[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00050.1

[Show Plain Result]


## Summary of Sequence Search
    1::50
    1::50      3e-27 100%   50 aa  RL332_LACS1 RecName: Full=50S ribosomal protein L33 2;
    3::49      3e-21  83%   49 aa  RL33_LACPL RecName: Full=50S ribosomal protein L33;
    3::49      6e-19  74%   49 aa  RL331_LACBA RecName: Full=50S ribosomal protein L33 1;
    2::49      9e-18  69%   49 aa  RL332_PEDPA RecName: Full=50S ribosomal protein L33 2;
    4::49      9e-18  74%   49 aa  RL332_LACDB RecName: Full=50S ribosomal protein L33 2;
    4::49      9e-18  74%   49 aa  RL332_LACDA RecName: Full=50S ribosomal protein L33 2;
    2::49      1e-17  65%   49 aa  RL331_LACRJ RecName: Full=50S ribosomal protein L33 1;
    4::49      3e-17  72%   49 aa  RL332_LACH4 RecName: Full=50S ribosomal protein L33 2;
    4::49      9e-17  70%   49 aa  RL332_LACC3 RecName: Full=50S ribosomal protein L33 2;
    5::49      1e-16  69%   49 aa  RL331_LEUMM RecName: Full=50S ribosomal protein L33 1;
    4::49      1e-16  67%   49 aa  RL331_LACJO RecName: Full=50S ribosomal protein L33 1;
    4::49      1e-16  67%   49 aa  RL331_LACGA RecName: Full=50S ribosomal protein L33 1;
    3::48      2e-16  67%   48 aa  RL331_LACF3 RecName: Full=50S ribosomal protein L33 1;
    4::49      3e-16  65%   49 aa  RL332_LACSS RecName: Full=50S ribosomal protein L33 2;
    2::49      4e-16  70%   49 aa  RL332_LISMO RecName: Full=50S ribosomal protein L33 2;
    2::49      4e-16  70%   49 aa  RL332_LISMF RecName: Full=50S ribosomal protein L33 2;
    2::49      4e-16  70%   49 aa  RL332_LISIN RecName: Full=50S ribosomal protein L33 2;
    2::49      4e-16  70%   49 aa  RL331_LISW6 RecName: Full=50S ribosomal protein L33 1;
    3::49      7e-15  67%   49 aa  RL331_OCEIH RecName: Full=50S ribosomal protein L33 1;
    2::48      6e-14  55%   48 aa  RL331_BACWK RecName: Full=50S ribosomal protein L33 1;
    4::50      1e-13  65%   50 aa  RL332_ENTFA RecName: Full=50S ribosomal protein L33 2;
    3::50      2e-13  65%   50 aa  RL332_STRA5 RecName: Full=50S ribosomal protein L33 2;
    2::49      2e-13  62%   49 aa  RL331_GEOTN RecName: Full=50S ribosomal protein L33 1;
    2::48      2e-13  53%   48 aa  RL331_BACC1 RecName: Full=50S ribosomal protein L33 1;
    2::48      2e-13  53%   48 aa  RL331_BACAN RecName: Full=50S ribosomal protein L33 1;
    4::49      2e-13  62%   49 aa  RL33_THETN RecName: Full=50S ribosomal protein L33;
    4::49      2e-13  62%   49 aa  RL33_THEP3 RecName: Full=50S ribosomal protein L33;
    4::50      2e-13  69%   50 aa  RL332_STRR6 RecName: Full=50S ribosomal protein L33 2;
    4::50      3e-13  63%   50 aa  RL332_STRPN RecName: Full=50S ribosomal protein L33 2;
    2::49      6e-13  60%   49 aa  RL33_CLOB8 RecName: Full=50S ribosomal protein L33;
    4::49      1e-12  58%   49 aa  RL33_CLOPH RecName: Full=50S ribosomal protein L33;
    6::50      1e-12  59%   50 aa  RL33_AQUAE RecName: Full=50S ribosomal protein L33;
    3::49      1e-12  57%   49 aa  RL333_LACLS RecName: Full=50S ribosomal protein L33 3;
    3::49      1e-12  57%   49 aa  RL333_LACLM RecName: Full=50S ribosomal protein L33 3;
    3::50      1e-12  65%   50 aa  RL332_STRPM RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRPG RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRPF RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRPD RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRPC RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRPB RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRP6 RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRP3 RecName: Full=50S ribosomal protein L33 2;
    3::50      1e-12  65%   50 aa  RL332_STRP1 RecName: Full=50S ribosomal protein L33 2;
    2::49      1e-12  55%   49 aa  RL33_CLOBA RecName: Full=50S ribosomal protein L33;
    3::49      1e-12  57%   49 aa  RL332_LACLA RecName: Full=50S ribosomal protein L33 2;
    4::48      2e-12  53%   49 aa  RL33_THEM4 RecName: Full=50S ribosomal protein L33;
    2::49      2e-12  57%   49 aa  RL331_ACHLI RecName: Full=50S ribosomal protein L33 1;
   10::54      3e-12  59%   54 aa  RL33_CALS8 RecName: Full=50S ribosomal protein L33;
    2::49      3e-12  60%   49 aa  RL332_BACLI RecName: Full=50S ribosomal protein L33 2;
    2::47      4e-12  52%   47 aa  RL33_STAXY RecName: Full=50S ribosomal protein L33;
    4::49      4e-12  62%   49 aa  RL33_BACHD RecName: Full=50S ribosomal protein L33;
    3::50      4e-12  55%   50 aa  RL331_STRTD RecName: Full=50S ribosomal protein L33 1;
    3::50      4e-12  55%   50 aa  RL331_STRT2 RecName: Full=50S ribosomal protein L33 1;
    3::50      4e-12  55%   50 aa  RL331_STRT1 RecName: Full=50S ribosomal protein L33 1;
    2::49      4e-12  55%   49 aa  RL331_BACP2 RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-12  51%   49 aa  RL33_THESQ RecName: Full=50S ribosomal protein L33;
    4::48      7e-12  51%   49 aa  RL33_THEP1 RecName: Full=50S ribosomal protein L33;
    4::48      7e-12  51%   49 aa  RL33_THEMA RecName: Full=50S ribosomal protein L33;
    4::49      7e-12  53%   49 aa  RL33_CLOTH RecName: Full=50S ribosomal protein L33;
    4::49      7e-12  58%   49 aa  RL33_CLOPS RecName: Full=50S ribosomal protein L33;
    4::49      7e-12  58%   49 aa  RL33_CLOPE RecName: Full=50S ribosomal protein L33;
    4::49      7e-12  58%   49 aa  RL33_CLOP1 RecName: Full=50S ribosomal protein L33;
    2::49      7e-12  57%   49 aa  RL331_BACLD RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-12  52%   49 aa  RL33_MOOTA RecName: Full=50S ribosomal protein L33;
    2::49      9e-12  53%   49 aa  RL33_FINM2 RecName: Full=50S ribosomal protein L33;
    5::49      9e-12  55%   49 aa  RL33_DESAP RecName: Full=50S ribosomal protein L33;
    5::49      9e-12  61%   49 aa  RL331_STAES RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-12  61%   49 aa  RL331_STAEQ RecName: Full=50S ribosomal protein L33 1;
    8::54      9e-12  52%   54 aa  RL331_MESFL RecName: Full=50S ribosomal protein L33 1;
    2::49      9e-12  57%   49 aa  RL331_GEOKA RecName: Full=50S ribosomal protein L33 1;
    4::49      1e-11  53%   49 aa  RL33_CLOK5 RecName: Full=50S ribosomal protein L33;
    4::49      1e-11  56%   49 aa  RL33_CLOAB RecName: Full=50S ribosomal protein L33;
   10::54      1e-11  55%   54 aa  RL33_ANATD RecName: Full=50S ribosomal protein L33;
   12::56      2e-11  57%   56 aa  RL33_BIFAA RecName: Full=50S ribosomal protein L33;
    2::49      2e-11  53%   49 aa  RL333_BACA2 RecName: Full=50S ribosomal protein L33 3;
    5::49      2e-11  59%   49 aa  RL332_STAS1 RecName: Full=50S ribosomal protein L33 2;
    2::49      2e-11  53%   49 aa  RL332_BACSU RecName: Full=50S ribosomal protein L33 2;
    2::47      2e-11  50%   47 aa  RL33_STASA RecName: Full=50S ribosomal protein L33;
    5::49      2e-11  55%   49 aa  RL33_DESHY RecName: Full=50S ribosomal protein L33;
   13::57      2e-11  57%   57 aa  RL33_BIFLO RecName: Full=50S ribosomal protein L33;
   11::55      2e-11  57%   55 aa  RL33_BIFLD RecName: Full=50S ribosomal protein L33;
    2::47      2e-11  50%   47 aa  RL333_STAS1 RecName: Full=50S ribosomal protein L33 3;
    5::49      2e-11  59%   49 aa  RL332_STAHJ RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAW RecName: Full=50S ribosomal protein L33 2;
    8::52      2e-11  59%   52 aa  RL332_STAAT RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAS RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAR RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAN RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAM RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAE RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAAC RecName: Full=50S ribosomal protein L33 2;
    8::52      2e-11  59%   52 aa  RL332_STAAB RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAA9 RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL332_STAA2 RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-11  59%   49 aa  RL331_STAA8 RecName: Full=50S ribosomal protein L33 1;
    8::52      2e-11  59%   52 aa  RL331_STAA3 RecName: Full=50S ribosomal protein L33 1;
    5::49      2e-11  59%   49 aa  RL331_STAA1 RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  57%   49 aa  RL332_STAES RecName: Full=50S ribosomal protein L33 2;
    5::49      3e-11  57%   49 aa  RL332_STAEQ RecName: Full=50S ribosomal protein L33 2;
    2::49      3e-11  47%   49 aa  RL33_NATTJ RecName: Full=50S ribosomal protein L33;
    5::49      3e-11  61%   49 aa  RL333_STAAT RecName: Full=50S ribosomal protein L33 3;
    5::49      3e-11  61%   49 aa  RL333_STAAE RecName: Full=50S ribosomal protein L33 3;
    5::49      3e-11  61%   49 aa  RL333_STAAB RecName: Full=50S ribosomal protein L33 3;
    5::49      3e-11  61%   49 aa  RL333_STAA9 RecName: Full=50S ribosomal protein L33 3;
    5::49      3e-11  61%   49 aa  RL333_STAA2 RecName: Full=50S ribosomal protein L33 3;
