[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00071.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
    8::263     5e-42  39%  265 aa  P5CR_AQUAE RecName: Full=Pyrroline-5-carboxylate reductase;        
   12::271     4e-41  35%  276 aa  P5CR1_ARATH RecName: Full=Pyrroline-5-carboxylate reductase;       
    4::264     6e-41  37%  269 aa  P5CR_SHIFL RecName: Full=Pyrroline-5-carboxylate reductase;        
    4::264     6e-41  37%  269 aa  P5CR_ECOLI RecName: Full=Pyrroline-5-carboxylate reductase;        
   15::265     8e-40  36%  278 aa  P5CR_ACTCH RecName: Full=Pyrroline-5-carboxylate reductase;        
   19::263     4e-37  38%  288 aa  P5CR3_DANRE RecName: Full=Pyrroline-5-carboxylate reductase 3;     
    1::261     4e-37  33%  320 aa  P5CR2_MACFA RecName: Full=Pyrroline-5-carboxylate reductase 2;     
    1::266     5e-37  32%  320 aa  P5CR1_BOVIN RecName: Full=Pyrroline-5-carboxylate reductase 1,
    1::261     9e-37  33%  320 aa  P5CR2_BOVIN RecName: Full=Pyrroline-5-carboxylate reductase 2;     
    5::265     1e-35  30%  270 aa  P5CR_METAC RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     2e-35  32%  320 aa  P5CR2_RAT RecName: Full=Pyrroline-5-carboxylate reductase 2;       
    1::261     2e-35  33%  309 aa  P5CR1_MOUSE RecName: Full=Pyrroline-5-carboxylate reductase 1,
    1::261     2e-35  33%  319 aa  P5CR1_PONAB RecName: Full=Pyrroline-5-carboxylate reductase 1,
    1::261     2e-35  33%  319 aa  P5CR1_HUMAN RecName: Full=Pyrroline-5-carboxylate reductase 1,
    1::261     4e-35  32%  320 aa  P5CR2_MOUSE RecName: Full=Pyrroline-5-carboxylate reductase 2;     
    3::262     7e-34  31%  267 aa  P5CR_SYNY3 RecName: Full=Pyrroline-5-carboxylate reductase;        
   10::269     3e-33  32%  274 aa  P5CR3_MOUSE RecName: Full=Pyrroline-5-carboxylate reductase 3;     
    3::261     3e-33  31%  278 aa  P5CR2_BACSU RecName: Full=Pyrroline-5-carboxylate reductase 2;     
   11::253     1e-31  32%  278 aa  P5CR_VIBAL RecName: Full=Pyrroline-5-carboxylate reductase;        
    4::265     1e-31  32%  270 aa  P5CR_CORML RecName: Full=Pyrroline-5-carboxylate reductase;        
    4::265     1e-31  32%  270 aa  P5CR_CORGL RecName: Full=Pyrroline-5-carboxylate reductase;        
   18::279     1e-31  31%  297 aa  P5CR1_BACSU RecName: Full=Pyrroline-5-carboxylate reductase 1;     
    1::261     2e-31  30%  320 aa  P5CR2_HUMAN RecName: Full=Pyrroline-5-carboxylate reductase 2;     
    1::261     2e-31  30%  320 aa  P5CR2_PONAB RecName: Full=Pyrroline-5-carboxylate reductase 2;     
    1::261     1e-30  28%  263 aa  P5CR_TREPA RecName: Full=Pyrroline-5-carboxylate reductase;        
   19::289     3e-30  39%  299 aa  P5CR_CAEEL RecName: Full=Putative pyrroline-5-carboxylate
    9::267     3e-30  30%  274 aa  P5CR3_XENLA RecName: Full=Pyrroline-5-carboxylate reductase 3;     
   13::271     1e-29  32%  274 aa  P5CR_SOYBN RecName: Full=Pyrroline-5-carboxylate reductase;        
   10::269     2e-29  30%  274 aa  P5CR3_RAT RecName: Full=Pyrroline-5-carboxylate reductase 3;       
   10::263     5e-29  30%  274 aa  P5CR3_MACFA RecName: Full=Pyrroline-5-carboxylate reductase 3;     
   10::269     1e-28  31%  274 aa  P5CR3_HUMAN RecName: Full=Pyrroline-5-carboxylate reductase 3;     
    1::244     6e-28  29%  271 aa  P5CR_STAHJ RecName: Full=Pyrroline-5-carboxylate reductase;        
  120::270     2e-27  36%  273 aa  P5CR_PEA RecName: Full=Pyrroline-5-carboxylate reductase;       
    1::261     3e-27  26%  271 aa  P5CR_STAES RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     3e-27  26%  271 aa  P5CR_STAEQ RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAW RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAS RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAR RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAN RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAM RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::261     8e-27  24%  271 aa  P5CR_STAAC RecName: Full=Pyrroline-5-carboxylate reductase;        
