[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00097.1

[Show Plain Result]


## Summary of Sequence Search
    1::807
   15::797       0.0  48%  798 aa  PHSG_BACSU RecName: Full=Glycogen phosphorylase;       
   49::814     e-180  44%  815 aa  PHSG_SHIFL RecName: Full=Glycogen phosphorylase;       
   49::814     e-180  44%  815 aa  PHSG_ECOLI RecName: Full=Glycogen phosphorylase;       
   39::818     e-178  45%  818 aa  PHSG_PASMU RecName: Full=Glycogen phosphorylase;       
   41::830     e-177  43%  844 aa  PYG_DROME RecName: Full=Glycogen phosphorylase;         EC=2.4.1.1;
   48::829     e-177  42%  849 aa  PHSG_SYNY3 RecName: Full=Glycogen phosphorylase;       
   54::818     e-176  44%  821 aa  PHSG_HAEIN RecName: Full=Glycogen phosphorylase;       
   41::832     e-175  41%  842 aa  PYGM_SHEEP RecName: Full=Glycogen phosphorylase, muscle form;      
   41::830     e-175  41%  843 aa  PYGM_RABIT RecName: Full=Glycogen phosphorylase, muscle form;      
   41::832     e-175  41%  842 aa  PYGM_BOVIN RecName: Full=Glycogen phosphorylase, muscle form;      
   41::830     e-175  41%  842 aa  PYGM_HUMAN RecName: Full=Glycogen phosphorylase, muscle form;      
   41::830     e-175  42%  851 aa  PYGL_BOVIN RecName: Full=Glycogen phosphorylase, liver form;       
   41::830     e-175  41%  842 aa  PYGM_MOUSE RecName: Full=Glycogen phosphorylase, muscle form;      
   41::830     e-174  41%  842 aa  PYGM_MACFA RecName: Full=Glycogen phosphorylase, muscle form;      
   41::830     e-174  42%  851 aa  PYGL_SHEEP RecName: Full=Glycogen phosphorylase, liver form;       
   41::830     e-173  42%  850 aa  PYGL_MOUSE RecName: Full=Glycogen phosphorylase, liver form;       
   41::830     e-173  42%  850 aa  PYGL_RAT RecName: Full=Glycogen phosphorylase, liver form;       
   41::830     e-172  41%  842 aa  PYGM_RAT RecName: Full=Glycogen phosphorylase, muscle form;        
   41::830     e-171  41%  847 aa  PYGL_HUMAN RecName: Full=Glycogen phosphorylase, liver form;       
   41::830     e-169  41%  843 aa  PYGB_PONAB RecName: Full=Glycogen phosphorylase, brain form;       
   41::830     e-169  40%  843 aa  PYGB_HUMAN RecName: Full=Glycogen phosphorylase, brain form;       
   41::830     e-169  40%  843 aa  PYGB_MOUSE RecName: Full=Glycogen phosphorylase, brain form;       
   41::826     e-168  41%  843 aa  PYGB_BOVIN RecName: Full=Glycogen phosphorylase, brain form;       
   41::830     e-168  40%  838 aa  PYGB_RAT RecName: Full=Glycogen phosphorylase, brain form;       
   41::826     e-168  40%  843 aa  PYGB_SHEEP RecName: Full=Glycogen phosphorylase, brain form;       
  132::911     e-165  42%  993 aa  PHS2_DICDI RecName: Full=Glycogen phosphorylase 2;       
   34::814     e-165  40%  824 aa  PHSG_CHLPN RecName: Full=Glycogen phosphorylase;       
   30::810     e-165  40%  813 aa  PHSG_CHLMU RecName: Full=Glycogen phosphorylase;       
   30::810     e-160  39%  814 aa  PHSG_CHLTR RecName: Full=Glycogen phosphorylase;       
   76::846     e-158  40%  853 aa  PHS1_DICDI RecName: Full=Glycogen phosphorylase 1;       
   92::901     e-155  41%  902 aa  PHSG_YEAST RecName: Full=Glycogen phosphorylase;       
   59::793     e-154  41%  797 aa  PHSM_ECOLI RecName: Full=Maltodextrin phosphorylase;       
   47::835     e-153  39%  841 aa  PHSH_ARATH RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