    5::49      3e-11  61%   49 aa  RL332_STAA8 RecName: Full=50S ribosomal protein L33 2;
    5::49      3e-11  61%   49 aa  RL332_STAA3 RecName: Full=50S ribosomal protein L33 2;
    5::49      3e-11  61%   49 aa  RL332_STAA1 RecName: Full=50S ribosomal protein L33 2;
    5::49      3e-11  61%   49 aa  RL331_STAAW RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  61%   49 aa  RL331_STAAS RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  61%   49 aa  RL331_STAAR RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  61%   49 aa  RL331_STAAN RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  61%   49 aa  RL331_STAAM RecName: Full=50S ribosomal protein L33 1;
    5::49      3e-11  61%   49 aa  RL331_STAAC RecName: Full=50S ribosomal protein L33 1;
    5::49      5e-11  59%   49 aa  RL331_STAHJ RecName: Full=50S ribosomal protein L33 1;
    3::49      5e-11  47%   49 aa  RL331_MYCAP RecName: Full=50S ribosomal protein L33 1;
    3::48      5e-11  50%   48 aa  RL331_EXIS2 RecName: Full=50S ribosomal protein L33 1;
    1::48      6e-11  52%   48 aa  RL331_MYCA5 RecName: Full=50S ribosomal protein L33 1;
    4::48      1e-10  47%   49 aa  RL33_THELT RecName: Full=50S ribosomal protein L33;
    5::49      1e-10  50%   49 aa  RL33_SYNAS RecName: Full=50S ribosomal protein L33;
    5::49      1e-10  52%   49 aa  RL33_DESRM RecName: Full=50S ribosomal protein L33;
    5::49      1e-10  52%   49 aa  RL33_CARHZ RecName: Full=50S ribosomal protein L33;
    5::49      1e-10  50%   49 aa  RL33_ALKOO RecName: Full=50S ribosomal protein L33;
    9::56      1e-10  51%   56 aa  RL331_PROAC RecName: Full=50S ribosomal protein L33 1;
    5::49      1e-10  59%   49 aa  RL331_BACCN RecName: Full=50S ribosomal protein L33 1;
   10::54      1e-10  52%   54 aa  RL33_SYMTH RecName: Full=50S ribosomal protein L33;
    8::55      1e-10  49%   55 aa  RL33_ACIC1 RecName: Full=50S ribosomal protein L33;
    4::49      2e-10  53%   49 aa  RL33_CLOBM RecName: Full=50S ribosomal protein L33;
    4::49      2e-10  53%   49 aa  RL33_CLOBL RecName: Full=50S ribosomal protein L33;
    4::49      2e-10  53%   49 aa  RL33_CLOBK RecName: Full=50S ribosomal protein L33;
    4::49      2e-10  53%   49 aa  RL33_CLOBH RecName: Full=50S ribosomal protein L33;
    4::49      2e-10  53%   49 aa  RL33_CLOB1 RecName: Full=50S ribosomal protein L33;
    4::53      2e-10  47%   53 aa  RL332_MYCCT RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-10  57%   49 aa  RL332_BACWK RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-10  57%   49 aa  RL332_BACC1 RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-10  57%   49 aa  RL332_BACAN RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-10  57%   49 aa  RL331_STAS1 RecName: Full=50S ribosomal protein L33 1;
    5::49      2e-10  57%   49 aa  RL331_BACCR RecName: Full=50S ribosomal protein L33 1;
    7::54      2e-10  51%   54 aa  RL33_FRASC RecName: Full=50S ribosomal protein L33;
    7::54      2e-10  51%   54 aa  RL33_FRAAA RecName: Full=50S ribosomal protein L33;
    9::56      3e-10  51%   56 aa  RL33_NOCSJ RecName: Full=50S ribosomal protein L33;
    1::50      4e-10  48%   50 aa  RL33_UNCTG RecName: Full=50S ribosomal protein L33;
    8::55      4e-10  49%   55 aa  RL33_RUBXD RecName: Full=50S ribosomal protein L33;
    5::49      4e-10  52%   49 aa  RL33_HELMI RecName: Full=50S ribosomal protein L33;
    8::55      4e-10  51%   55 aa  RL332_MYCTU RecName: Full=50S ribosomal protein L33 2;
    8::55      4e-10  51%   55 aa  RL332_MYCBO RecName: Full=50S ribosomal protein L33 2;
   15::56      4e-10  57%   56 aa  RL331_SORC5 RecName: Full=50S ribosomal protein L33 1;
    8::55      4e-10  51%   55 aa  RL331_MYCTA RecName: Full=50S ribosomal protein L33 1;
    8::55      4e-10  51%   55 aa  RL331_MYCBP RecName: Full=50S ribosomal protein L33 1;
    8::55      5e-10  49%   55 aa  RL333_KINRD RecName: Full=50S ribosomal protein L33 3;
    5::49      5e-10  57%   49 aa  RL332_GEOKA RecName: Full=50S ribosomal protein L33 2;
    5::49      5e-10  57%   49 aa  RL331_BACST RecName: Full=50S ribosomal protein L33 1;
   10::54      7e-10  52%   56 aa  RL33_TREDE RecName: Full=50S ribosomal protein L33;
    8::55      7e-10  47%   55 aa  RL33_MYCLB RecName: Full=50S ribosomal protein L33;
    5::49      7e-10  55%   49 aa  RL33_DESVV RecName: Full=50S ribosomal protein L33;
    5::49      7e-10  55%   49 aa  RL33_DESVH RecName: Full=50S ribosomal protein L33;
    2::47      7e-10  43%   47 aa  RL333_STAES RecName: Full=50S ribosomal protein L33 3;
    2::47      7e-10  43%   47 aa  RL333_STAEQ RecName: Full=50S ribosomal protein L33 3;
    8::55      7e-10  49%   55 aa  RL332_SALAI RecName: Full=50S ribosomal protein L33 2;
    8::55      7e-10  49%   55 aa  RL332_MYCMM RecName: Full=50S ribosomal protein L33 2;
    8::55      7e-10  47%   55 aa  RL332_MYCLE RecName: Full=50S ribosomal protein L33 2;
    5::49      7e-10  57%   49 aa  RL332_GEOTN RecName: Full=50S ribosomal protein L33 2;
    8::55      7e-10  49%   55 aa  RL331_MYCUA RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-10  53%   48 aa  RL331_BACSK RecName: Full=50S ribosomal protein L33 1;
    8::53      9e-10  49%   54 aa  RL33_THET8 RecName: Full=50S ribosomal protein L33;
    8::53      9e-10  49%   54 aa  RL33_THET2 RecName: Full=50S ribosomal protein L33;
    2::47      9e-10  43%   47 aa  RL33_STACP RecName: Full=50S ribosomal protein L33;
    4::49      9e-10  53%   52 aa  RL33_CAMJR RecName: Full=50S ribosomal protein L33;
    4::49      9e-10  53%   52 aa  RL33_CAMJJ RecName: Full=50S ribosomal protein L33;
    4::49      9e-10  53%   52 aa  RL33_CAMJE RecName: Full=50S ribosomal protein L33;
    4::49      9e-10  53%   52 aa  RL33_CAMJ8 RecName: Full=50S ribosomal protein L33;
   13::57      9e-10  55%   59 aa  RL33_BORT9 RecName: Full=50S ribosomal protein L33;
   13::57      9e-10  55%   59 aa  RL33_BORHD RecName: Full=50S ribosomal protein L33;
    8::55      9e-10  49%   55 aa  RL332_SALTO RecName: Full=50S ribosomal protein L33 2;
    8::55      9e-10  49%   55 aa  RL332_MYCPA RecName: Full=50S ribosomal protein L33 2;
    8::55      9e-10  49%   55 aa  RL331_MYCA1 RecName: Full=50S ribosomal protein L33 1;
    9::56      1e-09  51%   56 aa  RL33_BEUC1 RecName: Full=50S ribosomal protein L33;
    5::49      1e-09  55%   49 aa  RL333_BACLD RecName: Full=50S ribosomal protein L33 3;
    7::54      1e-09  49%   54 aa  RL332_STRGG RecName: Full=50S ribosomal protein L33 2;
    2::49      1e-09  51%   52 aa  RL33_HELPY RecName: Full=50S ribosomal protein L33;
    2::49      1e-09  51%   52 aa  RL33_HELPS RecName: Full=50S ribosomal protein L33;
    2::49      1e-09  51%   52 aa  RL33_HELPJ RecName: Full=50S ribosomal protein L33;
    2::49      1e-09  51%   52 aa  RL33_HELPH RecName: Full=50S ribosomal protein L33;
    8::53      1e-09  51%   56 aa  RL33_HELHP RecName: Full=50S ribosomal protein L33;
    7::54      1e-09  49%   54 aa  RL332_STRCO RecName: Full=50S ribosomal protein L33 2;
    7::54      1e-09  49%   54 aa  RL332_STRAW RecName: Full=50S ribosomal protein L33 2;
    7::54      1e-09  47%   54 aa  RL332_SACEN RecName: Full=50S ribosomal protein L33 2;
    8::55      1e-09  47%   55 aa  RL332_MYCGI RecName: Full=50S ribosomal protein L33 2;
    8::55      1e-09  47%   55 aa  RL331_MYCVP RecName: Full=50S ribosomal protein L33 1;
    2::47      2e-09  39%   47 aa  RL333_STAAW RecName: Full=50S ribosomal protein L33 3;
    2::47      2e-09  39%   47 aa  RL333_STAAS RecName: Full=50S ribosomal protein L33 3;
    2::47      2e-09  39%   47 aa  RL333_STAAR RecName: Full=50S ribosomal protein L33 3;
    2::47      2e-09  39%   47 aa  RL333_STAAN RecName: Full=50S ribosomal protein L33 3;
    2::47      2e-09  39%   47 aa  RL333_STAAM RecName: Full=50S ribosomal protein L33 3;
    2::47      2e-09  39%   47 aa  RL333_STAAC RecName: Full=50S ribosomal protein L33 3;
    9::56      2e-09  47%   56 aa  RL332_NOCFA RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-09  52%   49 aa  RL332_BACCN RecName: Full=50S ribosomal protein L33 2;
    2::47      2e-09  39%   47 aa  RL331_STAAT RecName: Full=50S ribosomal protein L33 1;
    2::47      2e-09  39%   47 aa  RL331_STAAE RecName: Full=50S ribosomal protein L33 1;
    2::47      2e-09  39%   47 aa  RL331_STAAB RecName: Full=50S ribosomal protein L33 1;
    2::47      2e-09  39%   47 aa  RL331_STAA9 RecName: Full=50S ribosomal protein L33 1;
    2::47      2e-09  39%   47 aa  RL331_STAA2 RecName: Full=50S ribosomal protein L33 1;
    5::49      2e-09  52%   49 aa  RL33_PELCD RecName: Full=50S ribosomal protein L33;
    4::49      2e-09  51%   52 aa  RL33_CAMJD RecName: Full=50S ribosomal protein L33;
    5::49      2e-09  52%   49 aa  RL333_BACC1 RecName: Full=50S ribosomal protein L33 3;
    5::49      2e-09  52%   49 aa  RL333_BACAN RecName: Full=50S ribosomal protein L33 3;