   12::265     8e-27  29%  308 aa  P5CR3_BOVIN RecName: Full=Pyrroline-5-carboxylate reductase 3;     
    1::244     5e-26  26%  271 aa  P5CR_STAS1 RecName: Full=Pyrroline-5-carboxylate reductase;        
    6::265     5e-26  29%  271 aa  P5CR_HAEIN RecName: Full=Pyrroline-5-carboxylate reductase;        
    7::279     1e-24  28%  282 aa  P5CR_SCHPO RecName: Full=Pyrroline-5-carboxylate reductase;        
    8::275     1e-24  29%  551 aa  P5CR1_DICDI RecName: Full=Pyrroline-5-carboxylate reductase 1;     
    6::241     2e-23  31%  275 aa  P5CR_PASMU RecName: Full=Pyrroline-5-carboxylate reductase;        
   12::283     9e-23  28%  299 aa  P5CR2_DICDI RecName: Full=Pyrroline-5-carboxylate reductase 2;     
   76::272     1e-21  31%  286 aa  P5CR_YEAST RecName: Full=Pyrroline-5-carboxylate reductase;        
    5::259     9e-21  26%  273 aa  P5CR_PSEAE RecName: Full=Pyrroline-5-carboxylate reductase;        
   46::288     2e-18  31%  295 aa  P5CR_MYCTU RecName: Full=Pyrroline-5-carboxylate reductase;        
   46::281     3e-18  28%  294 aa  P5CR_MYCLE RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::249     4e-18  26%  261 aa  P5CR_THET2 RecName: Full=Pyrroline-5-carboxylate reductase;        
   85::286     3e-13  32%  320 aa  P5CR_ZALAR RecName: Full=Pyrroline-5-carboxylate reductase;        
   90::290     7e-13  31%  332 aa  P5CR_NEUCR RecName: Full=Pyrroline-5-carboxylate reductase;        
    1::242     2e-11  23%  273 aa  COMER_BACSU RecName: Full=ComE operon protein 4;
    1::245     2e-10  25%  251 aa  P5CR_METSM RecName: Full=Pyrroline-5-carboxylate reductase;        
    6::254     5e-10  27%  257 aa  P5CR_HELPY RecName: Full=Pyrroline-5-carboxylate reductase;        
    6::254     1e-08  22%  257 aa  P5CR_HELPJ RecName: Full=Pyrroline-5-carboxylate reductase;        
  281::351     3e-05  34%  566 aa  GLYR1_ANOGA RecName: Full=Putative oxidoreductase GLYR1 homolog;   
  102::188     5e-05  36%  511 aa  TYPH_THEPD RecName: Full=Putative thymidine phosphorylase;       
    2::84      7e-05  29%  267 aa  ASPD_METVS RecName: Full=Probable L-aspartate dehydrogenase;     
   80::161     3e-04  30%  344 aa  CN148_XENTR RecName: Full=Pyrroline-5-carboxylate reductase-like
   40::97      3e-04  34%  347 aa  3HIDH_ARATH RecName: Full=Probable 3-hydroxyisobutyrate
  274::346     3e-04  30%  559 aa  GLYR1_AEDAE RecName: Full=Putative oxidoreductase GLYR1 homolog;   
    2::92      4e-04  31%  267 aa  ASPD_METMP RecName: Full=Probable L-aspartate dehydrogenase;     
    2::92      4e-04  31%  267 aa  ASPD_METM6 RecName: Full=Probable L-aspartate dehydrogenase;     
    2::92      6e-04  31%  267 aa  ASPD_METM7 RecName: Full=Probable L-aspartate dehydrogenase;     
    2::92      6e-04  29%  267 aa  ASPD_METM5 RecName: Full=Probable L-aspartate dehydrogenase;     
   11::90      6e-04  39%  344 aa  ARGC_CLOK5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   11::90      6e-04  39%  344 aa  ARGC_CLOK1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   13::87      0.001  31%  446 aa  Y612_METJA RecName: Full=Probable arogenate/prephenate
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
P5CR_AQUAE      MRVGIVGFGNMGQAFAL-CFSKKLGKENIIVTDKVQEKRNL-ATEMGIAFASDVKFLADNSDVVLVAVKP
P5CR1_ARATH     -KVGFIGAGKMAESIARGVVASGVLPPNRICTAVHSNNRRDVFESFGVNVFSTSEEVVKESDVVIFSVKP
P5CR_SHIFL      -KIGFIGCGNMGKAILGGLIASGVLPGQIWVYTPSPDKVAALHDQFGINAAESAQEVAQIADIIFAAVKP
P5CR_ECOLI      -KIGFIGCGNMGKAILGGLIASGVLPGQIWVYTPSPDKVAALHDQFGINAAESAQEVAQIADIIFAAVKP
P5CR_ACTCH      -KLGFIGAGKMAESIARGVVKSGVRIRTAHLGSARREAFESF----GVKVLDRNDQVVEDSDVIIFSVKP
P5CR3_DANRE     IKIGFIGAGNMAFGVAQGIIASGVPPSNIIISAPSMNNLPRF-KEKGVSVTHSNHEVVGGSRLIFLAVKP
P5CR2_MACFA     MSVGIIGAGQLAYALARGFTAAGIVSAHKIIASSPEMNLPTVSRKMGVNLTRSNKETVKHSDVLFLAVKP
