[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99890.1

[Show Plain Result]


## Summary of Sequence Search
    1::183
    4::180     1e-47  46%  185 aa  3MGA_HAEIN RecName: Full=DNA-3-methyladenine glycosylase;       
    3::179     2e-47  50%  187 aa  3MG1_ECOLI RecName: Full=DNA-3-methyladenine glycosylase 1;        
  786::972     2e-40  42% 1375 aa  GUAA_HELHP RecName: Full=Probable GMP synthase
   32::144     4e-04  31%  166 aa  RL10_BACP2 RecName: Full=50S ribosomal protein L10;
  901::996     5e-04  42% 2093 aa  L_ISFV RecName: Full=Large structural protein;       
   32::144     7e-04  29%  166 aa  RL10_BACLD RecName: Full=50S ribosomal protein L10;
    1::135     9e-04  31%  220 aa  AROD_METJA RecName: Full=3-dehydroquinate dehydratase;       
    1::183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKCAWIYGADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
3MGA_HAEIN      -RCPWV-GEQSIYIDYHDKEWGKPEFDSQKLFEKICLEGQQAGLSWITVLKKRESYREAFHQFDPKKIAK
3MG1_ECOLI      -RCGWV-SQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAA
GUAA_HELHP      VRCAWATDKDELYEDYHDTEWGEPLHEDKKLFEHLVLEGFQAGLSWITILKKREAFRVAFDDFDPHIVAN
RL10_BACP2      ------------------------------------------GLSVSEVTELRKQLRDAGVEFKVYKVEQ
L_ISFV          ---------------------------------------------WKVIYNRLKKLCTAFGN---PKIAQ
RL10_BACLD      ------------------------------------------GLNVAEVTELRKQLREANVEFKVYKVEQ
AROD_METJA      ---------------------------------MICLPVVEDSVE-KAIKTAEKYLEIAIVEFRIDMLKE


                         .         .         *         .         .         .         .:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHERNESLDSFFWGIINNQPIINNFKNPEEIPTKTK
3MGA_HAEIN      MTALDIDACMQNSGLIRHRAKLEAIVKNAKAYLAMEKCGENFSDFIWSFVNHKPIVNDVPDLRSVPTKTE
3MG1_ECOLI      MQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFVDFVWSFVNHQPQVTQATTLSEIPTSTS
GUAA_HELHP      YDEDKIKELMRNEGXXXXXXXXXXXXXXXXXFMAVQREFGSFDKYIWGFVGGKPIINAFESIADLPASTP
RL10_BACP2      VELTGLNDFLTGPNAIAFSN--EDVIAPAKIINEFAKSHEALEIKAGVIEGNVATVEEVKALAELPSREG
L_ISFV          FRYSHIEKLLEDPNLLRKRRTINSIVRDA--VTYIHSEDEKIRSYLWSI---------------------
RL10_BACLD      AELDGLNDFLTGPNAIAF--STEDVVAPAKVLNEFAKKHEALEIKAGVIEGKVSTVEEVKALAELPSREG
AROD_METJA      VSEEDIEKFAKYPCIITVRADWEAIECNAKFVDIREEKNKELVKFRDEIGSKTKIIISYHDFEKTPSKEK


                         +         .         .         .         .         *         .:210
query           LSEQISKTLKKMGFKFVGPTIVYSFMEASGMVNDHLVGCYGRN
3MGA_HAEIN      VSKALSKALKKRGFVFIGETTCYAFMQSMGLVDDHLNDC----
3MG1_ECOLI      ASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGC----
GUAA_HELHP      LSDKIAKDLKKRGFKFVGTTTMYAMMQSIGMVNDHLTSCFKCN
RL10_BACP2      LLSMLLSVLQ---------------------------------
L_ISFV          -------------------------------------------
RL10_BACLD      LLSMLLSVLQ---------------------------------
AROD_METJA      LVEIVEKAL----------------------------------