    8::752     e-153  41%  752 aa  PHSM_STRPN RecName: Full=Maltodextrin phosphorylase;       
   55::836     e-151  38%  842 aa  PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
   49::833     e-149  37%  838 aa  PHSH_SOLTU RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
   42::827     e-141  37%  832 aa  PHSH_WHEAT RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
  119::485     1e-91  42% 1003 aa  PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
  101::467     2e-89  41%  966 aa  PHSL1_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-1
   97::470     1e-88  41%  955 aa  PHSL_IPOBA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
  570::972     1e-87  42%  974 aa  PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2
  110::604     2e-16  29%  692 aa  PHSG_AQUAE RecName: Full=Glycogen phosphorylase;       
  130::632     7e-13  28%  863 aa  PHSG_MYCTU RecName: Full=Glycogen phosphorylase;       
  130::632     2e-12  28%  863 aa  PHSG_MYCBO RecName: Full=Glycogen phosphorylase;       
  163::468     7e-05  23%  519 aa  Y1631_METJA RecName: Full=Uncharacterized protein MJ1631;
   91::267     2e-04  27%  477 aa  Y078_NANEQ RecName: Full=UPF0027 protein NEQ078;
    1::807

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
PHSG_BACSU      --------------RLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEF
PHSG_SHIFL      ---------------------------------------VRDRLVERWLRSNRAQLSQETRQVYYLSMEF
PHSG_ECOLI      ---------------------------------------VRDRLVERWLRSNRAQLSQETRQVYYLSMEF
PHSG_PASMU      ------------------------KEASQRDWLNATLYAVRDFVTEGWITTARQSRSEETRRVYYLSMEF
PYG_DROME       -----------------------VKDSTLRDYYFALANTVKDNMVGRWIRTQQHYYEKDPKRVYYLSLEY
PHSG_SYNY3      --------------------------ATKNDCYMALAYTIRDRLLQRWLNTFQTYLNCDNRVVCYLSAEY
PHSG_HAEIN      ---------------------------------------VRDLVTEGWITTARQTRAEDSRRVYYLSMEF
PYGM_SHEEP      -----------------------VKDATPRDYYFALAYTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGM_RABIT      -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGM_BOVIN      -----------------------VKDATPRDYYFALAYTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGM_HUMAN      -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGL_BOVIN      -----------------------VKDATPRDYFFALAHTVRDHLVGRWIRTQQYYYEKCPKRVYYLSLEF
PYGM_MOUSE      -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGM_MACFA      -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
PYGL_SHEEP      -----------------------VKDATPRDYFFALAHTVRDHLVGRWIRTQQYYYEKCPKRVYYLSLEF
PYGL_MOUSE      -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
PYGL_RAT        -----------------------VKDATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
PYGM_RAT        -----------------------VKDATPRDYYFALAHTVRDHLVDRWIRTQQHYYAKDPKRIYYLSLEL
PYGL_HUMAN      -----------------------VKDATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
PYGB_PONAB      -----------------------VKDATPRDYLFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEF
PYGB_HUMAN      -----------------------VKDATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEF
PYGB_MOUSE      -----------------------VKDATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEF
PYGB_BOVIN      -----------------------VKDATRRDYYLALAHTVRDHLVGRWIRTQQRYYERDPKRIYYLSLEF
PYGB_RAT        -----------------------VKDATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEF
PYGB_SHEEP      -----------------------VKDATRRDYYLALAHTVRDHLVGRWIRTQQRYYERDPKRIYYLSLEF
PHS2_DICDI      -------------------------ECTDFSSFQALSYCTRDRLIERWKDTKLFFKQKNVKQVNYMSLEF
PHSG_CHLPN      ------------------------ESASPRDIFTAVAKTVMEWLAKGWLKTQNGYYKNDVKRVYYLSMEF
PHSG_CHLMU      ------------------------QSASTRDIFTAVAKTVSEWMAKGWLKTQSSYYDNDVKRVYYISMEF
PHSG_CHLTR      ------------------------QSASTRDIFTAVAKTVLEWMAKGWLKTQSSYYDNDVKRVYYISMEF
PHS1_DICDI      ---------------------------------------VRDRLIERWNETQQYYTERDPKRVYYLSMEF
PHSG_YEAST      --------------------------------YEAASMSIRDNLVIDWNKTQQKFTTRDPKRVYYLSLEF
PHSM_ECOLI      -----------------------------------------------------------QRHVNYISMEF
PHSH_ARATH      -----------------------LKFGPEQALYATAESL-RDRLIQLWNETYVHFNKVDPKQTYYLSMEY
PHSM_STRPN      ---------------VQNRYNKTIAECSNEELYLALLNYSKLASSQ-------KPVNTGKKKVYYISAEF
PHSH_VICFA      -----------------------------QQAYYATAESVRDRLIQQWNETYLHFHKVDPKQTYYLSMEF
PHSH_SOLTU      -----------------------------QAYYAATADSVRDRLIKQWNDTYLHYDKVNPKQTYYLSMEY
PHSH_WHEAT      ----------------------------PEQAFYATAESVRDHLLQRWNDTYLHFHKTDPKQTYYLSMEY
PHSL_VICFA      ----------------------------PQAFIATAQS-VRDALIINWNATYDYYEKLNVKQAYYLSMEF
PHSL1_SOLTU     ----------------------------PKAFFATAQS-VRDSLLINWNATYDIYEKLNMKQAYYLSMEF
PHSL_IPOBA      --------------------------------YFATAQSVRDALIVNWNATYDYYEKLNMKQAYYLSMEF
PHSL2_SOLTU     ----------------------------------------------------------------------
PHSG_AQUAE      ----------------------------------------------------------------------
PHSG_MYCTU      ----------------------------------------------------------------------
PHSG_MYCBO      ----------------------------------------------------------------------
Y1631_METJA     ----------------------------------------------------------------------
Y078_NANEQ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
PHSG_BACSU      LLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDXXXXXXXXXXXXXCFLDSLASLNLPGHGMGI
PHSG_SHIFL      LIGRTLSNAMLSLGIYEDVQGALEAMGXXXXXXXXXXXXPXXXXXXXXXXAACFLDSLATLGLPGRGYGI
PHSG_ECOLI      LIGRTLSNAMLSLGIYEDVQGALEAMGXXXXXXXXXXXXPXXXXXXXXXXAACFLDSLATLGLPGRGYGI
PHSG_PASMU      LIGRTLSNAMLAEGVYDVAKQALSELNVNLEDVLEKEVDPXXXXXXXXXXAACFMDSIATLALPGVGYGI
PYG_DROME       YMGRSLTNTMINLGIQSECEEAMYQLGLDIENLEEMEEDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PHSG_SYNY3      LLGPHLGNNLINLGLWEPVQQAVEESGLSXXXXXXXXXXPXXXXXXXXXXAACFMDSLATLEIPAIGYGI
PHSG_HAEIN      LIGRTLSNAMIAEGIYGLAQEALSXXXXXXXXXXXXXXDPXXXXXXXXXXAACFMDSIATLGLPGMGYGI
PYGM_SHEEP      YIGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_RABIT      YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_BOVIN      YIGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_HUMAN      YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGL_BOVIN      YMGRTLQNTMINLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_MOUSE      YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_MACFA      YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGL_SHEEP      YMGRTLQNTMINLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGL_MOUSE      YMGRTLQNTMINLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGL_RAT        YMGRTLQNTMINLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGM_RAT        YMGRTLQNTMVNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGL_HUMAN      YMGRTLQNTMINLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_PONAB      YMGRTLQNTMVNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_HUMAN      YMGRTLQNTMVNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_MOUSE      YMGRTLQNTMVNLGLQTACDEATYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_BOVIN      YMGRTLQNTMVNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_RAT        YMGRTLQNTMVNLGLQTACDEATYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PYGB_SHEEP      YMGRTLQNTMVNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI
PHS2_DICDI      LLGRSLQNSLSALGLVGKYSDALMDLGFKLEDLYDEERDXXXXXXXXXXXXXCFMDSLATCNFPGYGYGL
PHSG_CHLPN      LLGRSLKSNLLNLGILDLVRKALKTLNYDFDHLVEMESDXXXXXXXXXXXXXCYLDSMATLAVPAYGYGI
PHSG_CHLMU      XXXXXXXXXXXXXXXXXXVNEALSDLGYDFDQLVEMEHDXXXXXXXXXXXXXCFLDSMATLGIPAYGYGL
PHSG_CHLTR      XXXXXXXXXXXXXXXXXXVKEALFDLGYDFDQLVEMEHDXXXXXXXXXXXXXCFLDSMATLEIPAYGYGL
PHS1_DICDI      LMGRSLQNAIYNMNLKDEYHNALLELGFEMEDLYEEEKDXXXXXXXXXXXXXCFMDSLATLKYPAWGYGL
PHSG_YEAST      LMGRALDNALINMKIREMIKGALDEGGFKLEDVLDQEPDXXXXXXXXXXXXXCFVDSMATEGIPAWGYGL
PHSM_ECOLI      XXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXXXXXCFLDSMATVGQSATGYGL
PHSH_ARATH      LQGRALTNAIGNLNLQGPYADALRTLGYELEEIAEQEKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGL
PHSM_STRPN      LIGKLLSNNLINLGLYDDVKKELAAAGKDLIEVEEVELEPSLGNGGLGRLAACFIDSIATLGLNGDGVGL
PHSH_VICFA      LQGRALTNAIGNLNIQDAYADALRKFGLELEEITEQEKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGL
PHSH_SOLTU      LQGRALTNAVGNLDIHNAYADALNKLGXXXXXXXXXXKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGL
PHSH_WHEAT      LQGRALTNAVGNLAITGAYADALKKFGYELEAIAGQERDXXXXXXXXXXXXSCFLDSMATLNLPSWGYGL
PHSL_VICFA      LQGRALLNAIGNLELTGPYAEALSQLSYKLEDVAHQEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGL
PHSL1_SOLTU     LQGRALLNAIGNLELTGAFAEALKNLGHNLENVASQEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGL
PHSL_IPOBA      LQGRALLNAIGNLELTGEYAEALNKLGHNLENVASKEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGL
PHSL2_SOLTU     ----------------------------------------------------------------------
PHSG_AQUAE      --------------------------------------------GGLGFLAGDILKESSDLGFPLIGVGF
PHSG_MYCTU      -------------------------------------------SGGLGILAGDHLKSASDLGVPLIAVGL
PHSG_MYCBO      -------------------------------------------SGGLGILAGDHLKSASDLGVPLIAVGL
Y1631_METJA     ----------------------------------------------------------------------
Y078_NANEQ      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
PHSG_BACSU      RYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVP
PHSG_SHIFL      RYDYGMFKQNIVNGSQKESPDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGK----KTRWIETEEILGVA
PHSG_ECOLI      RYDYGMFKQNIVNGSQKESPDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGK----KTRWIETEEILGVA
PHSG_PASMU      RYEYGMFKQEIEDGHQVEKPDAWLDKGAAWEFIRPSKRHTVRFGGGIHFEGK----KCIWTSKEEVEALA
PYG_DROME       RYEYGIFAQKIKNGEQVEEPDDWLRYGNPWEKARPEFMLPVNFYGRVIDTPEGKK----WVDTQRVFAMP
PHSG_SYNY3      RYEFGIFDQEIKDGWQVEITDKWLQLGNPWEIARPESAVLVKLGGHTYTDDQGNY-RVRWIAGSLVKGIP
PHSG_HAEIN      RYEYGMFRQKIENGQQVERPDAWLEKGAPWEFIRPSKRFTVEFGGNIHFEGK----KCIWQDTEKVTALA
PYGM_SHEEP      RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
PYGM_RABIT      RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
PYGM_BOVIN      RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