P5CR1_BOVIN     MSVGFIGAGQLAFALAKGFTAAGVVAAHKIMASSPDMDLATVSRKMGVNLTHHNKETVQHSDVLFLAVKP
P5CR2_BOVIN     MSVGFIGAGQLACALARGFTAAGILSAHKIIASSPEMDLPTVSRKMGVNLTRSNKETVRHSDVLFLAVKP
P5CR_METAC      -KIGFIGAGKMGSALMQGTIKAGVTPENIGASDVYEPFLKDLQAKLGIRVSTDNAVIVRESDILILAVKP
P5CR2_RAT       MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPEMDLPTVSRKMGVNLTRSNKDTVRHSDVLFLAVKP
P5CR1_MOUSE     MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDQATVSRKIGVNLTPHNKETVRHSDVLFLAVKP
P5CR1_PONAB     MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
P5CR1_HUMAN     MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSRKMGVKLTPHNKETVQHSDVLFLAVKP
P5CR2_MOUSE     MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPDMDLPTVSRRMGVNLTRSNKDTVRHSDVLFLAVKP
P5CR_SYNY3      IQLGIIGGGVMAEAILARLIAEKTYAEEIIVGEPHGARRDYLQKTYQVRVSPDNQEAANVSEVLLLAVKP
P5CR3_MOUSE     -RVGFVGAGRMAEAIARGLIQAGVEAKQV-LASAPTDNNLCHFRALGCQTTHSNHEVLQNCPLVIFATKP
P5CR2_BACSU     -KIGFVGAGSMAEAMINGILQSGI-TKPEHIYITNRSNDEIELKETSVRPCRDKNEFFTHTDIIILAFKP
P5CR_VIBAL      -KIAFIGAGNMVRAIVSGLVANGYPAQNITATAPSEARRLPLEQDFGIRTTSDNIQAATEADVVVLSVKP
P5CR_CORML      --IAVIGGGQIGEALVSGLIAANMNPQNIRVTNRSEERGQELRDRYGILNMTDNSQAADEADVVFLCVKP
P5CR_CORGL      --IAVIGGGQIGEALVSGLIAANMNPQNIRVTNRSEERGQELRDRYGILNMTDNSQAADEADVVFLCVKP
P5CR1_BACSU     -KVAFIGAGSMAEGMISGIVANKIPKQNICV--TNRSNTERLTEQYGIKGALPNQLCIEDMDVLILAMKP
P5CR2_HUMAN     MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSRKMGVNLTRSNKETVKHSDVLFLAVKP
P5CR2_PONAB     MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSRKMGVNLTRSNKETVKHSDVLFLAVKP
P5CR_TREPA      MNVGFLGFGAMGRALAEGLVHAGLQAAQVYACALNQEKLRAQCTSLGIGACASVQELVQKSEWIFLAVKP
P5CR_CAEEL      ----FIGGGNMAAAIIKGCQNKGFTPKNIVIGVQTEKSAEKWRQLGYKNVFTNTLEMLERTAIYVICVKP
P5CR3_XENLA     LPVGCIGAGRMAQGILEGILHKGITPQNVMVSAPTDRNLEKLKAR-GCCTSHDNRSVVSNCRVVFLATKP
P5CR_SOYBN      --LGFIGAGKMAESIARGAVRSGVLPPSVHFNLARRGAFESF----GVTVLPXXXXXXXXXXXXXXXXKP
P5CR3_RAT       -RVGFVGAGRMAEAIAQGLIRAGVEAKQVLASAPTDKNL-CHFRALGCQTTHSNHEVLQNCPLVIFATKP
P5CR3_MACFA     -RVGFVGAGRMAGAIAQGLIRAGVEAQRI-VASAPTDRNLCHFQALGCQTTHSNQEVLQSCLLVIFATKP
P5CR3_HUMAN     -RVGFVGAGRMAGAIAQGLIRAGVEAQHI-LASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKP
P5CR_STAHJ      MKLVFYGAGNMAQAIFKGIISKKLKSHDIYL--TNKSNEEAFAEELGVEYSYDDEKLLQDADYVFLGSKP
P5CR_PEA        ----------------------------------------------------------------------
P5CR_STAES      MKLVFYGAGNMAQAIFTGIISNNLNANDIYL--TNKSNEQAFAEKLGVNYSYDDEALLKDADYVFLGTKP
P5CR_STAEQ      MKLVFYGAGNMAQAIFTGIISNNLNANDIYL--TNKSNEQAFAEKLGVNYSYDDEALLKDADYVFLGTKP
P5CR_STAAW      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR_STAAS      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR_STAAR      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR_STAAN      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR_STAAM      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR_STAAC      MKLVFYGAGNMAQAIFTGIISSNLDANDIYLNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKP
P5CR3_BOVIN     -RVGFVGAGRMAEAIAQGLIQAGVEAEHVLASAPSDRNLCRF-RAMGCQTTHSNLEVLHSCSLVFFATKP
P5CR_STAS1      MKLVFYGAGNMAHAIFTGIVSKVIDSNDIYLNRSNEVALKEYAEKLGVNYSYDDEALLKAADYVFLGTKP
P5CR_HAEIN      --IAFIGGGNMAQAIILGLLKQGYPAEQIIVNDPNEEKRAFFAN-LDVATSENNVGSAIKAEVVLLAVKP
P5CR_SCHPO      -----LGCGTMGKALLTGIFDSIAENGNIIIPNKFYACVKFPKEKEDVQGAKENAEMAAISNVLLLSCKP
P5CR1_DICDI     --VAVLGCGNLGNAIAKGLVSKQFKSNQIVLTKRNLSTIEPLKRE-GYHVTTSNHDAVSRCKIVIVCVVP
P5CR_PASMU      --ICFIGGGNMAQAIIFGLLKQGYPANQITVSDPNAAKRQCLA-EKGVNTVEASQDAVETSEVLLLAVKP
P5CR2_DICDI     --IAILGSGNLGVSIARGIVASGYKSNQIVLTRRTLEKIQHLKDEEGFQITSDNLEAANKCAILIIGVLP
P5CR_YEAST      -----------------------------------------------------NVSAVEEASVVLLGTKP
P5CR_PSEAE      -RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIXXXXXXXXXXXXXXXXXXXXKP
P5CR_MYCTU      -----------------------------------------YLAQTYSVLVTSAADAVENATFVVVAVKP