    2::46      2e-09  49%   46 aa  RL332_MYCPU RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-09  52%   49 aa  RL332_BACCR RecName: Full=50S ribosomal protein L33 2;
    2::49      3e-09  49%   52 aa  RL33_HELAH RecName: Full=50S ribosomal protein L33;
   13::57      3e-09  52%   59 aa  RL33_BORGA RecName: Full=50S ribosomal protein L33;
   13::57      3e-09  52%   59 aa  RL33_BORBZ RecName: Full=50S ribosomal protein L33;
   13::57      3e-09  52%   59 aa  RL33_BORBU RecName: Full=50S ribosomal protein L33;
   13::57      3e-09  52%   59 aa  RL33_BORAP RecName: Full=50S ribosomal protein L33;
    8::55      3e-09  49%   55 aa  RL331_RHOSR RecName: Full=50S ribosomal protein L33 1;
    1::65      4e-09  56%   65 aa  RL33_SYNY3 RecName: Full=50S ribosomal protein L33;
    7::54      6e-09  47%   54 aa  RL33_THEFY RecName: Full=50S ribosomal protein L33;
    5::49      6e-09  50%   49 aa  RL332_LISW6 RecName: Full=50S ribosomal protein L33 2;
    5::49      6e-09  50%   49 aa  RL332_BACP2 RecName: Full=50S ribosomal protein L33 2;
    2::49      6e-09  49%   49 aa  RL332_ACHLI RecName: Full=50S ribosomal protein L33 2;
    5::49      6e-09  50%   49 aa  RL331_LISMO RecName: Full=50S ribosomal protein L33 1;
    5::49      6e-09  50%   49 aa  RL331_LISMF RecName: Full=50S ribosomal protein L33 1;
    5::49      6e-09  50%   49 aa  RL331_LISIN RecName: Full=50S ribosomal protein L33 1;
    5::49      6e-09  52%   49 aa  RL331_BACSU RecName: Full=50S ribosomal protein L33 1;
    5::49      6e-09  52%   49 aa  RL331_BACA2 RecName: Full=50S ribosomal protein L33 1;
    8::55      7e-09  45%   55 aa  RL332_MYCA9 RecName: Full=50S ribosomal protein L33 2;
   11::64      9e-09  55%   64 aa  RL33_SYNP6 RecName: Full=50S ribosomal protein L33;
   11::64      9e-09  55%   64 aa  RL33_SYNE7 RecName: Full=50S ribosomal protein L33;
    7::54      9e-09  47%   54 aa  RL33_FRASN RecName: Full=50S ribosomal protein L33;
    1::53      9e-09  50%   56 aa  RL33_ARCB4 RecName: Full=50S ribosomal protein L33;
    5::53      9e-09  44%   54 aa  RL331_MYXXD RecName: Full=50S ribosomal protein L33 1;
    1::64      1e-08  56%   64 aa  RL33_CYAP7 RecName: Full=50S ribosomal protein L33;
    5::49      1e-08  52%   49 aa  RL332_OCEIH RecName: Full=50S ribosomal protein L33 2;
    2::47      1e-08  41%   48 aa  RL332_MYCGA RecName: Full=50S ribosomal protein L33 2;
    4::49      1e-08  51%   49 aa  RL332_BACSK RecName: Full=50S ribosomal protein L33 2;
    4::49      1e-08  49%   49 aa  RL332_BACLD RecName: Full=50S ribosomal protein L33 2;
    8::55      1e-08  45%   55 aa  RL331_MYCSS RecName: Full=50S ribosomal protein L33 1;
    8::55      1e-08  45%   55 aa  RL331_MYCSK RecName: Full=50S ribosomal protein L33 1;
    8::55      1e-08  45%   55 aa  RL331_MYCS2 RecName: Full=50S ribosomal protein L33 1;
   11::55      2e-08  45%   55 aa  RL33_DEHSC RecName: Full=50S ribosomal protein L33;
   11::55      2e-08  45%   55 aa  RL33_DEHSB RecName: Full=50S ribosomal protein L33;
   11::55      2e-08  45%   55 aa  RL33_DEHE1 RecName: Full=50S ribosomal protein L33;
    4::49      2e-08  51%   49 aa  RL333_BACP2 RecName: Full=50S ribosomal protein L33 3;
    8::55      2e-08  45%   55 aa  RL331_MYCSJ RecName: Full=50S ribosomal protein L33 1;
   11::62      2e-08  52%   62 aa  RK33_CYAME RecName: Full=50S ribosomal protein L33,
    1::64      2e-08  54%   64 aa  RL33_MICAN RecName: Full=50S ribosomal protein L33;
    4::49      2e-08  47%   49 aa  RL33_CLOD6 RecName: Full=50S ribosomal protein L33;
    9::55      3e-08  43%   58 aa  RL33_BRAHW RecName: Full=50S ribosomal protein L33;
    4::49      4e-08  47%   49 aa  RL33_ALKMQ RecName: Full=50S ribosomal protein L33;
    4::49      5e-08  51%   49 aa  RL332_EXIS2 RecName: Full=50S ribosomal protein L33 2;
    5::49      5e-08  52%   49 aa  RL332_BACA2 RecName: Full=50S ribosomal protein L33 2;
    1::64      6e-08  52%   64 aa  RL33_SYNP2 RecName: Full=50S ribosomal protein L33;
    4::49      6e-08  49%   49 aa  RL33_LYSSC RecName: Full=50S ribosomal protein L33;
    1::64      8e-08  52%   64 aa  RL33_CYAA5 RecName: Full=50S ribosomal protein L33;
   10::67      8e-08  51%   68 aa  RK33_LEMMI RecName: Full=50S ribosomal protein L33,
    1::51      1e-07  44%   53 aa  RL33_MYCPE RecName: Full=50S ribosomal protein L33;
    1::64      1e-07  52%   64 aa  RL33_CYAP8 RecName: Full=50S ribosomal protein L33;
   28::64      1e-07  53%   65 aa  RK33_ANEMR RecName: Full=50S ribosomal protein L33, plastid;
    5::49      2e-07  50%   49 aa  RL333_ENTFA RecName: Full=50S ribosomal protein L33 3;
   11::64      2e-07  55%   64 aa  RK33_CYAPA RecName: Full=50S ribosomal protein L33, cyanelle;
    4::48      2e-07  50%   48 aa  RL332_STRTD RecName: Full=50S ribosomal protein L33 2;
    4::48      2e-07  50%   48 aa  RL332_STRT2 RecName: Full=50S ribosomal protein L33 2;
    4::48      2e-07  50%   48 aa  RL332_STRT1 RecName: Full=50S ribosomal protein L33 2;
    5::49      2e-07  48%   49 aa  RL332_LACBA RecName: Full=50S ribosomal protein L33 2;
    1::51      2e-07  42%   53 aa  RL331_MYCGE RecName: Full=50S ribosomal protein L33 1;
    1::65      2e-07  54%   66 aa  RK33_POPTR RecName: Full=50S ribosomal protein L33,
    1::65      2e-07  54%   66 aa  RK33_POPAL RecName: Full=50S ribosomal protein L33,
    5::49      3e-07  48%   49 aa  RL332_LACJO RecName: Full=50S ribosomal protein L33 2;
    5::49      3e-07  48%   49 aa  RL332_LACGA RecName: Full=50S ribosomal protein L33 2;
    7::69      3e-07  50%   70 aa  RK33_PELHO RecName: Full=50S ribosomal protein L33,
   11::65      3e-07  50%   66 aa  RK33_ANGEV RecName: Full=50S ribosomal protein L33,
    1::65      3e-07  52%   66 aa  RK33_ADICA RecName: Full=50S ribosomal protein L33,
    1::51      4e-07  48%   53 aa  RL33_UREPA RecName: Full=50S ribosomal protein L33;
    1::51      4e-07  48%   53 aa  RL33_UREP2 RecName: Full=50S ribosomal protein L33;
    5::49      4e-07  45%   49 aa  RL33_LACAC RecName: Full=50S ribosomal protein L33;
    2::47      4e-07  35%   48 aa  RL332_MYCPN RecName: Full=50S ribosomal protein L33 2;
    5::49      4e-07  45%   49 aa  RL331_LACH4 RecName: Full=50S ribosomal protein L33 1;
   29::65      4e-07  53%   66 aa  RK33_PHYPA RecName: Full=50S ribosomal protein L33,
    5::49      5e-07  45%   49 aa  RL331_LACSS RecName: Full=50S ribosomal protein L33 1;
    6::50      7e-07  41%   50 aa  RL33_GEOBB RecName: Full=50S ribosomal protein L33;
    4::48      7e-07  48%   48 aa  RL331_STRPM RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRPG RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRPF RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRPD RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRPC RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRPB RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRP6 RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRP3 RecName: Full=50S ribosomal protein L33 1;
    4::48      7e-07  48%   48 aa  RL331_STRP1 RecName: Full=50S ribosomal protein L33 1;
    4::48      9e-07  45%   48 aa  RL33_STRMU RecName: Full=50S ribosomal protein L33;
    4::48      9e-07  45%   48 aa  RL331_STRA5 RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-07  45%   49 aa  RL331_PEDPA RecName: Full=50S ribosomal protein L33 1;
    8::50      9e-07  45%   50 aa  RL331_MYCPU RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-07  43%   49 aa  RL331_LACS1 RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-07  45%   49 aa  RL331_LACDB RecName: Full=50S ribosomal protein L33 1;
    5::49      9e-07  45%   49 aa  RL331_LACDA RecName: Full=50S ribosomal protein L33 1;
   10::65      9e-07  51%   66 aa  RK33_VITVI RecName: Full=50S ribosomal protein L33,
   28::64      9e-07  53%   65 aa  RK33_MARPO RecName: Full=50S ribosomal protein L33,
    1::51      1e-06  36%   53 aa  RL331_MYCGA RecName: Full=50S ribosomal protein L33 1;
   10::65      1e-06  56%   66 aa  RK33_SPIOL RecName: Full=50S ribosomal protein L33,
   11::64      1e-06  48%   64 aa  RK33_PHATR RecName: Full=50S ribosomal protein L33,
   11::64      1e-06  45%   64 aa  RK33_ODOSI RecName: Full=50S ribosomal protein L33,
   10::65      1e-06  49%   66 aa  RK33_MANES RecName: Full=50S ribosomal protein L33,
   11::65      1e-06  50%   66 aa  RK33_CRYJA RecName: Full=50S ribosomal protein L33,
   10::65      1e-06  51%   66 aa  RK33_CITSI RecName: Full=50S ribosomal protein L33,
    5::49      2e-06  41%   49 aa  RL33_SYNWW RecName: Full=50S ribosomal protein L33;
   11::64      2e-06  48%   65 aa  RK33_STAPU RecName: Full=50S ribosomal protein L33,
   11::65      2e-06  50%   66 aa  RK33_LIRTU RecName: Full=50S ribosomal protein L33,
   11::64      2e-06  48%   64 aa  RK33_CHLAT RecName: Full=50S ribosomal protein L33,
    8::50      2e-06  43%   50 aa  RL332_MYCAP RecName: Full=50S ribosomal protein L33 2;
   10::65      2e-06  49%   66 aa  RK33_NANDO RecName: Full=50S ribosomal protein L33,
