[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99824.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
  692::847     2e-08  28% 1276 aa  PHY2_SYNY3 RecName: Full=Phytochrome-like protein cph2;AltName:
  357::490     2e-07  23%  507 aa  YCGG_ECOLI RecName: Full=Uncharacterized protein ycgG;
  635::793     7e-07  31%  800 aa  YKOW_BACSU RecName: Full=Signaling protein ykoW;
  433::637     2e-06  26%  651 aa  YHJK_ECOLI RecName: Full=Protein yhjK;
  420::649     3e-06  24%  661 aa  GMR_ECOLI RecName: Full=Protein gmr;
  556::759     4e-06  23%  809 aa  Y091_CAUCR RecName: Full=Uncharacterized signaling protein CC_0091;
  384::501     6e-06  30%  532 aa  YOAD_ECOLI RecName: Full=Uncharacterized protein yoaD;
  622::770     8e-06  25%  782 aa  YLIE_ECOLI RecName: Full=Uncharacterized protein yliE;
  358::515     8e-06  26%  516 aa  YLAB_ECOLI RecName: Full=Uncharacterized protein ylaB;
  612::734     1e-05  29%  747 aa  YFGF_ECOLI RecName: Full=Inner membrane protein yfgF;
  272::500     2e-05  25%  518 aa  RTN_ECOLI RecName: Full=Protein rtn;
  581::806     3e-05  24%  827 aa  Y4LL_RHISN RecName: Full=Uncharacterized protein y4lL;
  599::715     1e-04  26%  735 aa  Y3085_AZOC5 RecName: Full=Uncharacterized protein AZC_3085;
  388::503     1e-04  27%  528 aa  YJCC_ECOLI RecName: Full=Uncharacterized protein yjcC;
  605::725     1e-04  28%  729 aa  YFEA_ECOLI RecName: Full=Uncharacterized protein yfeA;
  553::628     2e-04  34%  635 aa  SYT_RICAH RecName: Full=Threonyl-tRNA synthetase;       
  590::763     4e-04  24%  791 aa  MBAA_VIBCH RecName: Full=Biofilm architecture maintenance protein
    3::127     5e-04  30%  211 aa  SERB_METJA RecName: Full=Phosphoserine phosphatase;       
  670::747     5e-04  36%  880 aa  KINH_BOTFU RecName: Full=Kinesin heavy chain;
  185::346     7e-04  22%  362 aa  YAHA_ECOLI RecName: Full=Cyclic di-GMP phosphodiesterase yahA;     
  299::447     7e-04  29%  485 aa  GATB_BORBZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
  299::447     7e-04  29%  485 aa  GATB_BORBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIAPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLE
PHY2_SYNY3      ----------------------------------------------------------------------
YCGG_ECOLI      ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YHJK_ECOLI      ---------------------------------EVLLRIQQPDGLPDGLIDRI---ECCGLMVTHWVLEE
GMR_ECOLI       ---------DQLVIHYQPKITWRGE----VRSLEALVRSPERGLIPPLDFISYAEESGLIVPLGRWVILD
Y091_CAUCR      ------IADNELIVHYQPLARAADG---EVCGFEALVRWKHRGMIPPLDFIPVAEENGLIEALGDWV---
YOAD_ECOLI      ----------------------------------------------------------------------
YLIE_ECOLI      ----------------------------------------------------------------------
YLAB_ECOLI      ----------------------------------------------------------------------
YFGF_ECOLI      ----------------------------------------------------------------------
RTN_ECOLI       ------IKREQFYVAYQPVV---DTQALRVTGLEVLLRWRHPVAIPPDAFINFAESQKMTQHLFELIAAE
Y4LL_RHISN      ------LAKGELEVRYQPLA---NLRTGQITTFEALARHPERGQVSPAEFIAVAEETGLIGPLGEWILRQ
Y3085_AZOC5     ----------------------------------------------------------------------