P5CR_MYCLE      -----------------------------------------YLADTYSVLVTSVTDAVENAMFVVVAVKP
P5CR_THET2      MRLAFVGLGKMGRSILKGALERGLRPEEVGVLGRTPERSRELAEPFGVRPLTRAD--LGMAERVLIAVQP
P5CR_ZALAR      -------------------------------------------QSDNVTACR-------EADVVLLGCKP
P5CR_NEUCR      ----------------------------------------------------SNVSAAAEADIILLGCKP
COMER_BACSU     MKIGFIGTGNMGTILIESFISKAADPSNMTINRTIEKALHIKNRYNSINVTESLEKLVSENEMIFICVKP
P5CR_METSM      MNLGIIGYGNIGELLSQNIISHDFCNLNIANRTLSKINH-LKDIDPRISITDDNIEVAKTCEKIIISVKT
P5CR_HELPY      ----FIGYGNMAQAILEG--AHEILSKRFILEITGRNPEKIFLQEKNIQA-----QIVPYKDAVFLLFKP
P5CR_HELPJ      ----FIGYGNMAQAILEG--SHEILSKRFILEITGRNPEKIFLQEKNIQA-----QIVPYKDAIDIHQKF
GLYR1_ANOGA     LKFGFLGLGVMGCGIVKNLIKSG-HSVVVWNRSAHKCR---KFQEVGAEVADTPSDVVEMTDVTYSCVSD
TYPH_THEPD      ----------------------------------------------------------------------
ASPD_METVS      LKVGIVGCGAVASLITKALLSERIKARVLAFYDVNYEKAKKLSEETGAESCVSIDELVSKDLDLILECAS
CN148_XENTR     LRVSIIGGGNLGKQIAHCLIDLGVRAEDIRISTRRPETLQDL-QELGVHCAYDNAALATWSQVIFLCCLP
3HIDH_ARATH     --VGFIGLGNMGFRMVNNLIRAGYK---VTVHDINRDVMKMFT-EMGVSSRETPYEVAQDSEVV------
GLYR1_AEDAE     LKFGFLGLGIMGCGMVKNLLNSG---HSVVVWNRTATKCRKF-QEAGAEVADTPSDVIEMTDVTFSCVAD
ASPD_METMP      LKIGLVGCGAIASLITKALMSDRLKAEVLAFYDGNLEKAEKLAMETGADFCKSLDELVSKDDLIVECASV
ASPD_METM6      LKIGVVGCGAIASLITKALMSDRLKAEVLAFYDGNLEKAEKLAMETGADFCRSLDELVSKDDLIVECASV
ASPD_METM7      LKIGVVGCGAIASLITKALMSDRLKAEVLAFYDGNLEKAEKLAMETGADFCRSLDELVSKDDLIVECASV
ASPD_METM5      LKVGVVGCGAIASLITKALMSDRLKAEVLAFYDGNLEKAEKLAMETGADFCRSLDELVSKDDLIVECASV
ARGC_CLOK5      ---GYVGLSNHNKIKISGISSTSYEGKSI--NSLYPGFYDLKEL-----VCEKDDEVIKRSDLIFLALEP
ARGC_CLOK1      ---GYVGLSNHNKIKISGISSTSYEGKSI--NSLYPGFYDLKEL-----VCEKDDEVIKRSDLIFLALEP
Y612_METJA      ------GTDGLGKWFARYLKNKGF---NVIVTGRDIEKGKNVEKELGVEFTNNNIEAAKKGDIVIVAVPI


                         .         .         *         .         .         .         .:140
query           IVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
P5CR_AQUAE      KDSQEVLQKLKD----YKGIILSIMAGVSIEKMEKILG-KDKKIVRVMPNVNVAVGSGVMAITDNGNLSE
P5CR1_ARATH     QVVKKAVTELK-SKLSKNKILVSVAAGIKLNDLQEWSGQD--RFIRVMPNTPAAVGEAASVMSLGTGATE
P5CR_SHIFL      GIMIKVLSEITSS-LNKDSLVVSIAAGVTLDQLARALGH-DRKIIRAMPNTPALVNAGMTSVTPNALVTP
P5CR_ECOLI      GIMIKVLSEITSS-LNKDSLVVSIAAGVTLDQLARALGH-DRKIIRAMPNTPALVNAGMTSVTPNALVTP
P5CR_ACTCH      QIVKEVVLQLRP-LLSEKQLLVSIVAGVKLKELEDWAGHS--RFIRVMPNTPAAVGEAASVMSLGATATG
P5CR3_DANRE     HIIPQVLKEISQEV-TKEHIIVSMAAGITIATLEELLPA-GTHVIRIMPNLPCMLLEGALLLSCGSHAGE
P5CR2_MACFA     HIIPFILDEIADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVREGATVYAMGTHALV
P5CR1_BOVIN     HIIPFILDEIAANIARHIVVSCAAGVTISSIEKKLTAFQPAPKVIRCMTNTPVVVREGATVYATGTHAQV
P5CR2_BOVIN     HIIPFILDEIADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVLVREGATVYATGTHALV
P5CR_METAC      QTLSSVLSNLKNEI-TSEKLVISIAAGVPLSTYEDAL-LEGTRVVRVMPNIAATVSEAASGIAPGKNATP
P5CR2_RAT       HIIPFILDEIGADVQEHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVREGATVYATGTHALV
P5CR1_MOUSE     HIIPFILDEIGANIEDHIVVSCAAGVTINSIEKKLTAFQPAPKVIRCMTNTPVVVREGVTVYATGTHAQV
P5CR1_PONAB     HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
P5CR1_HUMAN     HIIPFILDEIADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQV
P5CR2_MOUSE     HIIPFILDEIGADVQEHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVREGATVYATGTHALV
P5CR_SYNY3      QVLDRVLASLAGGA--NRPLVISILAGVSLQRIQK--GFPDHAIIRAMPNTPATVGAGMTAIAANKMVEP
P5CR3_MOUSE     QVLPTVLAEVAP-IVTTEHIIVSVAAGISLSTMEGLL-PPNTRVLRVSPNLPCVVQEGAMVMARGHHAGN
P5CR2_BACSU     KDAAESIDSIRPYI--KDQLVISVLAGLTIETIQHYFGRK-LAVIRVMPNTSAAIRKSATGFSVSTEASK
P5CR_VIBAL      QMMADVCKPLQAIDFT-NKLVISIAAGINCSRLDDMLATK-LNLVRVMPNTPSQLGLGMSGLFAPIHVTE
P5CR_CORML      KFIVEVLSEITGTLDNNSAQXXXXXXXXXXXXXXXXXXXXXLPVVRVMPNTPMLVGKGMSTVTKGRYVDA
P5CR_CORGL      KFIVEVLSEITGTLDNNSAQXXXXXXXXXXXXXXXXXXXXXLPVVRVMPNTPMLVGKGMSTVTKGRYVDA
P5CR1_BACSU     KDAENALSSLKSRIQPHQLILSVLAGITTSFIEQSLLNEQPV--VRVMPNTSSMIGASATAIALGKYVSE
