[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00014.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    1::228     1e-25  34%  229 aa  COMFC_BACSU RecName: Full=ComF operon protein 3;
    9::228     1e-05  23%  229 aa  COMF_HAEIN RecName: Full=Competence protein F;AltName: Full=DNA
  112::146     2e-04  43%  207 aa  PYRE_VESOH RecName: Full=Orotate phosphoribosyltransferase;        
  112::146     2e-04  43%  214 aa  PYRE_ACTSZ RecName: Full=Orotate phosphoribosyltransferase;        
  110::146     3e-04  41%  212 aa  PYRE_RUTMC RecName: Full=Orotate phosphoribosyltransferase;        
  117::218     3e-04  38%  227 aa  GNTX_SHIFL RecName: Full=Protein gntX;
  117::218     3e-04  38%  227 aa  GNTX_ECOL6 RecName: Full=Protein gntX;
  213::249     4e-04  43%  324 aa  KPRS2_ENTFA RecName: Full=Ribose-phosphate pyrophosphokinase 2;    
  117::218     4e-04  37%  227 aa  GNTX_ECOLI RecName: Full=Protein gntX;
  117::218     4e-04  38%  227 aa  GNTX_ECO57 RecName: Full=Protein gntX;
  112::146     5e-04  40%  213 aa  PYRE_ENT38 RecName: Full=Orotate phosphoribosyltransferase;        
  195::244     5e-04  40%  315 aa  KPRS_YERPE RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_SALTY RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_SALTI RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_PHOLL RecName: Full=Ribose-phosphate pyrophosphokinase;       
  196::245     5e-04  38%  315 aa  KPRS_HAEIN RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_ECOLI RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_ECOL6 RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  40%  315 aa  KPRS_ECO57 RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     5e-04  38%  315 aa  KPRS_BUCAI RecName: Full=Ribose-phosphate pyrophosphokinase;       
  196::245     8e-04  38%  315 aa  KPRS_PASMU RecName: Full=Ribose-phosphate pyrophosphokinase;       
  196::245     8e-04  36%  316 aa  KPRS_HAEDU RecName: Full=Ribose-phosphate pyrophosphokinase;       
  195::244     8e-04  36%  315 aa  KPRS_BUCBP RecName: Full=Ribose-phosphate pyrophosphokinase;       
  117::218     8e-04  33%  227 aa  GNTX_SALTY RecName: Full=Protein gntX;
  117::218     8e-04  33%  227 aa  GNTX_SALTI RecName: Full=Protein gntX;
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNCLLCNNTIDFKLNIKWILSLEKYKRDNVCKRCREELGKCKIDNACEGCGREQKKLLLCNDCXXXXXXX
COMFC_BACSU     MICLLCDS--QFSQDVTWRALFLLKPDEKVCYSCRSKLKKIT-GHICPLCGRPQSVHAVCRDCEVWRTRI
COMF_HAEIN      ------------------------------CIHCRGNLHIAK-NGLCSGCQKQIKSFPYCGHCGSELQYY
PYRE_VESOH      ----------------------------------------------------------------------
PYRE_ACTSZ      ----------------------------------------------------------------------
PYRE_RUTMC      ----------------------------------------------------------------------
GNTX_SHIFL      ----------------------------------------------------------------------
GNTX_ECOL6      ----------------------------------------------------------------------
KPRS2_ENTFA     ----------------------------------------------------------------------
GNTX_ECOLI      ----------------------------------------------------------------------
GNTX_ECO57      ----------------------------------------------------------------------
PYRE_ENT38      ----------------------------------------------------------------------
KPRS_YERPE      ----------------------------------------------------------------------
KPRS_SALTY      ----------------------------------------------------------------------
KPRS_SALTI      ----------------------------------------------------------------------
KPRS_PHOLL      ----------------------------------------------------------------------
KPRS_HAEIN      ----------------------------------------------------------------------
KPRS_ECOLI      ----------------------------------------------------------------------
KPRS_ECOL6      ----------------------------------------------------------------------
KPRS_ECO57      ----------------------------------------------------------------------
KPRS_BUCAI      ----------------------------------------------------------------------
KPRS_PASMU      ----------------------------------------------------------------------
KPRS_HAEDU      ----------------------------------------------------------------------
KPRS_BUCBP      ----------------------------------------------------------------------
GNTX_SALTY      ----------------------------------------------------------------------
GNTX_SALTI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPSKDWIYIPIPVDEYTMQHRGF
COMFC_BACSU     RDSLLLRSVYTYNDMM-KETLSRFKFRGDAEIINAFKSDFSSTFSKVYPDKHFVLVPIPLSKEREEERGF
COMF_HAEIN      AQHCGNCLKQSWDKMVIIGHYQRFKFQNQFWLARLLYLAVRDAKRTHQLKLPEAIIPVPLYHFRQWRRGY
PYRE_VESOH      ----------------------------------------------------------------------
PYRE_ACTSZ      ----------------------------------------------------------------------
PYRE_RUTMC      ----------------------------------------------------------------------