YJCC_ECOLI      ----------------------------------------------------------------------
YFEA_ECOLI      ----------------------------------------------------------------------
SYT_RICAH       ------------------------------------------------------------------YALE
MBAA_VIBCH      -----------------------------------------------------------SKAFQEISTLQ
SERB_METJA      ---------------------------------------KKKKLILFDFDSTLVNNETIDEIAREAGVEE
KINH_BOTFU      ----------------------------------------------------------------------
YAHA_ECOLI      --------------------------------------------------------------------MP
GATB_BORBZ      ----------NLKLIELPFARIRLKGQYGLSDFDVITLTADKHLLK--YFEEAVINSSDPKKVANWILSE
GATB_BORBU      ----------NLKLIELPFARIRLKGQYGLSDFDVITLTADKHLLK--YFEEAVINSSDPKKVANWILSE


                         .         .         *         .         .         .         .:140
query           IKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGY
PHY2_SYNY3      -----TGRRLRMAVNISARQFQDESVLECLKRTGMPPEDLELEITESLMMEDI--KGTVVLLHRLREEGV
YCGG_ECOLI      ---------------------------NFRDSFTRRDLNLVLEVTER--EPLNVDESLVQRLNILHENGF
YKOW_BACSU      -----------VAINISARQFLIPLIKDTLNKYQLPPQLLEVEVTESMTMDLNHSKKVLSS---LTELGI
YHJK_ECOLI      SCRLLAAWQERLSVNLSALQLMHPNVADMLELLTRYRIQLILEVTE--SRRIDDPHAAVAILRPLRNAGV
GMR_ECOLI       VVRQVADKGIRVAVNISARQLADQTIFTALKQVLELNFEIDVELTESCLIEND--ELALSVIQQFSQLGA
Y091_CAUCR      LRRACADKPLRIAVNLSPIQLHNPALPTLVHEVLITTSRLELEITE--SALFKDYQRALDNLRRLKALGV
YOAD_ECOLI      -------------------------------------QQLILEITER--------DALLDVARELHRKNV
YLIE_ECOLI      -------------INVSPWQLNEPHFHERFTTIMKENNSLCVEITETVIERINEHFYL--NIEQLRKQGV
YLAB_ECOLI      -----------ISINLESPVLTSEKIPQLLRDMINHYQQIALELTER---EFADPKTSAPIISRYREAGH
YFGF_ECOLI      --------------------------------------QLIFEVTES-NALTNVKQAQI-TLQHLQELGC
RTN_ECOLI       LEKVLP-VGVKFGINIAPDHLHSESFKADIQKLLTHHFQIVLEITER---DMLKEQEATQLFAWLHSVGV
Y4LL_RHISN      AEAVKWPPYVSVAVNLSPLQFRNQRLASTVRNSLEDTSRLQLEITESVL--LEECDSNLQTLKEIRQLGV
Y3085_AZOC5     -------------------------------------QCVCFELTE--SAILNQPEIAIETLSRLRALGC
YJCC_ECOLI      -------------------------------------QQIKFEVTEHAFLDVDKMTPIILA---FRQAGY
YFEA_ECOLI      -------------------------------------QAVILEITEE--QAFSNAESSMYNIEQLHKFGF
SYT_RICAH       VQKALIDNGVRTDINISPDKINYKIREFYIGKQEQENKQVTIRRLRTTEQEVLSLEQLITLIK-------
MBAA_VIBCH      ---AIVKEPIQVSINLSSAELNSLKLAQFIHRQAEQFGVSPAWIDFEITETFAADSQSFPLLHELSRLGY
SERB_METJA      EVKKITKEAMEGKLNFEQS----------LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGY
KINH_BOTFU      -----------------------------LEKAYSNNQDIKVELVEDLKKEVAQKSAEIEKFKAVEDLQQ
YAHA_ECOLI      VKHLLPDN-FHIGINVSAGCFLAKECLNLVNKLGNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITF
GATB_BORBZ      VLSVLNDKGISVEFNLLP---------SYITELVEFAGKISGKMAKRVFSEM-MTRGVSASVV-ISENQL
GATB_BORBU      VLSVLNDKGISVEFNLLP---------SYITELVEFAGKISGKMAKRVFSEM-MTRGVSASVV-ISENQL


                         +         .         .         .         .         *         .:210
query           RVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDD
PHY2_SYNY3      QVAIDDFGTGYSSLSILKQ--LPIHRLKIDKSFVNDLLNEG-ADTAIIQYVIDLANGLNLETVAEGIESE