P5CR2_HUMAN     HIIPFILDEIADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTHALV
P5CR2_PONAB     HIIPFILDEIGADVQAHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTHALV
P5CR_TREPA      SQISTVLR---DRQSFQGKVLISLAAGMSCAAYEALFAAQGIRHLSLLPNLPCQVARGVIIAEARHTLHH
P5CR_CAEEL      QVFEEVVSEFIISVMAGVPLKVLN------AKLPFVSGN--TTIVRLMPNVASSIGAGASTMEKNEKIMN
P5CR3_XENLA     HIIPSVLQEIYPKV-TADHLIISMAAGVTLETLEKNLPPGS-KVIRMMPNLPCVLQEGAIVFSRGRCAGE
P5CR_SOYBN      ----QLVKDVVSXXXXXXXXXXXXVSVAAGTKLKDLQEAGNDRFIRVMPNTPAAVGQAASVMSLGGSATE
P5CR3_RAT       QXXXXXXXXXXXXXXXXH-IIVSVAAGISLSSMEELLPPK-TRVLRVSPNLPCVVQEGAMVMTRGHHAGN
P5CR3_MACFA     HILXXXXXXXXXXXXXXH-ILVSVAAGVSLSTLEELL-PPNTRVLRVLPNLPCVVQEGAIVMARGRHVGS
P5CR3_HUMAN     HXXXXXXXXXXXXXXXXH-ILVSVAAGVSLSTLEELL-PPNTRVLRVLPNLPCVVQEGAIVMARGRHVGS
P5CR_STAHJ      YDFEKVAQRIQPYINENNRFISIMAGLPINYIQEQL--QVENPIARIMPNTNAQVGHSVTGISFSGNFGP
P5CR_PEA        ------------------------------------------RFIRVMPNTPAAVGQAASVMSLGGAATE
P5CR_STAES      HDFENLANRIREHI-TNDNRFISIMAGLSIDYIRQQLNTNN-PLARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAEQ      HDFENLANRIREHI-TNDNRFISIMAGLSIDYIRQQLNTNN-PLARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAW      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAS      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAR      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAN      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAM      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR_STAAC      HDFDALATRIKPHI-TKDNCFISIMAGIPIDYIKQQLECQN-PVARIMPNTNAQVGHSVTGISFSNNFDP
P5CR3_BOVIN     HIXXXXXXXXXXXXXXXH-ILVSVAAGVSLSTLEKLLPPM-ARVLRVSPNLPCIVQEGAMVMARGCCAGS
P5CR_STAS1      YDFESLAERIKPFITDKNKFISIMAGLPISYIREKL--EADNPIARIMPNTNAHVGHSVTGISFSSNFGP
P5CR_HAEIN      QMMAEVCSPLS-AVDFSDKLLISIAAGISTERLNALIPSVK-SIVRVMPNTPALVGEGMAGLFAPKNTSE
P5CR_SCHPO      QAAEDVLNSPKMKEALKGKLILSILAGKTISSLQSML-DESTRVIRIMPNTASRIRESMSVICPGPNATE
P5CR1_DICDI     AQLDDLLDSIKQSVTENH----IIISVVSGASIEDIRSEKDVPIVRAMPNTAIQHCQSMTCLSPSDKAKD
P5CR_PASMU      QMIAAVCQGLS-AVDFSQKLVISIAAGVSVTKLQSRLPTAK-QIVRVMPNTPALVAEGMSGLFAQNSLKP
P5CR2_DICDI     AQVPQLLESIKHLV-TKDHIIISVVLGITISGIRSHL-QPDVPIVRAMPNTAIQYCESMTCINKSDHLAD
P5CR_YEAST      FLAEEVLNGVKSVI------GGKLLISLAAGWTIDQLSQYTSTVCRVMTNTPAKYGYGCAVVSYSADVSK
P5CR_PSEAE      QAMKAVCQALAPA-LKPEQLIVSIAAGIPCASLEAWLGQPR-PVVRCMPNTPALLRQGASGLYANAQVSA
P5CR_MYCTU      ADVEPVIXXXXXXXXXXXXXXXXQVFVTVVAGITIAYFESKLPVVRAMPNXXXXXXXXXXXXXKGRFVTP
P5CR_MYCLE      TDVESVMGDLVQAAAVANDSAEQVLVTVAAGVTITYLESKGTPVVRAMPNXXXXXXXXXXXXXKGRFVTG
P5CR_THET2      RDFPALAPEIAHHRLGYISIMAGISTSVLARRLDNR------RVVRAMPNLAVVIGESSTALTALKEARE
P5CR_ZALAR      YMAEGILGELLISILAGVPAEQIYGYMYGKTPVNP---EKECQVVRAMPNTASGIRESMTVXXXXXXXXX
P5CR_NEUCR      YMVSGLLSAMKDALTVKHTEGHARSQKIIISDLERVL-REDVGVVRAMPNTASKIRESMTVINTVDPLPD
COMER_BACSU     LDIYPLLARAL-PYLRKDHILISITSPVQTEQLEQYV---PCQVARVIPSITNRALAGVSLVTFGTSCGE
P5CR_METSM      PDLAIVLDPLKPHITKNQQIIHTCAGTD--------LEFKDCGLSCVIPTISSTYDEGVSIIMHDENVSG
P5CR_HELPY      YNLKDFNYQGQKSVLS-------ALAGVGFKALSDAIDS--LHYLKCMPNIASKFALSSTAVCEKSPMPS
P5CR_HELPJ      VFLLFKPYNLKD--FNYQGQAKSVLSALAGVNFEALSNANSLHYLKCMPNIASKFALSSTAVCEKSSISE
GLYR1_ANOGA     PQVAK-----------------------------------------------------------------
TYPH_THEPD      --------------------------------------------------------------------SD
ASPD_METVS      VVEETVLKSI------------------------------------------------------------
CN148_XENTR     SQLPSICTEIRD----------------------------------------------------------
3HIDH_ARATH     ----------------------------------------------------------------------
GLYR1_AEDAE     PQVAKEL---------------------------------------------------------------
ASPD_METMP      NAVEKSLNNDKDVII-------------------------------------------------------
ASPD_METM6      TAVEKSLNNGKDVII-------------------------------------------------------
ASPD_METM7      TAVEKSLNNDKDVIV-------------------------------------------------------
