THICR      VTIIKFRRRKNRRTKQGHRQNYTEVEITGISA
RL21_DESDG      VITFRKWRRNDSRKKQGHRQDYTALKIKTITA
RL21_LACH4      XXXXXXXXXXXXXXXXGHRQPYTKVTVEKIEA
RL21_RALEH      VKIFKMRRRKHYQKRQGHRQNYTELRIEAIVA
RL21_LACJO      XXXXXXXXXXHSHTKYGHRQPYTKVTIESIEA
RL21_LACAC      XXXXXXXXXXXXXXXXGHRQPYTKVTVEKIEA
RL21_CUPTR      VKIFKMRRRKHYQKRQGHRQNYTELRIEAIVA
RL21_CLOD6      XXXXXXXXXXDYRRKQGHRQSYTKIVVEKINA
RL21_AZOSB      VKIFKMRRRKHYQKHQGHRQNYTELRIEAISA
RL21_RALME      VKIFKMRRRKHYQKRQGHRQNYTELRIEAIVA
RL21_DESAP      II