[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABD99944.1

[Show Plain Result]


## Summary of Sequence Search
    1::170
    1::163     9e-56  60%  169 aa  Y956_LISMF RecName: Full=Uncharacterized tRNA/rRNA
    1::168     1e-54  58%  169 aa  Y934_LISIN RecName: Full=Uncharacterized tRNA/rRNA
    1::156     3e-52  60%  157 aa  YGL3_BACST RecName: Full=Uncharacterized tRNA/rRNA
    5::162     1e-31  43%  166 aa  Y521_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
    3::151     2e-30  48%  157 aa  YIBK_ECOLI RecName: Full=Uncharacterized tRNA/rRNA
    3::151     2e-30  48%  157 aa  YIBK_ECOL6 RecName: Full=Uncharacterized tRNA/rRNA
    7::162     3e-29  41%  166 aa  Y346_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
    4::150     6e-29  45%  160 aa  Y766_HAEIN RecName: Full=Probable tRNA/rRNA methyltransferase
    4::148     3e-24  41%  153 aa  Y992_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
 1474::1612    2e-07  27% 1621 aa  TARB1_HUMAN RecName: Full=Probable methyltransferase TARBP1;       
  106::242     3e-05  28%  248 aa  TRMHL_STAAW RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAS RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAR RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAN RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAM RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAE RecName: Full=Putative trmH family tRNA/rRNA
  106::242     3e-05  28%  248 aa  TRMHL_STAAC RecName: Full=Putative trmH family tRNA/rRNA
  228::374     7e-05  28%  384 aa  Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
   30::165     4e-04  29%  229 aa  TRMH_SHIFL RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   30::165     4e-04  29%  229 aa  TRMH_ECOLI RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   30::165     4e-04  29%  229 aa  TRMH_ECO57 RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
  106::244     5e-04  25%  249 aa  TRMHL_STAS1 RecName: Full=Putative trmH family tRNA/rRNA
    1::170

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANHIVLFEPLMPANTGNIARTCAGTNTELHLIEPLGFSTDDKYMKRAGLDYWDKVKITYHPNLPAFLET
Y956_LISMF      MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK
Y934_LISIN      MPNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEFFEK
YGL3_BACST      MALHVVLFQPEIPANTGNIARTCAATNTALHLIRPLGFSTDDKMLRRAGLDYWEFVNIHYYDSLDHFFQQ
Y521_MYCPN      -AINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKVQMFEHKSWEHFIET
YIBK_ECOLI      ---NIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEA
YIBK_ECOL6      ---NIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEA
Y346_MYCGE      ---NIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHFLQA
Y766_HAEIN      ----IVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAFLES
Y992_SYNY3      ----LVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFELGDRYLKRAGLDYWPYVDLHYHNSCEEFIHW
TARB1_HUMAN     ------------PTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSSAEQWLPLVEVKPPQLIDYLQQ
TRMHL_STAAW     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAS     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAR     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAN     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAM     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAE     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
TRMHL_STAAC     ------------PHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
Y955_SYNY3      ------------PHNLGAIIRTAEAFGAQGMVLPQAGITSTVMKVAAGALEHFPVARVV---NLSRALET
TRMH_SHIFL      ------------PHNVSAIIRTADAVGVEVHAVWP-GSRMRTMASAAAGSNSWVQVKT--HRTIGDAVAH
TRMH_ECOLI      ------------PHNVSAIIRTADAVGVEVHAVWP-GSRMRTMASAAAGSNSWVQVKT--HRTIGDAVAH
TRMH_ECO57      ------------PHNVSAIIRTADAVGVEVHAVWP-GSRMRTMASAAAGSNSWVQVKT--HRTIGDAVAH
TRMHL_STAS1     ------------PHNLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIQHIPVMRVTNLANTIET


                         .         .         *         .         .         .         .:140
query           IPENGELYIVSKFASKAYTEADYTNTEKEHYFLFGKETTGLPEMFMRQNPEKCIRIPQNDEHIRALNLSN
Y956_LISMF      -NEGGEFYYITKFGRHVYSDIDYSDPNKDYFFVFGKETTGLPDALLQKNEENCLRIPMTD-HIRSLNLSN
Y934_LISIN      -NAGGEFYYITKFGRHVYSDVDYSDPNKNYFFVFGKETTGLPDELLQANEENCLRIPMTD-HIRSLNLSN
YGL3_BACST      -NQNGDFYYITKFGKRYYTSYDFSDPSKEIFFIFGRETTGLPKELLAENEDRCLRIPMT-ENVRALNLSN
Y521_MYCPN      TPPNKAIWLLTKSGTTTPDQINQTDNREQLYFVFGQETKGLPQTLMEQYSQNQVRIPIWNP-VRSINLSN
YIBK_ECOLI      --ENPQLFALTTKGTPAHSAVSYQDGD---YLMFGPETRGLPASILDALPEQKIRIPMVPDS-RSMNLSN
YIBK_ECOL6      --ENPQLFALTTKGTPAHSAVSYQDGD---YLMFGPETRGLPASILDALPEQKIRIPMVPDS-RSMNLSN
Y346_MYCGE      TTENKTIWLLTKSGDKTPDQICMTNLPNELYFVFGQETKGLPKTIMDNFKQNQIRIPIWNS-VRSINLAN
Y766_HAEIN      -EKPKRLFALTTKGCPAHSQVKF---KLGDYLMFGPETRGIPMSILNEMPEQKIRIPMT-ANSRSMNLSN
Y992_SYNY3      RGQGGNLLGFSVTGTVNFWDYTYQSTD---WLMMGSETDGLPQM-MRDLSTQLLCIPMPHSEVRXXXXXX
TARB1_HUMAN     KKTEGYTIIGVEQTAKSLDLTQYCFPEKS-LLLLGNEREGIPANLIQQL-DVCVEIPQQGI-IRSLNVHV
TRMHL_STAAW     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAS     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAR     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAN     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAM     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAE     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
TRMHL_STAAC     LKDNG-FWVAGTEANNA---TDYRNLEADMSLVIGSEGQGMSRLVS----DKCIKIPMVG-HVNSLNASV
Y955_SYNY3      LKESG-FWIYGTVAGKQ-TALHQADLREPMGLVIGSEGEGL-SLLTQKHCDHLITIPLAGK-TPSLNASV
TRMH_SHIFL      LKGQGMQILATHLSDNAFREIDYT---RPTCILMGQEKTGITQEALALADQDII-IPMIGM-VQSLNVSV
TRMH_ECOLI      LKGQGMQILATHLSDNAFREIDYT---RPTCILMGQEKTGITQEALALADQDII-IPMIGM-VQSLNVSV
TRMH_ECO57      LKGQGMQILATHLSDNAFREIDYT---RPTCILMGQEKTGITQEALALADQDII-IPMIGM-VQSLNVSV
TRMHL_STAS1     LKDNGYWIV----GTEAENSTDYREMDAGMPLVIGSEGQGMSRLVK----EKCINIPMVG-HVNSLNASV


                         +         .         .         .         .         *         .:210
query           TAAIVVYEALRQQGFPNLETTHTYENDKLK
Y956_LISMF      TAAILAYEALRQQNFGALLQEPNYD-----
Y934_LISIN      TAAVLAYEALRQQSFGALLQEPNYDRKIFK
YGL3_BACST      TAAILVYEALRQQSFHGL------------
Y521_MYCPN      TVACVLYEYAKQNHYFNLD-----------
YIBK_ECOLI      AVSVVVYEAWRQLGYP--------------
YIBK_ECOL6      AVSVVVYEAWRQLGYP--------------
Y346_MYCGE      AVVCILYEYSKQNQYSNLD-----------
Y766_HAEIN      SVAVTVYEAWRQLGY---------------
Y992_SYNY3      XXXXXXFEAGRQ------------------
TARB1_HUMAN     SGALLIWEYTRQQ-----------------
TRMHL_STAAW     AASLMMYEVFRKR-----------------
TRMHL_STAAS     AASLMMYEVFRKR-----------------
TRMHL_STAAR     AASLMMYEVFRKR-----------------
TRMHL_STAAN     AASLMMYEVFRKR-----------------
TRMHL_STAAM     AASLMMYEVFRKR-----------------
TRMHL_STAAE     AASLMMYEVFRKR-----------------
TRMHL_STAAC     AASLMMYEVFRKR-----------------
Y955_SYNY3      AAAISLYEIFRQRGFDRPTLSHT-------
TRMH_SHIFL      ASALILYEAQRQR-----------------
TRMH_ECOLI      ASALILYEAQRQR-----------------
TRMH_ECO57      ASALILYEAQRQR-----------------
TRMHL_STAS1     AASLMMYEVFRKRNY---------------