ASPD_METM5      TAVEKSLNNGKDVII-------------------------------------------------------
ARGC_CLOK5      IVEKAVAKD-------------------------------------------------------------
ARGC_CLOK1      IVEKAVAKD-------------------------------------------------------------
Y612_METJA      NVTERVIKEVAPHV--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
P5CR_AQUAE      EERSKVEELLLSCGTLYRIEERLFDAFTALAGSGPAFVFSFIDALALAGVHQGFSYEQALRIALDTVMGS
P5CR1_ARATH     EDGAIVAMLFGAVGKILKADEKMFDAVTGLSGSGPAYIFLAIEALADGGVAAGLPRELALSLASQTVLGA
P5CR_SHIFL      EDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGS
P5CR_ECOLI      EDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGS
P5CR_ACTCH      EDGELITKLFGAIGKIWKADEKLFDAVTGLSGSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGA
P5CR3_DANRE     QEETLLKTLLGPCGLVEFGPESWIDAHVGLSGSGVAFVYVFAEALADGAVKMGMPSTLARRIAAQTILGA
P5CR2_MACFA     EDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR1_BOVIN     EDGRLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR2_BOVIN     EDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR_METAC      EDLKAALEIFSAVGTAVQVPESLMDAVTGLSGSGPAFIFPVIEAMADGAVLEGMDRKSALTLAAQTVLGA
P5CR2_RAT       EDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAYAFMALDALADGGVKMGVPRRLAVRLGAQALLGA
P5CR1_MOUSE     EDGRLVEQLMGSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR1_PONAB     EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR1_HUMAN     EDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGA
P5CR2_MOUSE     EDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAYAFMALDALADGGVKMGVPRRLAVRLGAQALLGA
P5CR_SYNY3      DQLAKAKAIFSAVGNVVEVPENLMDAVTGVSGSGPAYVALMIEALADGGVLAGLPRAIAQKLALQTVLGT
P5CR3_MOUSE     DDAELLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSGLAHRIAAQTLLGT
P5CR2_BACSU     NDIIAAKALLETIGDATLVEERHLDAVTAIAGSGPAYVYRYIEAMEKAAQKVGLDKETAKALILQTMAGA
P5CR_VIBAL      HDKAFAAELMEAVGKVCWVEESGINNVIAAAGSAPAYFFLFMEAMQAEAIAQGFDKESARLLVQQAALGA
P5CR_CORML      EQLEQVKDLLSTVGDVLEVAESDIDAVTAMSGSSPAYLFLVTEALIEAGVNLGLPRATAKKLAVASFEGA
P5CR_CORGL      EQLEQVKDLLSTVGDVLEVAESDIDAVTAMSGSSPAYLFLVTEALIEAGVNLGLPRATAKKLAVASFEGA
P5CR1_BACSU     DLKKLAEALLGCMGEVYTIQENQMDIFTGIAGSGPAYFYYLMEFIEKTGEEAGLDKQLSRSIGAQTLLGA
P5CR2_HUMAN     EDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRXXXXXXXXXXXXX
P5CR2_PONAB     EDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRXXXXXXXXXXXXX
P5CR_TREPA      DEHAALLAVLRTVAQVEVVDTAYFAIAGVIAGCAPAFAAQFIEALADAGVRYGLARDQAYRLAAHMLEGT
P5CR_CAEEL      QDIELAREFAECVGTVELIPERCFNPAMAIGGSSPAWTFMYIESLADGAVAQGLGRAEAKRLAAQAVLGA
P5CR3_XENLA     VEADVFESLVRTCGLCVEVPQSCIDIHTGVSGSGVAYVYTFAEALADGAVKMGMPSALARQIVAQTLLGA
P5CR_SOYBN      EDGNIIAQLFGSIGKIWKAEEKYFDAITGLSGSGPAYVYLAIEALADGGVAAGLPRDLSLSLASQTVLGA
P5CR3_RAT       EDAKLLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSDLAHRIAAQTLLGT
P5CR3_MACFA     SETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAIKMGMPSSLAHRIAAQTLLGT
P5CR3_HUMAN     SETNLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGT
P5CR_STAHJ      KSKEEVNDLVNAFGSVIEVDEDHLHQVTAITGSGPAFLYHVFEQYVKAGTDLGLEKDQVEESIKNLIIGT
P5CR_PEA        EDANLISQLFGSIGKIWKADDKFFDAITGLSGSGPAYIYLAIEALADGGVAAGLPRDLALSLASQTVLGA
P5CR_STAES      KSKNEVDELINAFGSVIEVSEEHLHQVTAITGSGPAFLYHVFEQYVKAGTELGLERNQVEESIRNLIIGT
P5CR_STAEQ      KSKNEVDELINAFGSVIEVSEEHLHQVTAITGSGPAFLYHVFEQYVKAGTELGLERNQVEESIRNLIIGT
P5CR_STAAW      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR_STAAS      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR_STAAR      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR_STAAN      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR_STAAM      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR_STAAC      KSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGT
P5CR3_BOVIN     YEAQLLRSLLEACGQCEEVPEAQVDVHTGLSGSGVAFVCAFSEALAEGAIKMGMPSGLAHRIAAQTLLGT