   10::65      2e-06  49%   66 aa  RK33_DRIGR RecName: Full=50S ribosomal protein L33,
   10::65      2e-06  49%   66 aa  RK33_BUXMI RecName: Full=50S ribosomal protein L33,
   31::65      2e-06  51%   66 aa  RK33_BARVE RecName: Full=50S ribosomal protein L33,
   11::66      3e-06  55%   66 aa  RL332_SYNSC RecName: Full=50S ribosomal protein L33 2;
    2::47      3e-06  35%   48 aa  RL332_MYCGE RecName: Full=50S ribosomal protein L33 2;
   10::65      3e-06  47%   66 aa  RK33_ORYSJ RecName: Full=50S ribosomal protein L33,
   10::65      3e-06  47%   66 aa  RK33_ORYSI RecName: Full=50S ribosomal protein L33,
   10::65      3e-06  47%   66 aa  RK33_ORYSA RecName: Full=50S ribosomal protein L33,
   10::65      3e-06  47%   66 aa  RK33_ORYNI RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_COFAR RecName: Full=50S ribosomal protein L33,
   10::65      3e-06  49%   66 aa  RK33_CERDE RecName: Full=50S ribosomal protein L33,
   31::65      3e-06  51%   66 aa  RK33_CALFG RecName: Full=50S ribosomal protein L33,
   31::65      3e-06  49%   66 aa  RK33_ACOCL RecName: Full=50S ribosomal protein L33,
    4::49      3e-06  47%   50 aa  RL33_FUSNN RecName: Full=50S ribosomal protein L33;
   11::65      3e-06  50%   66 aa  RK33_TOBAC RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   68 aa  RK33_PINTH RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   68 aa  RK33_PINKO RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_PANGI RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_NICTO RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_NICSY RecName: Full=50S ribosomal protein L33,
   33::67      3e-06  51%   68 aa  RK33_LACSA RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_FAGEA RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_EUCGG RecName: Full=50S ribosomal protein L33,
   11::65      3e-06  50%   66 aa  RK33_ATRBE RecName: Full=50S ribosomal protein L33,
   11::64      3e-06  48%   65 aa  RK33_ANTFO RecName: Full=50S ribosomal protein L33,
    4::49      4e-06  44%   49 aa  RL331_STRPN RecName: Full=50S ribosomal protein L33 1;
   11::64      4e-06  48%   65 aa  RK33_ZYGCR RecName: Full=50S ribosomal protein L33,
   10::65      4e-06  47%   66 aa  RK33_SORBI RecName: Full=50S ribosomal protein L33,
   10::65      4e-06  47%   66 aa  RK33_SACOF RecName: Full=50S ribosomal protein L33,
   10::65      4e-06  47%   66 aa  RK33_SACHY RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_PLAOC RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_OLIPU RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_NASOF RecName: Full=50S ribosomal protein L33,
   10::65      4e-06  47%   66 aa  RK33_MAIZE RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_LOBMA RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_LEPVR RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_GOSHI RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_GOSBA RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_DRANE RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_CRUWA RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_CHLSC RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_CARPA RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_CAPBU RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_ARATH RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_ARAHI RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_AETGR RecName: Full=50S ribosomal protein L33,
   31::65      4e-06  51%   66 aa  RK33_AETCO RecName: Full=50S ribosomal protein L33,
   45::64      6e-06  70%   64 aa  RL33_THEEB RecName: Full=50S ribosomal protein L33;
    5::49      6e-06  43%   49 aa  RL33_LACRD RecName: Full=50S ribosomal protein L33;
    5::49      6e-06  41%   53 aa  RL332_SORC5 RecName: Full=50S ribosomal protein L33 2;
    5::49      6e-06  43%   49 aa  RL332_LACRJ RecName: Full=50S ribosomal protein L33 2;
    4::47      6e-06  44%   48 aa  RL332_LACLS RecName: Full=50S ribosomal protein L33 2;
    4::47      6e-06  44%   48 aa  RL332_LACLM RecName: Full=50S ribosomal protein L33 2;
    5::49      6e-06  43%   49 aa  RL332_LACF3 RecName: Full=50S ribosomal protein L33 2;
    4::47      6e-06  44%   48 aa  RL331_LACLC RecName: Full=50S ribosomal protein L33 1;
    4::47      6e-06  44%   48 aa  RL331_LACLA RecName: Full=50S ribosomal protein L33 1;
   33::67      6e-06  51%   68 aa  RK33_PIPCE RecName: Full=50S ribosomal protein L33,
    7::63      6e-06  43%   66 aa  RK33_JASNU RecName: Full=50S ribosomal protein L33,
   30::64      6e-06  46%   64 aa  RK33_CYACA RecName: Full=50S ribosomal protein L33,
   11::65      6e-06  48%   66 aa  RK33_CICAR RecName: Full=50S ribosomal protein L33,
   10::67      6e-06  47%   68 aa  RK33_AMBTC RecName: Full=50S ribosomal protein L33,
    8::50      8e-06  36%   50 aa  RL33_MYCS5 RecName: Full=50S ribosomal protein L33;
    4::48      8e-06  40%   49 aa  RL33_FERNB RecName: Full=50S ribosomal protein L33;
   10::65      8e-06  47%   66 aa  RK33_WHEAT RecName: Full=50S ribosomal protein L33,
   33::67      8e-06  51%   68 aa  RK33_NYMAL RecName: Full=50S ribosomal protein L33,
   10::65      8e-06  47%   66 aa  RK33_LOLPR RecName: Full=50S ribosomal protein L33,
   10::65      8e-06  47%   66 aa  RK33_HORVU RecName: Full=50S ribosomal protein L33,
   10::65      8e-06  47%   66 aa  RK33_CYCTA RecName: Full=50S ribosomal protein L33,
   10::65      8e-06  47%   66 aa  RK33_BRADI RecName: Full=50S ribosomal protein L33,
   10::65      8e-06  47%   66 aa  RK33_AGRST RecName: Full=50S ribosomal protein L33,
    4::52      1e-05  38%   52 aa  RL33_ANADF RecName: Full=50S ribosomal protein L33;
    3::50      1e-05  34%   50 aa  RL332_MYCA5 RecName: Full=50S ribosomal protein L33 2;
   11::64      1e-05  41%   64 aa  RK33_THAPS RecName: Full=50S ribosomal protein L33,
   11::65      1e-05  48%   66 aa  RK33_SOLTU RecName: Full=50S ribosomal protein L33,
   11::65      1e-05  48%   66 aa  RK33_SOLLC RecName: Full=50S ribosomal protein L33,
   11::65      1e-05  48%   66 aa  RK33_SOLBU RecName: Full=50S ribosomal protein L33,
   11::65      1e-05  50%   66 aa  RK33_ILLOL RecName: Full=50S ribosomal protein L33,
   31::65      1e-05  51%   66 aa  RK33_HELAN RecName: Full=50S ribosomal protein L33,
   31::65      1e-05  51%   66 aa  RK33_GUIAB RecName: Full=50S ribosomal protein L33,
    9::62      1e-05  43%   62 aa  RL33_CYAP4 RecName: Full=50S ribosomal protein L33;
   31::65      1e-05  49%   66 aa  RK33_PHAAO RecName: Full=50S ribosomal protein L33,
   31::65      1e-05  49%   66 aa  RK33_DAUCA RecName: Full=50S ribosomal protein L33,
   11::67      1e-05  52%   68 aa  RK33_CUSEX RecName: Full=50S ribosomal protein L33, plastid;
    5::49      2e-05  41%   49 aa  RL33_SYNFM RecName: Full=50S ribosomal protein L33;
   11::65      2e-05  48%   66 aa  RK33_IPOPU RecName: Full=50S ribosomal protein L33,
    1::53      2e-05  36%   54 aa  RL33_PETMO RecName: Full=50S ribosomal protein L33;
    5::54      2e-05  37%   56 aa  RL33_CAMHC RecName: Full=50S ribosomal protein L33;
   31::65      2e-05  49%   66 aa  RK33_EPIVI RecName: Full=50S ribosomal protein L33, plastid;
   11::67      2e-05  45%   68 aa  RK33_CUSRE RecName: Full=50S ribosomal protein L33, plastid;
   10::65      3e-05  48%   65 aa  RL33_PROMA RecName: Full=50S ribosomal protein L33;
    4::49      3e-05  42%   49 aa  RL331_STRR6 RecName: Full=50S ribosomal protein L33 1;
    4::49      3e-05  42%   49 aa  RL331_STRPI RecName: Full=50S ribosomal protein L33 1;
   31::65      3e-05  49%   66 aa  RK33_SOYBN RecName: Full=50S ribosomal protein L33,
   11::64      3e-05  41%   64 aa  RK33_MESVI RecName: Full=50S ribosomal protein L33,
   29::65      3e-05  50%   65 aa  RK33_GRATL RecName: Full=50S ribosomal protein L33,
   10::65      3e-05  42%   66 aa  RK33_DIOEL RecName: Full=50S ribosomal protein L33,
    5::54      4e-05  44%   54 aa  RL33_SALRD RecName: Full=50S ribosomal protein L33;
    5::49      4e-05  36%   49 aa  RL33_PELTS RecName: Full=50S ribosomal protein L33;
   32::65      4e-05  44%   66 aa  RK33_WELMI RecName: Full=50S ribosomal protein L33,
   11::65      4e-05  48%   66 aa  RK33_CUCSA RecName: Full=50S ribosomal protein L33,
   10::63      5e-05  45%   63 aa  RL33_GLOVI RecName: Full=50S ribosomal protein L33;
   11::64      5e-05  43%   64 aa  RL33_ANAVT RecName: Full=50S ribosomal protein L33;
   11::64      5e-05  43%   64 aa  RL33_ANASP RecName: Full=50S ribosomal protein L33;
    5::39      5e-05  46%   40 aa  RK33_PEA RecName: Full=50S ribosomal protein L33,
   31::65      5e-05  49%   66 aa  RK33_MORIN RecName: Full=50S ribosomal protein L33,
    6::59      6e-05  44%   59 aa  RL33_PROA2 RecName: Full=50S ribosomal protein L33;
   11::64      6e-05  39%   64 aa  RL33_NOSP7 RecName: Full=50S ribosomal protein L33;
   14::46      6e-05  52%   46 aa  RL331_MYCH7 RecName: Full=50S ribosomal protein L33 1;