GNTX_SHIFL      -------------------------------------------------------ISVPLWQRRHWRRGF
GNTX_ECOL6      -------------------------------------------------------ISVPLWQRRHWRRGF
KPRS2_ENTFA     ----------------------------------------------------------------------
GNTX_ECOLI      -------------------------------------------------------VSVPLWQRRHWRRGF
GNTX_ECO57      -------------------------------------------------------ISVPLWQRRHWRRGF
PYRE_ENT38      ----------------------------------------------------------------------
KPRS_YERPE      ----------------------------------------------------------------------
KPRS_SALTY      ----------------------------------------------------------------------
KPRS_SALTI      ----------------------------------------------------------------------
KPRS_PHOLL      ----------------------------------------------------------------------
KPRS_HAEIN      ----------------------------------------------------------------------
KPRS_ECOLI      ----------------------------------------------------------------------
KPRS_ECOL6      ----------------------------------------------------------------------
KPRS_ECO57      ----------------------------------------------------------------------
KPRS_BUCAI      ----------------------------------------------------------------------
KPRS_PASMU      ----------------------------------------------------------------------
KPRS_HAEDU      ----------------------------------------------------------------------
KPRS_BUCBP      ----------------------------------------------------------------------
GNTX_SALTY      -------------------------------------------------------VSVPLWSRRHWRRGF
GNTX_SALTI      -------------------------------------------------------VSVPLWSRRHWRRGF


                         +         .         .         .         .         *         .:210
query           NQVEGLIGDLPYSRVLXXXXXXXXXXQSEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQ
COMFC_BACSU     NQAHLLAEDRPSHHPL---IRLNNEKQSKKKKTERLLSECIFDTKNNSAEGNIILIDDLYTTGATLHFAA
COMF_HAEIN      NQADLLSQDIPNLNNIVKRVKHTYTQRGLSAKDRRQNLKNAFSLAVSKNEFPYALVDDVITTGSTLNEIS
PYRE_VESOH      --------------------------------------------VGHSLEGNILIIDDVITAGTAIHEAV
PYRE_ACTSZ      --------------------------------------------IGSPLQGNVLLVDDVITAGTAIREAM
PYRE_RUTMC      ------------------------------------------DIVGHQLEGNILIIDDVITVGTAIIEAM
GNTX_SHIFL      NQSDLLCQ--PLSRWLHCQWDSEAVTRSARLRKRNLKNAFRLEL---PVQGRHVIVDDVVTTGSTVAEIA
GNTX_ECOL6      NQSDLLCQ--PLSRWLHCRWDSEAVTRSARLRKRNLKNAFRLEL---PVQGRHVIVDDVVTTGSTVAEIA
KPRS2_ENTFA     --------------------------------------------IGNVAGKKCILVDDILNTGQTLATAA
GNTX_ECOLI      NQSDLLCQ--PLSRWLHCQWDSEAVTRSARLRKRNLKNAFRLEL---PVQGRHVIVDDVVTTGSTVAEIA
GNTX_ECO57      NQSDLLCQ--PLSRWLHCQWDSEAITRSARLRRRNLKNAFRLEL---PVQGRHVIVDDVVTTGSTVAEIA
PYRE_ENT38      --------------------------------------------VGSELQGRIMLVDDVITAGTAIRESM
KPRS_YERPE      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_SALTY      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_SALTI      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_PHOLL      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_HAEIN      -------------------------------RRPRANVAQVMHIIGDVADRDCILVDDMIDTGGTLCKAA
KPRS_ECOLI      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_ECOL6      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_ECO57      -------------------------------RRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAA
KPRS_BUCAI      -------------------------------RRPRANVSQIMNIIGDVANRDCILVDDMIDTGGTLCKAA
KPRS_PASMU      -------------------------------RRPRANVAQVMHIIGDVAGRDCILVDDMIDTGGTLCKAA
KPRS_HAEDU      -------------------------------RRPKANVSQVMHIIGDVTDRDCILVDDMIDTGGTLVKAA
KPRS_BUCBP      -------------------------------RRPHINFSQVMHVIGEVFNRDCILVDDMIDTGGTLCQAA
GNTX_SALTY      NQSDLLCQPLAHQTITRVRATATQHHLSARLRKRNLKNAFRLEL---PVQGHMVIVDDVVTTGSTVAEIA
GNTX_SALTI      NQSDLLCQPLAHQTITRVRATATQHHLSARLRKRNLKNAFRLEL---PVQGHMVIVDDVVTTGSTVAEIA


                         .         .         .         +         .         .         .:280
query           ELLLKNGASRVCSVTLAR
COMFC_BACSU     RCLLEKGAASVSSFTLIR
COMF_HAEIN      KLLRKLGVEEIQVWGLAR
PYRE_VESOH      DIIKANGAT---------
PYRE_ACTSZ      DIIAANGAT---------
PYRE_RUTMC      SIIKANGAT---------
GNTX_SHIFL      QLLLRNGAATV-------
GNTX_ECOL6      QLLLRNGAATV-------
KPRS2_ENTFA     EVLMKNGAQEV-------
GNTX_ECOLI      QLLLRNGAAAV-------
GNTX_ECO57      QLLLRNGAATV-------
PYRE_ENT38      EIIQANGAS---------
KPRS_YERPE      EALKERGAKRV-------
KPRS_SALTY      EALKERGAKRV-------
KPRS_SALTI      EALKERGAKRV-------
KPRS_PHOLL      EALKERGAKRV-------
KPRS_HAEIN      EALKERGAKRV-------
KPRS_ECOLI      EALKERGAKRV-------
KPRS_ECOL6      EALKERGAKRV-------
KPRS_ECO57      EALKERGAKRV-------
KPRS_BUCAI      EALKERGAKRV-------
KPRS_PASMU      EALKERGAKRV-------
KPRS_HAEDU      EALKERGARRV-------
KPRS_BUCBP      EALKKRGARRV-------
GNTX_SALTY      QLLLRNGAATV-------
GNTX_SALTI      QLLLRNGAATV-------