P5CR_STAS1      NSKDEVDELINAFGSAIEVPEDNLHQVTAITGSGPAFLYHVFEQYVTAGTRLGLEKAQVEESIRNLIIGT
P5CR_HAEIN      NYRTFAQDLLGAVGRTVWVDETQMHAVTAASGSSPAYFFLMLEAMQKALIKMNIDEKTARELVQQSMLGA
P5CR_SCHPO      EDIKFAEWVFNGIGRSMKLPEKLIDAATAVCGSGPAFVATMIEAMTDGGVMMGIPFPQAQELAAQTMVGT
P5CR1_DICDI     NALEVAKKIFNCLGMSIVLSEEQIVPATALCACGXXXXXXXXXXXXQGGCEIGFHAEDAIRIAAQTAKGA
P5CR_PASMU      EYKQFTQDLLNAVGKTCWVQEADMHTITAGSGSSPAYFFLFMEAMQQALCQMNMDEDTARLLVQQSALGA
P5CR2_DICDI     QNLEVTEKIFNCCGECITISEEAMVSAPALCSCGTAFFCRIIRAAASAGCEIGFHAEDAVRIAAQTAKGA
P5CR_YEAST      EQKPLVNELISQVGKYVELPEKNMDAATALVGSGPAFVXXXXXXXXXXXXXXXIPLQESKECAMKVLEGT
P5CR_PSEAE      AQCEQAGQLLSAVGIALWLDEAQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGA
P5CR_MYCTU      QQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGS
P5CR_MYCLE      QQFEDVLAMFDAVGGVLTVPESQMDAVTAVSGSGPAYFFLLVEALVDAGVAVGLTRQVATELAAQTMAGS
P5CR_THET2      EDLAFARALFATVGDVYEIPEHLFDAFTGMSASAPAYLAVVAEALADAGVKMGM--PRXXXXXXXXXXXX
P5CR_ZALAR      XXXXXXXXIFKRIGDVVQLPAATMDASTALCGSGPAFFALILEAAIDGAVAMGLPRAEAQRMAAQTMKGA
P5CR_NEUCR      TVTELLTWIFERIGEVVYLPPHLMDACTSLCASGTAFFALMMEAAADGGVAMGLPRAEANRMAAQTMRGA
COMER_BACSU     SAKAKINELMQHISHPLQIESDITRVASDIVSCGPAFMSYLIQRFIDAAVETSVSKQDAILMCKEMLVGM
P5CR_METSM      ENREFVEKLFSKFSQIKVVDSMDLEIATIAASCMPAFIALGVDLFAELEEKCNLSKEETFKILAE-TLNS
P5CR_HELPY      QKALSVIESFGNCVRVGHEELVDAS--VATNGSALAFLSLVANSLKDAGIREGLNARGSLELVKMSFKGF
P5CR_HELPJ      KALNII-ESFGNCVRVGNEEQVDSS--VATNGXXXXXXXXXXXXXKDAGIREGLNAKDSLELVKMSFKGF
GLYR1_ANOGA     ----------------------------------------------------------------------
TYPH_THEPD      EIYQVVKDIVD--GKLSELELAAFVTAVHFQGMTPSEIYSFTLSMVETGQRLRL---KRKPILDKHSLGG
ASPD_METVS      ----------------------------------------------------------------------
CN148_XENTR     ----------------------------------------------------------------------
3HIDH_ARATH     ----------------------------------------------------------------------
GLYR1_AEDAE     ----------------------------------------------------------------------
ASPD_METMP      ----------------------------------------------------------------------
ASPD_METM6      ----------------------------------------------------------------------
ASPD_METM7      ----------------------------------------------------------------------
ASPD_METM5      ----------------------------------------------------------------------
ARGC_CLOK5      ----------------------------------------------------------------------
ARGC_CLOK1      ----------------------------------------------------------------------
Y612_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKG
P5CR_AQUAE      AKLLKEFQVNPNELIAKVTSPGGTTIEGIKYLEEKGFKGTVMECINRTSQKAK-
P5CR1_ARATH     ATMVSKTGKHPGVLKDDVTSPGGTTIAGVHELEKGSFRATLMNAVVAAAKRSR-
P5CR_SHIFL      AKMVLETGEHPGALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSE-
P5CR_ECOLI      AKMVLETGEHPGALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSE-
P5CR_ACTCH      ASMVARGGKHPGQLKDDVASAGGTTIAGIHELEKGGFRGTLMNAV---------
P5CR3_DANRE     GVLLRDSGKLPAELKAEVCTPGGTTIHGIHALEKGGF-----------------
P5CR2_MACFA     AKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR1_BOVIN     AKMLLDSEQHPGQLKDNVCSPGGATIHALHVLESGGFRSLLIKAVEASCTRTR-
P5CR2_BOVIN     AKMLLDSEQHPGQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR_METAC      AKMALETGMHPGELKDMVTSPAGTTIQGIHSLEEAGIRAAFMNAVIRASERSK-
P5CR2_RAT       AKMLLDSEDHPGQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR1_MOUSE     AKMLLDSEQHPSQLKDNVCSPGGATIHALHVLESGGFRSLLINAVEAS------
P5CR1_PONAB     AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
P5CR1_HUMAN     AKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEAS------
P5CR2_MOUSE     AKMLLDSEDHPGQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR_SYNY3      AELIKETEEHPAQIKDKVTSPGGTTIAGVAVLEKMGFRSAIIEAVRAAYRRSQ-
P5CR3_MOUSE     AKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALERGGFRAATMSAVEAATCRAK-
P5CR2_BACSU     TDMLLQSGKQPEKLRKEITSPGGTTEAGLRALQDSRFEEAIIHCIEETAKR---