   11::63      6e-05  43%   64 aa  RK33_HUPLU RecName: Full=50S ribosomal protein L33,
   32::65      6e-05  44%   66 aa  RK33_GNEPA RecName: Full=50S ribosomal protein L33,
   44::64      8e-05  57%   64 aa  RL33_SYNJB RecName: Full=50S ribosomal protein L33;
   28::49      8e-05  55%   50 aa  RL33_SULDN RecName: Full=50S ribosomal protein L33;
    4::53      8e-05  43%   54 aa  RL33_RHOBA RecName: Full=50S ribosomal protein L33;
    1::65      8e-05  50%   65 aa  RK33_PSINU RecName: Full=50S ribosomal protein L33,
   31::65      8e-05  46%   66 aa  RK33_CUSOB RecName: Full=50S ribosomal protein L33, plastid;
    9::62      1e-04  49%   62 aa  RL33_TRIEI RecName: Full=50S ribosomal protein L33;
    6::54      1e-04  40%   54 aa  RL33_HERA2 RecName: Full=50S ribosomal protein L33;
   11::65      1e-04  45%   66 aa  RK33_OENPA RecName: Full=50S ribosomal protein L33,
   11::65      1e-04  45%   66 aa  RK33_OENGL RecName: Full=50S ribosomal protein L33,
   11::65      1e-04  45%   66 aa  RK33_OENEH RecName: Full=50S ribosomal protein L33,
   11::65      1e-04  45%   66 aa  RK33_OENBI RecName: Full=50S ribosomal protein L33,
   11::65      1e-04  45%   66 aa  RK33_OENAR RecName: Full=50S ribosomal protein L33,
   10::65      1e-04  44%   66 aa  RK33_CUSGR RecName: Full=50S ribosomal protein L33, plastid;
   29::50      1e-04  59%   50 aa  RL33_SOLUE RecName: Full=50S ribosomal protein L33;
   47::66      2e-04  60%   66 aa  RL33_PROM3 RecName: Full=50S ribosomal protein L33;
   44::64      2e-04  57%   64 aa  RL33_SYNJA RecName: Full=50S ribosomal protein L33;
    6::54      2e-04  35%   56 aa  RL33_ACTPJ RecName: Full=50S ribosomal protein L33;
    6::54      2e-04  35%   56 aa  RL33_ACTP7 RecName: Full=50S ribosomal protein L33;
    6::54      2e-04  35%   56 aa  RL33_ACTP2 RecName: Full=50S ribosomal protein L33;
   10::64      3e-04  48%   64 aa  RL33_PROMP RecName: Full=50S ribosomal protein L33;
   10::64      3e-04  48%   64 aa  RL33_PROM5 RecName: Full=50S ribosomal protein L33;
    4::52      3e-04  33%   52 aa  RL33_ANASK RecName: Full=50S ribosomal protein L33;
    4::52      3e-04  33%   52 aa  RL33_ANADE RecName: Full=50S ribosomal protein L33;
    4::52      3e-04  33%   52 aa  RL33_ANAD2 RecName: Full=50S ribosomal protein L33;
   30::50      3e-04  62%   50 aa  RL33_ACIBL RecName: Full=50S ribosomal protein L33;
    9::62      3e-04  41%   62 aa  RL33_ACAM1 RecName: Full=50S ribosomal protein L33;
    2::47      3e-04  35%   47 aa  RL332_MESFL RecName: Full=50S ribosomal protein L33 2;
    8::62      4e-04  42%   62 aa  RL33_BACV8 RecName: Full=50S ribosomal protein L33;
   31::65      4e-04  46%   66 aa  RK33_LOTJA RecName: Full=50S ribosomal protein L33,
    6::20      5e-04  73%   93 aa  RL44_ARCFU RecName: Full=50S ribosomal protein L44E;
    8::62      5e-04  44%   62 aa  RL33_PARD8 RecName: Full=50S ribosomal protein L33;
    6::54      5e-04  33%   56 aa  RL33_HAEDU RecName: Full=50S ribosomal protein L33;
    1::52      5e-04  34%   54 aa  RL33_ELUMP RecName: Full=50S ribosomal protein L33;
   29::65      5e-04  42%   65 aa  RK33_PORYE RecName: Full=50S ribosomal protein L33,
    2::49      7e-04  36%   51 aa  RL33_METFK RecName: Full=50S ribosomal protein L33;
    6::54      7e-04  33%   56 aa  RL33_HAEPS RecName: Full=50S ribosomal protein L33;
    7::54      7e-04  36%   56 aa  RL33_DICNV RecName: Full=50S ribosomal protein L33;
   13::57      7e-04  39%   59 aa  RL33_BORRA RecName: Full=50S ribosomal protein L33;
   13::57      7e-04  39%   59 aa  RL33_BORDL RecName: Full=50S ribosomal protein L33;
    8::62      7e-04  42%   62 aa  RL33_BACTN RecName: Full=50S ribosomal protein L33;
    8::62      7e-04  42%   62 aa  RL33_BACFR RecName: Full=50S ribosomal protein L33;
    8::62      7e-04  42%   62 aa  RL33_BACFN RecName: Full=50S ribosomal protein L33;
   45::64      7e-04  55%   64 aa  RL331_SYNSC RecName: Full=50S ribosomal protein L33 1;
   27::65      7e-04  39%   65 aa  RK33_PORPU RecName: Full=50S ribosomal protein L33,
    2::49      0.001  36%   51 aa  RL33_NITEC RecName: Full=50S ribosomal protein L33;
    6::60      0.001  40%   60 aa  RL33_FLAPJ RecName: Full=50S ribosomal protein L33;
    6::60      0.001  38%   60 aa  RL33_CYTH3 RecName: Full=50S ribosomal protein L33;
    1::50

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
RL332_LACS1     MANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
RL33_LACPL      ---QKKVALACTVCGSRNYTIDANPNRTDRLEVKKFCKYCGKHTLHRETR
RL331_LACBA     ---QRKIALACSVCGSRNYTITASATRTKRLEVMKFCKFCGKHTLHRETR
RL332_PEDPA     --SQKKVALACTVCGSRNYTVAANPQRTDRLEVNKYCKRCNKHTLHSETR
RL332_LACDB     ----KKAALACSVCGSRNYSITANSNRTKRLELNKFCKHCGKKTLHKETR
RL332_LACDA     ----KKAALACSVCGSRNYSITANSNRTKRLELNKFCKHCGKKTLHKETR
RL331_LACRJ     --SQKKVALECTKCGARNYTITANPQRQERLELRKFCKHCGEYTIHRESR
RL332_LACH4     ----KKAALACSVCGSRNYSITASKNRTKRLELKKFCKHCGKMTLHKETR
RL332_LACC3     ----KKVALACSVCGQRNYFVPENPKRTERLTLKKFCKHCGRVTVHQETK
RL331_LEUMM     -----KVSLACTVCGSRNYTVTLSKDRTERLSVSKFCQHCGKHTLHQQTK
RL331_LACJO     ----KKAALACTVCGSRNYSIAASKNRTQRLELKKFCKHCGKQTLHKETR
RL331_LACGA     ----KKAALACTVCGSRNYSIAASKNRTQRLELKKFCKHCGKQTLHKETR
RL331_LACF3     ----KKVALECSECGRRNYSVPARPNHEERLELKKFCKHCGKVTVHRETR
RL332_LACSS     ----KKVALACTVCGSRNYYVAENKNRTERLELNKYCKHCGQYAQHKETR
RL332_LISMO     ---KKKTSLACSECGSRNYTVNVSGTQKERLEVKKFCRHCNKHTLHRETK
RL332_LISMF     ---KKKTSLACSECGSRNYTVNVSGTQKERLEVKKFCRHCNKHTLHRETK
RL332_LISIN     ---KKKTSLACSECGSRNYTVNVSGTQKERLEVKKFCRHCNKHTLHRETK
RL331_LISW6     ---KKKTSLACSECGSRNYTVNVSGTQKERLEVKKFCRHCNKHTLHRETK
RL331_OCEIH     ----KKITLACAVCSSRNYSTNKNSNQSTRLEVKKFCKTCGKHTLHRETK
RL331_BACWK     ---RKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNKHTVHKETK
RL332_ENTFA     ----KKAALACSVCGSRNYSKSVSEGRGERLEINKFCKYCNQYTLHKETK
RL332_STRA5     ---QKKASLACTECGSRNYSISSTPKPT-RLEVNKFCKYCKKYTIHKETR
RL331_GEOTN     ---RQKVTLACEQCGSRNYTTTKQMGRLERLTANKFCSVCNKHTVHRETK
RL331_BACC1     ---RKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNQHTVHKETK
RL331_BACAN     ---RKKVVLSCEECKNRNYSTMKDTSSVERLEIKKFCKTCNQHTVHKETK
RL33_THETN      -----KIALVCTECKNRNYHTTKNKNDPDRLELKKYCKHCKKHTLHRETK
RL33_THEP3      -----KITLACTECKNRNYHTTKNKNDPDRLELMKYCKFCKKHTLHRETK
RL332_STRR6     ----KKASLACAVCGSRNYSISGNPKPT-RLEVNKFCKHCGKYTTHRETR
RL332_STRPN     ----KKASLACAVCGSRNYSIKISGNKPTRLEVNKFCKHCGKYTTHRETR
RL33_CLOB8      ---RTKVTLACTECKQRNYDSMKNKNDPDRLEMKKYCKFCKKHTLHRETK
RL33_CLOPH      -----KITLACTECKQRNYNTTEKKNHPDRMETKKFCKFCKSHTLHKETK
RL33_AQUAE      ------ITLACTECKRRNYTTTKNKQKPERLELRKYCKWCRKHTIHREVK
RL333_LACLS     ----RKAGLACTVCGSRNYTLNSSVAKEKRVEVKKFCRTCGKHTLHKETR
RL333_LACLM     ----RKAGLACTVCGSRNYTLNSSVAKEKRVEVKKFCRTCGKHTLHKETR
RL332_STRPM     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRPG     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRPF     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRPD     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRPC     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRPB     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRP6     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRP3     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL332_STRP1     ---QKKASLACVECGSRNYSISSTPKPT-RLEVNKFCKYCKTYTLHKETR
RL33_CLOBA      ---RTKITLACTECKQRNYDSMKNKNNPDRLEMNKYCRFCKKHTLHRETK
RL332_LACLA     ----RKAGLACTICGSRNYTLNSSVAKEKRVEVKKFCRTCGKHTLHKETR
RL33_THEM4      -----QVALKCSECGNKNYYTTREKNKKEKLSLRKYCPKCNKHTVHNETK
RL331_ACHLI     ---REKIILVCSECLSRNFTTTKNKQTSERLEMNKFCPRCNKHTLHKESK
RL33_CALS8      ------IHLECTECKNRNYTTEKNKNDPDRLELRKYCKFCRKHTLHRETK
RL332_BACLI     ---KKKVTLACKNCGSRNYTTMKSSAAAERLEVKKYCNNCNSHTVHLETK
RL33_STAXY      ----KKVPLTCDVCGSRNYNVPKQSNLTSRLTLKKFCSRCNAHTMHKESK
RL33_BACHD      -----KRILACVECRSRNYTKTNQQSHTDRLEMKKFCRTCNRHTLHRETK
RL331_STRTD     ---QKKASLACADCGNRNYSISVSSTKPTRLEVNKFCKNCKKYTLHKETR
RL331_STRT2     ---QKKASLACADCGNRNYSISVSSTKPTRLEVNKFCKNCKKYTLHKETR
RL331_STRT1     ---QKKASLACADCGNRNYSISVSSTKPTRLEVNKFCKNCKKYTLHKETR
RL331_BACP2     ---RKKITLACKDCGSRNYTMKSDASAAERLEVKKYCKTCNSHKTHLETK
RL33_THESQ      -----KVALKCSQCGNKNYYTTRNKDKRAKLELRKYCPKCNAHTIHTETK
RL33_THEP1      -----KVALKCSQCGNKNYYTTRNKDKRAKLELRKYCPKCNAHTIHTETK
RL33_THEMA      -----KVALKCSQCGNKNYYTTRNKDKRAKLELRKYCPKCNAHTIHTETK
RL33_CLOTH      -----KITLACGECKQRNYNTMKNKNDPDRLEMRKYCRFCQKHTMHKETK
RL33_CLOPS      -----KVTLACTECKQRNYNTMKNKNDPNRIEMKKYCKFCKTHTLHRETK
RL33_CLOPE      -----KVTLACTECKQRNYNTMKNKNDPNRIEMKKYCKFCKTHTLHRETK
RL33_CLOP1      -----KVTLACTECKQRNYNTMKNKNDPNRIEMKKYCKFCKTHTLHRETK
RL331_BACLD     ---KKKVTLACKNCGNRNYTTMKSSAAAERLEVKKYCNNCNSHTVHLETK
RL33_MOOTA      ------ITLACTECKRRNYISTKNKNDPDRIELKKYCSFCGRHTVHKETK
RL33_FINM2      ---RDKVILECTECKSRNYTTKKNKKHPDRVETNKYCKFCKKHTLHKETR
RL33_DESAP      ------VTLACTECKRRNYITTKNKNDPNRIEMKKYCRWCGSHTMHKETK
RL331_STAES     ------VTLACTECGDRNYISTKNKNNPERVEMKKYCSRDNKHTLHRETK
RL331_STAEQ     ------VTLACTECGDRNYISTKNKNNPERVEMKKYCSRDNKHTLHRETK
RL331_MESFL     ----RKIILVCEDCLSRNYSLNKNLTQKERLEIKKFCSMCNKHTLHKETR