YCGG_ECOLI      VIALDDFGTGYSGLSYLHD--LHIDYIKIDHSFVGRVNADPESTRI-LDCVLDLARKLSISIVAEGVETK
YKOW_BACSU      RISIDDFGTGHSSLSYLKD--FPIHRLKIDKSFIDDIQTHPKSEQ-ITGAIIAMGHQLSLQVIAEGVE-N
YHJK_ECOLI      RVALDDFGMGYAGLRQLQHKSLPIDVLKIDKMFVEGLPGDSS----MIAAIIMLAQSLNLQMIAEGVETE
GMR_ECOLI       QVHLDDFGTGYSSLSQLARF--PIDAIKLDQ-VFVRDIHKQPVSQSLVRAIVAVAQALNLQVIAEGVESA
Y091_CAUCR      RIAMDDFGTGFSSLSTLQS--FPFDKIKIKSFVENIHRHDRATA--IVRAVLGLGRSLEIPVVAEGVETE
YOAD_ECOLI      KLAIDDFGTGNSSFETLRPDVLKIDKSFTAAI--GSDAVNSTVTDIIIA----LGQRLNIELVAEGVETQ
YLIE_ECOLI      RISIDDFGTGLSNLKRFYEI--NPDSIKVDSQ-FTGDIFGTAGKIVRII--FDLARYNRIPVIAEGVESE
YLAB_ECOLI      EIYLDDFGTGYSSLSYLQDLDVDILKIDKSFV----DALEYKNVTPHI---IEMAKTLKLKMVAEGIETS
YFGF_ECOLI      QIAIDDFGTGYASYKNVNADLLKIDGSFIRNIVSN--SLDYQ----IVASICHLARMKKMLVVAEYVENE
RTN_ECOLI       EIAIDDFGTG-HSALIYLERFT-LDYLKIDRGFINAIGTETITSPV-LDAVLTLAKRLNMLTVAEGVETP
Y4LL_RHISN      IVAIDDFGTGYSSLSYLR--TFPFDKIKVD-RSFIADLPKSKESLAIVRAVAAIGRSLGIITTVEGVERQ
Y3085_AZOC5     TTAIDDFGTGYSSLSYLQRLPMDVLKIDRSFVL---DMVDNSRSREIVRVMIEMAHGLGMSVVAEGVETT
YJCC_ECOLI      EVAIDDFGIGYHNLKSLNVDILKIDKS------FVETLTTHKTSHLIAEHIIELAHSLGLKTIAEGVETE
YFEA_ECOLI      RIAIDDFGTGYANYKRLQADIIKIDGV------FVKDIVTNTLDAMIVRSITDLAKAKSLSVVAEFVE--
SYT_RICAH       ----------------------------------------------------------------------
MBAA_VIBCH      GLTIDDFGSGYTSIQLVQYPVQKIDRHFLDTLI-------ATNKQNVIRPLIDLCHSQSMKVTAEGIESE
SERB_METJA      VVAV--VSGG---FDIAVNKIKGLDYAFANRLIVKD----------------------------------
KINH_BOTFU      RVASNGTAPGSASGKTVQQQIAEFDVMKKSLM--------------------------------------
YAHA_ECOLI      --ALDDFGTGYATYRYLQAF--PVDFIKIDKSFVQMASVD-EISGHIVDNIVELARKPGLSIVAEGVETQ
GATB_BORBZ      EQVSDKFVIKQIVLEVLDENPKSIELYK------------------------------------------
GATB_BORBU      EQVSDKFVIKQIVLEVLDENPKSIELYK------------------------------------------


                         .         .         .         +         .         .         .:280
query           VAAKEMLCHNIKLQQGFFWQVPQDYISPKEVHNFxxxx
PHY2_SYNY3      AQLQRLQKMGCHLGQGYFLTRP----------------
YCGG_ECOLI      EQLDYLNQNYITFQQGYYFYKPVTYI------------
YKOW_BACSU      AAQKQLLCDHL---QGFFFSRP---IPPEQFEQF----
YHJK_ECOLI      AQRDWLAKAGVGIAQGFLFARP----------------
GMR_ECOLI       KEDAFLTKNGINERQGFLFAKPMPAVA-----------
Y091_CAUCR      --------------------------------------
YOAD_ECOLI      EQAKYLRRHGVHILQGYLYAQP----------------
YLIE_ECOLI      DVARELIKLGCVQAQGYLYQKPMPF-------------
YLAB_ECOLI      KQEEWLRQHGVHYGQGWLYSPKEDFLRWAEQH------
YFGF_ECOLI      EIREAVLSLGIDYMQGYLIGKPQPLI------------
RTN_ECOLI       EQARWLSERGVNFMQGYWISRP----------------
Y4LL_RHISN      DQLDTIKAEGFDEAQGYLFGGP----------------
Y3085_AZOC5     GALQILRQMGCDRAQGFLF-------------------
YJCC_ECOLI      EQVNWLRKRGVRYCQGWFF-------------------
YFEA_ECOLI      TQQQQALLHKLGVQQGYLIGRPQ---------------
SYT_RICAH       --------------------------------------
MBAA_VIBCH      TMHQWLADYECDYMQGFYFGYPMSLISP----------
SERB_METJA      --------------------------------------
KINH_BOTFU      --------------------------------------
YAHA_ECOLI      EQADLMIGKGVHFLQGYLYSPP----------------
GATB_BORBZ      --------------------------------------
GATB_BORBU      --------------------------------------