P5CR_VIBAL      ASMVVSNPETELSLRENVTSKGGTTAEALRTFNE--------------------
P5CR_CORML      ATMMKETGKEPSELRAGVSSPAGTTVAAIRELEESGIRGAFYRAAQACADRSE-
P5CR_CORGL      ATMMKETGKEPSELRAGVSSPAGTTVAAIRELEESGIRGAFYRAAQACADRSE-
P5CR1_BACSU     AKMLMETGEHPEILRDNITSPNGTTAAGLQALKKSGGGEAISQAIKHAAKRSK-
P5CR2_HUMAN     XXXXXDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR2_PONAB     XXXXXDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEAS------
P5CR_TREPA      AALIQHSGVHPAQLKDRVCSPAGSTIRGVLALEEQGLRRAVIHAVRAALS----
P5CR_CAEEL      AQMVLNSNQHFGSLKDMVCSPGGTTIEGVRALEKNGFRYAVMEAVVAASTK---
P5CR3_XENLA     GKMLLQSEEHPASLRADVCTPGGTTIFGLHELEKGGLRAAVMNAVEAATTR---
P5CR_SOYBN      ASMVSQTGKHPGQLKDDVTSPGGTTITGIHELENGGFRGTLMNAVVAAAKRSR-
P5CR3_RAT       AKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALEQGGFRAAAMSAVEAATCRAK-
P5CR3_MACFA     AKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEA-------
P5CR3_HUMAN     AKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAK-
P5CR_STAHJ      SKMIERSDLSMEQLRKNITSKGGTTQAGLNALAQ--------------------
P5CR_PEA        ASMATLSGKHPGQLKDDVTSPGGTTIAGVHELEKGGFRGTLMNAVVAAAKRSR-
P5CR_STAES      SKMIERSDLSMSQLRKNITSKGGTTQAGLDALSQYDIVSMFEDCLGAAVNR---
P5CR_STAEQ      SKMIERSDLSMSQLRKNITSKGGTTQAGLDALSQYDIVSMFEDCLGAAVNR---
P5CR_STAAW      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR_STAAS      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR_STAAR      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR_STAAN      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR_STAAM      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR_STAAC      SKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDR---
P5CR3_BOVIN     AKVLLQKGQHPAQLRTDVCTPGGTTIYGLHVLEQGGLRATAMSAVEA-------
P5CR_STAS1      SKMIERSELSMEQLRKNITSKGGTTQAGLNALSQ--------------------
P5CR_HAEIN      AKMVTENPQIALSLRENVTSKGGTTAAALAVFDAQHFNQTIEQAMQACLSRSQ-
P5CR_SCHPO      GRMVLQG-QHPAMIRNDVSTPAGCTISGLLALEDGKIRSTIARGIEQATKTASG
P5CR1_DICDI     ATLLLENNFHPEYEIDKVTTPQGCTIAGLNQMEHAGFSSAMIKGIVTSSDK---
P5CR_PASMU      AKMVIENPDLPATLRENVTSKGGTT-----------------------------
P5CR2_DICDI     AIMLLKNDSHPESEIDRITTPSGATIAGLNTMEHNGLSSAIIKGIVMSAEK---
P5CR_YEAST      VKMVEKSGAHPSVLKHQVCTPGGTTIAGLCVMEEKGVKSGIINGVE--------
P5CR_PSEAE      AQMALSSEVEPAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNA-------
P5CR_MYCTU      ALMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSE-
P5CR_MYCLE      AAMLLERDVPAAQLRATITSPGGTTAAALRELERGGLRMVVDAAVQA-------
P5CR_THET2      XXXXXXKGRHPAQVKDEVASPGGTTIHGLHALEARAVRAAFYEAVEA-------
P5CR_ZALAR      AGLVL-SGEHPALLKDKVTTPGGCTIGGLMVLE---------------------
P5CR_NEUCR      AGLVLEGEH-PAILREKVSTPGGCTI----------------------------
COMER_BACSU     G-KLLETEYTLPALQEKVCVKGGVTGEGIKALE---------------------
P5CR_METSM      TAYILKEDYSPDELINKVATKNGITQKGLDVLDK--------------------
P5CR_HELPY      A-KLLEKER-PEMIIEQICTPKGATIEGLSVLEKKGVRGAFIEACHKSVKK---
P5CR_HELPJ      A-KLLEKER-PEMIIEQICTPKGATIEGLSVLEKKGVRGAFIKACHESVKK---
GLYR1_ANOGA     ------------------------------------------------------
TYPH_THEPD      ----VPGDKTSLLVVPIIASLGFT------------------------------
ASPD_METVS      ------------------------------------------------------
CN148_XENTR     ------------------------------------------------------
3HIDH_ARATH     ------------------------------------------------------
GLYR1_AEDAE     ------------------------------------------------------
ASPD_METMP      ------------------------------------------------------
ASPD_METM6      ------------------------------------------------------
ASPD_METM7      ------------------------------------------------------
ASPD_METM5      ------------------------------------------------------
ARGC_CLOK5      ------------------------------------------------------
ARGC_CLOK1      ------------------------------------------------------
Y612_METJA      ------------------------------------------------------