RL331_GEOKA     ---RQKVTLACVQCASRNYTAAKQIRRLERLMANKFCSTCNKHTIHRETK
RL33_CLOK5      -----KVILACTECKQRNYNTMKNKNNPNRLEIKKYCPFCNKHTVHKQTK
RL33_CLOAB      -----KLTLACTECRQRNYNTMKNKNDPDRLEMKKYCPFCHKHTLHKETK
RL33_ANATD      ------IHLECTECKNRNYTTEKNKNDPDRLELKKYCKFCRRHTIHRETK
RL33_BIFAA      ------ITLACTECKERNYITTKNRRNTDRLELKKFCSRCGKQTVHRETR
RL333_BACA2     ---RKKITLACKTCGNRNYTMKSSASAAERLEVKKYCSTCNSHTAHLETK
RL332_STAS1     ------ITLACTECGDRNYISTKNKNHPERIELKKFCPRLNKYTLHRETK
RL332_BACSU     ---RKKITLACKTCGNRNYTMKSSASAAERLEVKKYCSTCNSHTAHLETK
RL33_STASA      ----KKVPLNCEVCGNRNYNVPKQSNLASRLELKKYCPRCNAHTLHKESK
RL33_DESHY      ------ITLACTECKNRNYASIKNKNNPDRLEVKKYCKFCKSHTAHKETK
RL33_BIFLO      ------ITLACTECKERNYITTKNRRNTDRLELKKFCPRCGKQTVHRETR
RL33_BIFLD      ------ITLACTECKERNYITTKNRRNTDRLELKKFCPRCGKQTVHRETR
RL333_STAS1     ----KKVPLNCEVCGNRNYNVPKQSNLASRLELKKYCPRCNAHTLHKESK
RL332_STAHJ     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAW     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAT     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAS     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAR     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAN     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAM     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAE     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAC     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAAB     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAA9     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAA2     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL331_STAA8     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL331_STAA3     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL331_STAA1     ------VTLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAES     ------ITLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL332_STAEQ     ------ITLACTECGDRNYITTKNKNNPERIEMKKYCPRLNKYTLHRETK
RL33_NATTJ      ---REKITLECTECKQRNYKSFKNKNDRDRIELKKYCKFCNRHTLHKESK
RL333_STAAT     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL333_STAAE     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL333_STAAB     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL333_STAA9     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL333_STAA2     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL332_STAA8     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL332_STAA3     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL332_STAA1     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAW     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAS     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAR     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAN     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAM     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAAC     ------VTLACTECGDRNYITTKNKNNPERVEMKKFCSRENKQTLHRETK
RL331_STAHJ     ------VTLACTECGDRNYISTKNKRTNERVEMKKYCSRDNKHTLHRETK
RL331_MYCAP     ---RKKVTLSCEECHSMNYSTNKSLMSVDRITVKKFCRKCNKHTMHKEEK
RL331_EXIS2     ----KKVGLACDICGARDYTTMKKEDVSIRLELKKFCRRCNAHTIHKEAK
RL331_MYCA5     MKNTKKITLACQVCLAKNYST--NKSVTNRLEIKKFCKHCNMQTLHKEEK
RL33_THELT      -----KISLKCSECGKKNYYTDKNKTAKEKLSFRRYCPKCNKHTVHSETK
RL33_SYNAS      ------IILACTECKQKNYTTTKNKRTMQRFEIKKYCRFCRSHKLHRETK
RL33_DESRM      ------VTLACTECKRRNYTTAKNKNDPNRIELKKYCKWCHTHTVHKETR
RL33_CARHZ      ------ITLECTQCKHRNYTTTKNKNDPGRLELKKYCPYCNAHTVHKETK
RL33_ALKOO      ------ITLACTECKQRNYNTSKNKSNPDRMELKKYCKFCKTHTAHRETK
RL331_PROAC     ---RPKITLACTECKERNYITKKNRNNPDRMEMAKFCPRCRKHTAHRETR
RL331_BACCN     ------ITLACTECGDRNYISKKNKNNAERLELKKYCKRDKKSTLHRETK
RL33_SYMTH      ------ITMACTDCKNRNYSTYKNKNDSGRLELRKFCPTCGHHTLHRETR
RL33_ACIC1      ---RPKITLACQECKHRNYITRKNRNDPDRLELKKYCPHCNKHQVHRETR
RL33_CLOBM      -----KVTLACTECKRRNYNTMKNKNDPDRLEMNKYCPHCHKHAAHKETK
RL33_CLOBL      -----KVTLACTECKRRNYNTMKNKNDPDRLEMNKYCPHCHKHAAHKETK
RL33_CLOBK      -----KVTLACTECKRRNYNTMKNKNDPDRLEMNKYCPHCHKHAAHKETK
RL33_CLOBH      -----KVTLACTECKRRNYNTMKNKNDPDRLEMNKYCPHCHKHAAHKETK
RL33_CLOB1      -----KVTLACTECKRRNYNTMKNKNDPDRLEMNKYCPHCHKHAAHKETK
RL332_MYCCT     -STNKKATLVCVECLSRNYSVNKSGTQKQRLEIKKFCTTCNAHTLHKETR
RL332_BACWK     ------ITLACTECGDRNYISKKNKNNAERIELKKYCKRDKKSTLHRETK
RL332_BACC1     ------ITLACTECGDRNYISKKNKNNAERIELKKYCKRDKKSTLHRETK
RL332_BACAN     ------ITLACTECGDRNYISKKNKNNAERIELKKYCKRDKKSTLHRETK
RL331_STAS1     ------VTLACTECGERNYITTKNKRTNERIEMKKHCARDNKHTMHRETK
RL331_BACCR     ------ITLACTECGDRNYISKKNKNNAERIELKKYCKRDKKSTLHRETK
RL33_FRASC      ---RPKITMACQVCKHRNYITRKNRNDPDRLELKKFCPNCGKHTEHRETR
RL33_FRAAA      ---RPKITMACQVCKHRNYITRKNRNDPDRLELKKFCPNCGKHTEHRETR
RL33_NOCSJ      ---RPKITLACVECKERNYITKKNRNDPDRMELSKFCPRCRKHTAHRETR
RL33_UNCTG      MAERVIITLACSVCKNRNYYFDRAKNHEGKLALKKFCKNCGKRTDHKETK
RL33_RUBXD      ---RQLVTLACEECKRRNYHTRKNRRNTDRLQLRKFCPWCRRHTAHRETR
RL33_HELMI      ------VALACTECKRRNYMTNKNKNDPDRIELKKYCKWCKTQTVHKETK
RL332_MYCTU     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGKHQAHRETR
RL332_MYCBO     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGKHQAHRETR
RL331_SORC5     ------VSLACRECKSRNYKTTKAPDQV--VSLKKFCKQCKKHTVHDETK
RL331_MYCTA     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGKHQAHRETR
RL331_MYCBP     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGKHQAHRETR
RL333_KINRD     ---RPKITMACTECKERNYITKKNRNDPDRLDLAKFCPRCGKKTTHRETR
RL332_GEOKA     ------ITLACTECGERNYITSKNKNNPERLELKKYCPRDRKVTLHRETK
RL331_BACST     ------ITLACTECGERNYITSKNKNNPERLELKKYCPRDRKVTLHRETK
RL33_TREDE      ------IALQCSECKRRNYTTSKNRKNIQKLELMKYCSFDRKHTLHKETK
RL33_MYCLB      ---RPKITMACEVCKHRNYITKKNRNDPDRMELKKFCRNCGKHQSHRETR
RL33_DESVV      ------IQLACTECKRRNYATDKNKNTTGRLELKKYCPWDKKHTVHRETK
RL33_DESVH      ------IQLACTECKRRNYATDKNKNTTGRLELKKYCPWDKKHTVHRETK
RL333_STAES     ----KKVPLNCENCGNRNYNVPKKEGSATRLTLKKYCPRCNAHTVHKESK
RL333_STAEQ     ----KKVPLNCENCGNRNYNVPKKEGSATRLTLKKYCPRCNAHTVHKESK
RL332_SALAI     ---RPKITLACVECKERNYITRKNRNDPDRIELKKFCPRDGRHTIHRETR
RL332_MYCMM     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCRNCGSHQAHRETR
RL332_MYCLE     ---RPKITMACEVCKHRNYITKKNRNDPDRMELKKFCRNCGKHQSHRETR
RL332_GEOTN     ------ITLACTECGERNYISSKNKNNPERLELKKYCPRDRKVTLHRETK
RL331_MYCUA     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCRNCGSHQAHRETR
RL331_BACSK     -----KRVLACDICKSRNYSVTSAKKSDTRLTVKKFCKRCNGHTLHVETR
RL33_THET8      -----KLLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHREVK
RL33_THET2      -----KLLLECTECKRRNYATEKNKRNTNKLELRKYCPWCRKHTVHREVK
RL33_STACP      ----KKVPLNCEVCGNRNYNVPKKEGSATRLTLKKYCPKCNSHTVHKESK
RL33_CAMJR      -----KVGLKCEECGDINYSTYKNSNTTEKLELKKYCPRLKKHTLHKEVK
RL33_CAMJJ      -----KVGLKCEECGDINYSTYKNSNTTEKLELKKYCPRLKKHTLHKEVK
RL33_CAMJE      -----KVGLKCEECGDINYSTYKNSNTTEKLELKKYCPRLKKHTLHKEVK
RL33_CAMJ8      -----KVGLKCEECGDINYSTYKNSNTTEKLELKKYCPRLKKHTLHKEVK
RL33_BORT9      ------IALVCEETGIRNYTTTKNRNKQEKLELMKYCPILRKHTLHKEGK
RL33_BORHD      ------IALVCEETGIRNYTTTKNRNKQEKLELMKYCPILRKHTLHKEGK
RL332_SALTO     ---RPKITLACVECKERNYITRKNRNDPDRIELKKFCPREGRHTIHRETR
RL332_MYCPA     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKYCPNCGKHQAHRETR
RL331_MYCA1     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKYCPNCGKHQAHRETR
RL33_BEUC1      ---RPKITLACEVCKERNYITTKNRNHPDRLELQKFCPRCTAKTAHRETR
RL333_BACLD     ------ITLACTECGERNYISTKNKNNPDRVEFKKYCPRDKKSTLHRETK
RL332_STRGG     ---RPKITLACVECKERNYITKKNRNNPDRLEMKKHCPRCNSHTAHRETR
RL33_HELPY      ---KVKIGLKCSDCEDINYSTTKNAKNTEKLELKKFCPRENKHTLHKEIK
RL33_HELPS      ---KVKIGLKCSDCEDINYSTTKNAKNTEKLELKKFCPRENKHTLHKEIK
RL33_HELPJ      ---KVKIGLKCSDCEDINYSTTKNAKNTEKLELKKFCPRENKHTLHKEIK
RL33_HELPH      ---KVKIGLKCSDCEDINYSTTKNAKNTEKLELKKFCPRENKHTLHKEIK
RL33_HELHP      -----KIGLKCSECGDINYSTTKNAKNTEKLELKKFSPRLNKHTIHKEVK
RL332_STRCO     ---RPKITLACVECKERNYITKKNRNNPDRLEMKKHCPRCNAHTAHRETR
RL332_STRAW     ---RPKITLACVECKERNYITKKNRNNPDRLEMKKHCPRCNAHTAHRETR
RL332_SACEN     ---RPKITLACEECKHRNYITNKNRNDPDRLAMKKFCPNCGTHRVHKETR
RL332_MYCGI     ---RPKITLACEVCKHRNYITKKNRNDPDRLEIKKFCPNCGKHQAHKESR
RL331_MYCVP     ---RPKITLACEVCKHRNYITKKNRNDPDRLEIKKFCPNCGKHQAHKESR
RL333_STAAW     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL333_STAAS     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL333_STAAR     ----RKIPLNCEACGNRNYNVPKQEGTATRLTLKKYCPKCNAHTIHKESK
RL333_STAAN     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL333_STAAM     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL333_STAAC     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL332_NOCFA     ---RPKITLACEQCKHRNYITKKNRNDPDRLELKKFCPNCGTHRAHRESR
RL332_BACCN     ------ITLACTECGDRNYITKKNKNNPERIELKKYCPRLKRVTLHRETK
RL331_STAAT     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL331_STAAE     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL331_STAAB     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL331_STAA9     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL331_STAA2     ----RKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK
RL33_PELCD      ------ITLACTECKQRNYXXXXXXXXXERLEFNKYCRFCRKHTPHRETK
RL33_CAMJD      -----KVGLKCEECGDINYSTYKNSNTTEKLELKKYCPRLKKHTFHKEVK
RL333_BACC1     ------ITLACTECGDRNYISKKNKNNPERIELKKYCPRLKRVTLHRETK
RL333_BACAN     ------ITLACTECGDRNYISKKNKNNPERIELKKYCPRLKRVTLHRETK
RL332_MYCPU     ---KSKIALSCEKCKIKNYKT--NKSIIERLELKKFCSRCKEHTIHKEEK
RL332_BACCR     ------ITLACTECGDRNYISKKNKNNPERIELKKYCPRLKRVTLHRETK
RL33_HELAH      ---KVKIGLKCSDCEDINYSTTKNAKNTEKLELNKFCPRENKHTIHKEIK
RL33_BORGA      ------ISLICEETGIRNYTTTKNRNKQEKLELMKYCPKLRKHTLHKEGK
RL33_BORBZ      ------ISLICEETGIRNYTTTKNRNKQEKLELMKYCPKLRKHTLHKEGK
RL33_BORBU      ------ISLICEETGIRNYTTTKNRNKQEKLELMKYCPKLRKHTLHKEGK
RL33_BORAP      ------ISLICEETGIRNYTTTKNRNKQEKLELMKYCPKLRKHTLHKEGK
RL331_RHOSR     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGTHQSHRESK
RL33_SYNY3      MAKKGKITLECTECGVNRYTTMKNRNTTARLELKKFCTHCNKHTIHKETK
RL33_THEFY      ---RPKITLACQECKHRNYITRKNRRNTDRLELRKYCPNCRTHREHRETR
RL332_LISW6     ------ITLECTECGDRNYITTKNKRENERIELKKYCPRLRRVTLHRETK
RL332_BACP2     ------ITLACTECGERNYITKKNKNNPDRVEFKKYCSRDKKQTVHRETK
RL332_ACHLI     ---RELVKLVCTECGDENYHTTKNKKTTDRLEMSKYCPRTRKYTLHREKK
RL331_LISMO     ------ITLECTECGDRNYITTKNKRENERIELKKYCPRLRRVTLHRETK
RL331_LISMF     ------ITLECTECGDRNYITTKNKRENERIELKKYCPRLRRVTLHRETK
RL331_LISIN     ------ITLECTECGDRNYITTKNKRENERIELKKYCPRLRRVTLHRETK
RL331_BACSU     ------ITLACTECGERNYISKKNKNNPDRVEFKKYCPRDKKSTLHRETK
RL331_BACA2     ------ITLACTECGERNYISKKNKNNPDRVEFKKYCPRDKKSTLHRETK
RL332_MYCA9     ---RPKITLACETCKHRNYITKKNRNDPDRLEIKKFCPNCGSHQPHKESR
RL33_SYNP6      ------ITLECTECGVSRYTTQKNRNTTERLEIKKFCPHCNKHTAHKEIK
RL33_SYNE7      ------ITLECTECGVSRYTTQKNRNTTERLEIKKFCPHCNKHTAHKEIK
RL33_FRASN      ---RPKITMACQVCKHRNYITRKNRNDPDRLELRKFCPNCRTHTEHRETR
RL33_ARCB4      MANRIKIGLKCQESGDINYTTWKNPKHTEKFEVKKYCPRLKKHTTHKEVK
RL331_MYXXD     --NRSIISLECTVCKERNYTTTKNKRKSDKLELSKFCPRCRKHQDHKEGK
RL33_CYAP7      MASKKGVTLECTECGVSRYTTSKNRNTTGRLELKKFCTHCNKHTVHKEIK
RL332_OCEIH     ------ITLACTETGDRNYISTKNKRTNERIELKKYSPRLKKHTLHRETK
RL332_MYCGA     ---RKKIILICEHCLNRNYTTTRSKLETTRLVLNKYCSSCNQKTVHKES-
RL332_BACSK     -----QVTLACTETGDRNYITTKNKRTNERIELKKYSPRLKRHTLHRETK
RL332_BACLD     -----KITLACTETGDRNYITTKNKTNPDRLELKKYSPRLKRHTIHRETK
RL331_MYCSS     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGTHRAHKESR
RL331_MYCSK     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGTHRAHKESR
RL331_MYCS2     ---RPKITLACEVCKHRNYITKKNRNDPDRLEIKKFCPNCGTHQPHKESR
RL33_DEHSC      ------INMACTDCGERNYTTEKNKNDPRRIELSKYCPRCREAKVHRETK
RL33_DEHSB      ------INMACTDCGERNYTTEKNKNDPRRIELSKYCPRCREAKVHRETK
RL33_DEHE1      ------INMACTDCGERNYTTEKNKNDPRRIELNKYCPRCREAKVHRETK
RL333_BACP2     -----KITLACTETGDRNYITTKNKTNPDRLELKKYSPRLKKYTLHRETK
RL331_MYCSJ     ---RPKITLACEVCKHRNYITKKNRNDPDRLELKKFCPNCGVHRAHKESR
RK33_CYAME      ------ISLECTACGVNRYRTTKNKKNTNRLELKKFCPYCGHHTIHREIK
RL33_MICAN      MASKKGVRLICTECGVSRYTTSKNRNTTGRLEIKKYCPHCNKHTVHKEIK
RL33_CLOD6      -----KVTLACTECKQRXXXXXXXXXXXDRIELQKYCRFCKKHTTHKETK
RL33_BRAHW      ----EQIHLQCTECKRKNYITTKNKNVPEKLELKKYCPHDKKHTIHKELK
RL33_ALKMQ      -----KITLACTECKQRXXXXXXXXXXXDRMEMQKHCKFCKSHTLHKETK
RL332_EXIS2     -----KITLACTETGDRTYITKKNKNNPERLELKKYNPRLRKHTLHREVK
RL332_BACA2     ------VTLACTETGDRNYITTKNKRTNDRLEMKKYSPRLKKYTLHRETK
RL33_SYNP2      MASKKGVRITCTECGVSRYTTSKNRNTTGRLEIKKFCPHCNAHTVHKEIK
RL33_LYSSC      -----QITLACTETGDKNYITTKNKNNPERLELKKYSPRLKRTTLHRETK
RL33_CYAA5      MASKKGVTLECTECGVNRYTTSKNRNTTGRIELKKFCPHCNTHTVHKEIK
RK33_LEMMI      -----RVILECNSCGSRYVTQKNRHNTPSRLELKKFCRYCNKHTIHVEVK
RL33_MYCPE      MAIKKSIRLECGECKEINYLTFKNAKKPEKLELNKYCKRCRSAKPHKETK
RL33_CYAP8      MAAKKGVTLECTECGVSRYTTSKNRNTTGRMEIKKFCPHCNTHTIHKEIK
RK33_ANEMR      --------------GISRYTTQKNRRNTPRLELRKFCRYCGEHTIHKEMK
RL333_ENTFA     ------ITLECTSCKERNYLTNKNKNNPDRLEKQKYCPRERKVTLHRETK
RK33_CYAPA      ------VTLECTECGVSRYATKKNRRNTNRLELNKFCPYCKKHVLHREIK
RL332_STRTD     -----KINLKCSECGSLNYLTSKNQNHPEKIQVPKFCPKDRKVTLHVES-
RL332_STRT2     -----KINLKCSECGSLNYLTSKNQNHPEKIQVPKFCPKDRKVTLHVES-
RL332_STRT1     -----KINLKCSECGSLNYLTSKNQNHPEKIQVPKFCPKDRKVTLHVES-
RL332_LACBA     ------ITLECTECHERNYLSSKNRNNPDRVEFKKYCPRDRKVTLHRETK
RL331_MYCGE     MAVKRSTRLGCNECSEINYLTFKNVKKNEKLALNKFCSRCRKVVLHKEVK
RK33_POPTR      MANGKRVILECTSCVSRYITQKNRHNRPSRLELRKFCPYCYKHTIHGEIK
RK33_POPAL      MANGKRVILECTSCVSRYITQKNRHNRPSRLELRKFCPYCYKHTIHGEIK
RL332_LACJO     ------IILECTECGDRSYLSEKNKRKPERLALKKYCPVERKVTLHRETK
RL332_LACGA     ------IILECTECGDRSYLSEKNKRKPERLALKKYCPVERKVTLHRETK
RK33_PELHO      --NRGKVTLECTGCGIYRYLTQKNPKNTPSLELRKFCPYCNKHTIHGEIK
RK33_ANGEV      ------ITLECISCDRNNYTTRKNQRNTPRLELKKFCPYCSEHTIHRELK
RK33_ADICA      MANTKDIALECTSCIQRKYTTRKNRRNTPRLELEKYCFHCHKHTLHKESK
RL33_UREPA      MAIKRGVRLQCNESKSINYITTKNANNPDRLSLNKFCPKCRKVTTHVEIK
RL33_UREP2      MAIKRGVRLQCNESKSINYITTKNANNPDRLSLNKFCPKCRKVTTHVEIK
RL33_LACAC      ------IILECTECGDRSYLSKKNKRKPERLSLKKYCPVERRATLHRETK
RL332_MYCPN     ---RKKIIFVCQDCLSRNYVMSWSKQVLNRLIINKYCKHCNQKTKHLDS-
RL331_LACH4     ------IILECTECGDRSYLSKKNKRKPERLSLKKYCPVERRATLHRETK
RK33_PHYPA      --------------GVSRYTTQKNRRNTPRLELKKFCSYCNKHTIHKEIK
RL331_LACSS     ------ITMECTECHERSYLSNKNKNNPDRLELKKYCPRERKVTLHRETK
RL33_GEOBB      ------ITLGCTECKQRXXXXXXXXXXXQKLEFNKYCRFCQKHTLHKETK
RL331_STRPM     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRPG     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRPF     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRPD     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRPC     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRPB     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRP6     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRP3     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL331_STRP1     -----KINLECSECGSNNYLTSKNSSHPEKIKVPKYCPKERKVTLHVET-
RL33_STRMU      -----KINLQCSHCGSKNYLTSKNKNHPEKIQVPKYCPKERKVTLHIES-
RL331_STRA5     -----KINLKCSSCGSKNYLTSKNSNHPDKIEVPKYCPKERKVTLHIES-
RL331_PEDPA     ------ITLECTECHNRQYLSNKNKNNPDRLELNKYCPRERKVTLHKETK
RL331_MYCPU     --------LACKECKMENYSXXXXXXHVEKLEINKFCSKCNSKTMHREKK
RL331_LACS1     ------ITLECTECHEQTYLTSKNKNNPDRIELKKYCPRDHKVTLHRETK
RL331_LACDB     ------IILECTECGDRSYLSKKNKRKPERLTLKKYCPVERQVTLHRETK
RL331_LACDA     ------IILECTECGDRSYLSKKNKRKPERLTLKKYCPVERQVTLHRETK
RK33_VITVI      -----RVLLECTSCGISRYITEKNRHNTPRLELQKFCPYCYKHTIHGEIK
RK33_MARPO      --------------GISRYTTQKNRRNTPRLELKKFCCYCNKHTIHKEIK
RL331_MYCGA     MAQKRGTRLGCNDCNEINYITRKNAKKNEKLSLNKYCSRCRGTTVHKEVK
RK33_SPIOL      -----KVILECTGCGSRGYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_PHATR      ------ITLECTECGVSRYSTQKNRNNPERLELKKYCSHCNKTTLHKEIK
RK33_ODOSI      ------ITLECTECGVSRYTTQKNRNNPERIELKKYCPHCNKSTIHKEIK
RK33_MANES      -----RVILECTTCTSRYITQKNRHNTPSRLELRKFCRYCYKHTIHGEIK
RK33_CRYJA      ------ITLECTSCGISRYTTRKNRRNTPRLELKKFCPYCYKHTIHGEIK
RK33_CITSI      -----RVILECTSCGISRYITQKNRHNTSRLELRKFCPYCYKHTLHGEIK
RL33_SYNWW      ------ITLACSECKQRNYMTTRDXXXXXXXXXXXYCRFCNTHTLHKEIK
RK33_STAPU      ------ITLECTNCGISRYTTQKNRRNTNRLELKKFCPHCSLHTLHKEIK
RK33_LIRTU      ------VILQCTSCGTSRYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_CHLAT      ------ITLECTNCKSNDYTTQKNRRNTNRLELKKFCSRCNQHTLHKEIK
RL332_MYCAP     --------LFCTDCKMENYISKKNKKNTEKVELKKFCAKCNASTLHKEKK
RK33_NANDO      -----RVILECNSCGISRYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_DRIGR      -----RVILECTSCGISRYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_BUXMI      -----RVILECTSCGISRYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_BARVE      ---------------SRYITQKNRHNTPSRLELRKFCPYCSKHTIHGEIK
RL332_SYNSC     ------VTLECTECGVSRYTTTKNRNNLERLELMKFCPQLNRMTLHREIK
RL332_MYCGE     ---RKKIIFVCQDCLSRNYVKRWTKQPLQRLIINKYCKQCNQKTKHLDS-
RK33_ORYSJ      -----RVILQCVSCGISRYSTQKNRHNTPQLELRKFCRYCRKHTIHAEIK
RK33_ORYSI      -----RVILQCVSCGISRYSTQKNRHNTPQLELRKFCRYCRKHTIHAEIK
RK33_ORYSA      -----RVILQCVSCGISRYSTQKNRHNTPQLELRKFCRYCRKHTIHAEIK
RK33_ORYNI      -----RVILQCVSCGISRYSTQKNRHNTPQLELRKFCRYCRKHTIHAEIK
RK33_COFAR      ------VILECTDCGISRYITQKNRHNTNRLELKKFCPYCYKHTVHGEIK
RK33_CERDE      -----RVILECTSCASRYITQKNRHNTPSRLELRKFCPYCYKHTTHGEIK
RK33_CALFG      ---------------SRYITQKNRHNTPSRLELKKFCSYCYKHTIHAEIK
RK33_ACOCL      ---------------SRYITQKNRHNTSSRLELRKYCRYCYKHTIHGEIK
RL33_FUSNN      -----QVILECTETKLRHYTTTKNKKHPERLEMMKYNPVLKKHTLYKETK
RK33_TOBAC      ------VILECTSCGISRYITQKNRHNTNRLELKKFCPYCYKHTIHGEIK
RK33_PINTH      ------ITLECTSCGISRYTTRKNRRNTPRLESNKFCPYCYKHTIHGEIK
RK33_PINKO      ------ITLECTSCGISRYTTRKNRRNTPRLESNKFCPYCYKHTIHGEIK
RK33_PANGI      ------VILECTSCGISRYITQKNRHNTNRLELRKFCPYCYKHTIHGEIK
RK33_NICTO      ------VILECTSCGISRYITQKNRHNTNRLELKKFCPYCYKHTIHGEIK
RK33_NICSY      ------VILECTSCGISRYITQKNRHNTNRLELKKFCPYCYKHTIHGEIK
RK33_LACSA      ---------------SRYITQKNRHNTPNRLELRKFCPYCYKHTIHGEVK
RK33_FAGEA      ------VILECTSCVRKNYITQKNRRNTSRLELRKFCPYCYKHTIHGEIK
RK33_EUCGG      ------VILECTNCGVSRYITQKNRHNTSRLELRKFCPYCYKHTIHGEIK
RK33_ATRBE      ------VILECTSCGISRYITQKNRHNTNRLELKKFCPYCYKHTIHGEIK
RK33_ANTFO      ------ITLECTSCGVSRYVSEKNRRNTPRLELKKFCPYCYKHKIHREIK
RL331_STRPN     -----KINLKCSSCGSINYLTSKNKTHPDKIEVLKYCPKERKVTLHLESK
RK33_ZYGCR      ------VTLECTNCASRYITQKNRRNTPNRLELNKFCPYCVGHTVHKEIK
RK33_SORBI      -----RVILECISCGISRYSTQKNRHNTPQLELRKFCRYCRKHTTHNEIK
RK33_SACOF      -----RVILECISCGISRYSTQKNRHNTPQLELRKFCRYCRKHTTHNEIK
RK33_SACHY      -----RVILECISCGISRYSTQKNRHNTPQLELRKFCRYCRKHTTHNEIK
RK33_PLAOC      ---------------SRYITQKNRHNTPSRLELRKFCPYCFKHTIHGEIK
RK33_OLIPU      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_NASOF      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_MAIZE      -----RVILECISCGISRYSTQKNRHNTPQLELRKFCRYCRKHTTHNEIK
RK33_LOBMA      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_LEPVR      ---------------SRYITQKNRHNTPSRLELRKFCAYCYKHTIHGEIK
RK33_GOSHI      ---------------SRYITQKNRHNTPSRLELKKFCPYCYKHTIHGEIK
RK33_GOSBA      ---------------SRYITQKNRHNTPSRLELKKFCPYCYKHTIHGEIK
RK33_DRANE      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_CRUWA      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_CHLSC      ---------------SRYITQRNRHNTPNRLELRKFCPYCYKHTIHGEIK
RK33_CARPA      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_CAPBU      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_ARATH      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_ARAHI      ---------------SRYITQKNRHNTPSRLELRKFCPYCFKHTIHGEIK
RK33_AETGR      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RK33_AETCO      ---------------SRYITQKNRHNTPSRLELRKFCPYCYKHTIHGEIK
RL33_THEEB      ------------------------------LELKKFCRYCNKHTIHREIK
RL33_LACRD      ------ITLECTSCHERTYLTSKNRRHNDRLELNKYCPREQKVTLHRETK
RL332_SORC5     ------IKLTCGNCGRANYHTTKNKRTTDKFVIKKFCPTERKHTEHKEGK
RL332_LACRJ     ------ITLECTSCHERTYLTSKNRRHNDRLELNKYCPREQKVTLHRETK
RL332_LACLS     -----KITLICSSCGNKNYISSKNATHPEKVETMKFCPKERIVTLHRE--
RL332_LACLM     -----KITLICSSCGNKNYISSKNATHPEKVETMKFCPKERIVTLHRE--
RL332_LACF3     ------ITLECTSCHERTYLTSKNRNNPDRLELNKYCPREHKVVLHRETK
RL331_LACLC     -----KITLICSSCGNKNYISSKNATHPEKVETMKFCPKERIVTLHRE--
RL331_LACLA     -----KITLICSSCGNKNYISSKNATHPEKVETMKFCPKERIVTLHRE--
RK33_PIPCE      ---------------SRYITQRNRHNTPGRLELRKFCPYCHKHTIHGEIK
RK33_JASNU      -APRVRVILECTGCVSRYITQKNRHNTSKQLELRKFCPYCHKHMIHGEIK
RK33_CYACA      ---------------SRYTTIKNRKNNPSRMELKKFCPYCNMRTIHKEIK
RK33_CICAR      ------VILECTSCDSRYITQKNRHNTPSRLELRKFCPFCCKHTIHAEIK
RK33_AMBTC      -----RVILECTSCTSRYITEKNRHNTPSRLELKKFCPYCSKHMIHAEIK
RL33_MYCS5      --------LECTSCKMQNYISKKNKKHPEKVKLSKYCSKCSKHSVHKERK
RL33_FERNB      -----QVGLKCEECGNRNYYTTXXXXXXXXXXXXXXXXXCNKHTFHTETK
RK33_WHEAT      -----RVILECISCGISRYSTQKNRHNTPQLEFKKFCRYCRKHTTHHEIK
RK33_NYMAL      ---------------SRYITQKNRHNTPGRLELKKFCPYCYKHTIHGEIK
RK33_LOLPR      -----RVILECISCGISRYSTQKNRHNTPQLEFKKFCRYCRKHTTHHEIK
RK33_HORVU      -----RVILECISCGISRYSTQKNRHNTPQLEFKKFCRYCRKHTTHHEIK
RK33_CYCTA      -----KITLECTSCGVSRYITQKNRRNTPRSELKKFCPYCYKHTIHGEIK
RK33_BRADI      -----RVILECISCGISRYSTEKNRHNTPQLEFKKFCRYCRKHTTHHEIK
RK33_AGRST      -----RVILECISCGISRYSTQKNRHNTPQLEFKKFCRYCRKHTTHHEIK
RL33_ANADF      --NRSIITLECKTCKERNYXXXXXXXXXQKLALSKFCPRCRKHVDHKETK
RL332_MYCA5     ---REGLTLRCETCKMENYITKKNKKHPDKMEVTKYCPKCNQHTNHKEKK
RK33_THAPS      ------ITLECTECRSRYLTQKNRRNNPQRMELKKYCPHCNKPTIHKEIK
RK33_SOLTU      ------VILECTSCGISRYITQKNRHNTNRFELKKFCPYCYKHTIHGEIK
RK33_SOLLC      ------VILECTSCGISRYITQKNRHNTNRFELKKFCPYCYKHTIHGEIK
RK33_SOLBU      ------VILECTSCGISRYITQKNRHNTNRFELKKFCPYCYKHTIHGEIK
RK33_ILLOL      ------VILECTSCASRYITEKNRHNTPGRLELIKFCPYCYKHTIHGEIK
RK33_HELAN      ---------------SRYITQKNRHNTPNRLELLKFCPYCYKHTIHGEIK
RK33_GUIAB      ---------------SRYITQKNRHNTPNRLELLKFCPYCYKHTIHGEIK
RL33_CYAP4      ------ITLECTECRSNPAKRSAGVSRXARLELNKFCPHCNKHTVHKEIK
RK33_PHAAO      ---------------SRYITQKNRHNTPNRLEFRKFCRYCQKYTIHGEIK
RK33_DAUCA      ---------------SRYITEKNRHNTPNRLELRKFCPFCYKHTMHGEIK
RK33_CUSEX      ------VILECTSCASRYITQKNRHNTPNRLEFQKFCPRCYKHTLHGEIK
RL33_SYNFM      ------VTLACSECXXXXXXXXXXXXXXEKLSFKKYCRFCHAHTEHKETK
RK33_IPOPU      ------VILECTSCGISRYITQKNRHNTPNLELKKFCPYCYKHTIHGEIK
RL33_PETMO      MAAKSQISLKCTECXXXXXXXXXXXXXXXXIELKKYCPHCRKHTLHVESK
RL33_CAMHC      -ANRVKIGLKCSECGDXXXXXXXXXXXXXXIELKKYCPRLKKHTVHKEIK
RK33_EPIVI      ---------------SRYITQKNRRNTPNRLELRKFCPYCYKHMIHGEIK
RK33_CUSRE      ------VILECTSCAQNNVNVNKRHNTPNRLEFKKFCPRCYKHTLHGEIK
RL33_PROMA      ------VTLECTECGVSRYTTEKNRNTSDRLELKKFCPQLNKMTIHKEIK
RL331_STRR6     -----KINLKCSSCDSINYLTSKNKTHPDKIEVLKYCPKERKVTLHLESK
RL331_STRPI     -----KINLKCSSCDSINYLTSKNKTHPDKIEVLKYCPKERKVTLHLESK
RK33_SOYBN      ---------------SRYITKKNRQNTPSRLELRKFCPRCCKHTIHAEIK
RK33_MESVI      ------ITLECTSCKNNNYMTQKNRRNTNRLELKKFCSHCNQSTIHKEIK
RK33_GRATL      --------------GIFRYTSTKNRKNTNRIELMKFCPYCNKHQKFREIK
RK33_DIOEL      -----RIILECASCVSRYITQKSRHNTPNRLELRKYCHYCRTHTIHGEIK
RL33_SALRD      --DRVQVILECTEPGTSRYHTTKNKNTSDRLELMKYNPVLQKHTLHREKK
RL33_PELTS      ------VTLACTECXXXXXXXXXXXXXXXXIEMKKYCRFCQTHTLHKETR
RK33_WELMI      ----------------RYITKKNRHNKSTPLELKKFCPFCLKHTIHKERK
RK33_CUCSA      ------VILECTRCGISRYITQKNRHNTSRLELRKFCPRCYKHTIHGEIK
RL33_GLOVI      ------ITLECTEC--RTNTAKRRPGVSRXMELKKFCPNCNKHTVHKETK
RL33_ANAVT      ------VTLECTECRSRYTSXXXXXXXXXXLELKKFCTHCNKHTVHKEIK
RL33_ANASP      ------VTLECTECRSRYTSXXXXXXXXXXLELKKFCTHCNKHTVHKEIK
RK33_PEA        ---------------SRYITKKNRHNTPSRLELRKFCPFCCKHMIHAEIK
RK33_MORIN      ---------------SRYITQKNRHNTPSRLELRKFCPSCYKHTIHGELK
RL33_PROA2      --NRVIITLECTEARKEGYTTTKNKNQTERLVLKKYNPSLKKHTLHKEIK
RL33_NOSP7      ------ITLECTECRTNSDKRSAGVSRXXXLELKKFCTHCNKHTVHKEIK
RL331_MYCH7     ---------------NRNYKT--NKSVQSRLQINKFCKICRKSTLHQEEK
RK33_HUPLU      ------ISLECTGCSQGNYTTQKNRRNTPRIELKKFCPYCYRRTICREIK
RK33_GNEPA      ----------------RYITQKNRQNKPTPLELKKFCPFCLKHTVHKEIK
RL33_SYNJB      -----------------------------RLELKKFCPHCNRHTVHKEIK
RL33_SULDN      ----------------------------EKFSVKKYCKFCREHTLHKEMK
RL33_RHOBA      --SKKKIFLVCEETGQYNYTLRKKPG-GEKLRLKKYNPNLRKHTWHAEKK
RK33_PSINU      MAKKVKGALECIDCNNQQYTTQKNRNTPTRLELKKFCPSCSKHTIHIE--
RK33_CUSOB      ---------------SRYITQKNRHNTPNRLELKKFCPHCYKHIIHGEIK
RL33_TRIEI      ------ITLECTECRT-------NPNKRSQLELKKFCTHCNRHTVHKEIK
RL33_HERA2      --NRIVITLACTECGXXXXXXXXXXXXXXXLELMKYCPRLRKRTLHRETK
RK33_OENPA      ------VILECTNCGISRYITEKNRHNTPQLELKKFCPYCYKQTIHGEIK
RK33_OENGL      ------VILECTNCGISRYITEKNRHNTPQLELKKFCPYCYKQTIHGEIK
RK33_OENEH      ------VILECTNCGISRYITEKNRHNTPQLELKKFCPYCYKQTIHGEIK
RK33_OENBI      ------VILECTNCGISRYITEKNRHNTPQLELKKFCPYCYKQTIHGEIK
RK33_OENAR      ------VILECTNCGISRYITEKNRHNTPQLELKKFCPYCYKQTIHGEIK
RK33_CUSGR      -----KIILECTGCGVSRYITQKNRHNTNRLELKKFCPRCYKHIIHGEIK
RL33_SOLUE      ----------------------------ERLEMKKFCRHCRKHQGHKEIK
RL33_PROM3      ------------------------------LEIKKFCRYCNKSTTHKEIK
RL33_SYNJA      -----------------------------RLELKKFCPKCNRHTVHKEIK
RL33_ACTPJ      --NREKIRLVSSAETGHFYTTTKNKNMPEKMEIKKFDPVVRKHVIYKEAK
RL33_ACTP7      --NREKIRLVSSAETGHFYTTTKNKNMPEKMEIKKFDPVVRKHVIYKEAK
RL33_ACTP2      --NREKIRLVSSAETGHFYTTTKNKNMPEKMEIKKFDPVVRKHVIYKEAK
RL33_PROMP      ------VTLECTEAGVSRYTTEKNKNTTERLELKKFNPHLNKMTIHKEIK
RL33_PROM5      ------VTLECTEAGISRYTTEKNKNTTERLELKKFNPHLNKMTIHKEIK
RL33_ANASK      --NRSIITLECKTCKERNYXXXXXXXXXXXXXLSKYCPRCRKHVEHKETK
RL33_ANADE      --NRSIITLECKTCKERNYXXXXXXXXXXXXXLSKYCPRCRKHVEHKETK
RL33_ANAD2      --NRSIITLECKTCKERNYXXXXXXXXXXXXXLSKYCPRCRKHVEHKETK
RL33_ACIBL      -----------------------------RLEFSKFCRKCRKHTSHKEVK
RL33_ACAM1      ------VTLECTECRSNSNKRSPGXXXXXXLELKKFCTHCNKHTNHKEIK
RL332_MESFL     ---REKYILRCTECKNENY-IGXXXXXXXXXXXXXFCSNCNKHELHKQKK
RL33_BACV8      --NRVQVILECTEMGTSRYITTKNKNTTERLELKKYNPILKRVTVHKEIK
RK33_LOTJA      ---------------SRYITQKNRHNTPSRLELIKFCPCCRKHMIHAEIK
RL44_ARCFU      -------------------------------KVKTFCRYCGKHTLH----
RL33_PARD8      --NRVQVILECTEHGMSRYITTKNKNTTQRLELMKYNPVLKKMTLHKEIK
RL33_HAEDU      --NREKIKLVSTAETGHFYTTTKNKNMPEKMEIKKFDPVVRKHVIYKEAK
RL33_ELUMP      MASKERILLACTECKNKNYYYARGXXXXXXXXXXXXXXACGKSTKHKEGK
RK33_PORYE      --------------GVFRYTTTKNRRNTSRIELNKFCPNCNQHCIFKEIK
RL33_METFK      ---REKIKLESSAGTGHFYTTTKNKRTMEKMEIKKFDPVARKHVLYKETK
RL33_HAEPS      --NREKIKLVSTAETGHFYTTTKNKNMPEKMEIKKFDPVVRKHVVYKEAK
RL33_DICNV      ---RELIRLVSSEGTGHFYTTTKNKRNTEKMEVKKFDPVARKHCIYKEAK
RL33_BORRA      ------IALVCEETGXXXXXXXXXXXXQEKLELMKYCPSLRKHTLHKEGK
RL33_BORDL      ------IALVCEETGXXXXXXXXXXXXQEKLELMKYCPSLRKHTLHKEGK
RL33_BACTN      --NRVQVILECTEHGTSRYITTKNKNTTERLELKKYNPILKRVTVHKEIK
RL33_BACFR      --NRVQVILECTEHGTSRYITTKNKNTTERLELKKYNPILKRVTVHKEIK
RL33_BACFN      --NRVQVILECTEHGTSRYITTKNKNTTERLELKKYNPILKRVTVHKEIK
RL331_SYNSC     ------------------------------LEIKKFCPHCNKSTIHKEIK
RK33_PORPU      ------------KAGVFRYTTTKNRRNTPRIELKKFCPNCNSHCVFKEIK
RL33_NITEC      ---REKIKLESSAGTGHFYTTTKNKRANEKLELKKFDPVARKHVMYKETK
RL33_FLAPJ      --NRIQVILECTEAGTSRYITTKNKKNTDRLEIKKFNPVLKRVTVHKEIK
RL33_CYTH3      --NRIQVILECTEHKSRHITTKNRKNTPERIELKKYNSVLKKYTIHKEIK