PYGM_HUMAN      RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQG----AKWVDTQVVLAMP
PYGL_BOVIN      RYEYGIFNQKIRDGWQIEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTEAGTK----WTDTQVVLALP
PYGM_MOUSE      RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
PYGM_MACFA      RYEFGIFNQKISGGWQMEEADVWLRYGNPWEKARPEFTLPVHFYGHVEHTSQG----AKWVDTQVVLAMP
PYGL_SHEEP      RYEYGIFNQKIRDGWQIEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTEAGTK----WIDTQVVLALP
PYGL_MOUSE      RYEYGIFNQKIREGWQVEEADDWLRHGNPWEKARPEFVLPVHFYGRVEHTQTGTK----WVDTQVVLALP
PYGL_RAT        RYEYGIFNQKIREGWQVEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTQAGTK----WVDTQVVLALP
PYGM_RAT        RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
PYGL_HUMAN      RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----WIDTQVVLALP
PYGB_PONAB      RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VKWLDTQVVLAMP
PYGB_HUMAN      RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VKWLDTQVVLAMP
PYGB_MOUSE      RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VLWLDTQVVLAMP
PYGB_BOVIN      RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHSPEGVR----WLDTQVVLAMP
PYGB_RAT        RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPNG----VLWLDTQVVLAMP
PYGB_SHEEP      RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHSPEGVR----WLDTQVVLAMP
PHS2_DICDI      RYKFGMFYQTLVDGEQVELPDYWLNYGSPWEIERLDVSYPINFYGKVSEVEDENGKKVMWDQGEQMLAVA
PHSG_CHLPN      RYDYGIFDQRIVNGYQEEAPDEWLRYGNPWEICRGEYLYPVRFYGRVYTDSRGKQVADLV-DTQEVLAMA
PHSG_CHLMU      RYDYGIFDQQIENGYQVESPDEWLRYGNPWEICRGEYLYPVHFYGKVKMDSRGRDVAELV-DSQEVLAMA
PHSG_CHLTR      RYDYGIFDQKIENGFQVESPDEWLRYGNPWEICRGEYLYPVHFYGKVHSIDSRGRDVAELVDSQEVLAMA
PHS1_DICDI      RYNYGMFEQGIYDGYQTEVPDYWLVAGNPWEIERLDVQYTVRFYGQVTEKKSSDGSKFEWDHGELVQAIA
PHSG_YEAST      RYEYGIFAQKIIDGYQVETPDYWLNSGNPWEIERNEVQIPVTFYGYVDRPEGGKTTLSASQGGERVLAVA
PHSM_ECOLI      NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGKVTKDGR-------WEPEFTITGQA
PHSH_ARATH      RYRHGLFKQIITKKGQEEIPEDWLEKFSPWEIVRHDVVFPVRFFGKVQVNPDGSRK---WVDGDVVQALA
PHSM_STRPN      NYHFGLFQQVLKNNQQETIPNAWLTEQN-WLVR-SSRSYQVP-----------------FADFTLTSTL-
PHSH_VICFA      RYRYGLFKQIITKEGQEEVAEDWLEKFSPWEIVRHDVLYPIRFFGQVEVNPDGSRQ---WIGGEVIQALA
PHSH_SOLTU      RYRYGLFKQLITKAGQEEVPEDWLEKFSPWEIVRHDVVFPIRFFGHVEVLPSGSRK---WVGGEVLQALA
PHSH_WHEAT      RYRYGLFKQRIAKEGQEEIAEDWLDKFSPWEIVRHDVVYPIRFFGHVEISPDG---KRKWAGGEVLNALA
PHSL_VICFA      RYKYGLFKQRITKDGQEEVAEDWLEMGNPWEIVRNDVSYPVRFYGKVVSGSDGKKHWVGGED---IKAVA
PHSL1_SOLTU     RYKYGLFKQRITKDGQEEVAEDWLEIGSPWEVVRNDVSYPIKFYGKVSTGSDGKRYWIGGED---IKAVA
PHSL_IPOBA      RYKYGLFKQRITKDGQEEVAEDWLELGNPWEIIRMDVSYPVKFFGKVITGSDGKKHWIGGED---ILAVA
PHSL2_SOLTU     ----------------------------------------------------------------------
PHSG_AQUAE      MYPQGYVKQRIVDGWQ-----EDLDAQNQKELMPVKKVLDKELKCYVYVRDEKVYFGVWEVNVGKTKLYL
PHSG_MYCTU      YYRSGYFRQSLTDGWQHETYPSLDPQGLPLRLLTDANG-----------------------DPVLVEVAL
PHSG_MYCBO      YYRSGYFRQSLTDGWQHETYPSLDPQGLPLRLLTDANG-----------------------DPVLVEVAL
Y1631_METJA     ----------------------------------------------------------------------
Y078_NANEQ      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
PHSG_BACSU      YDIPIIGYETGTVNTLRLWNAE-PYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCA
PHSG_SHIFL      YDQIIPGYDTDATNTLRLWSAQASSNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLRQEYFLVSS
PHSG_ECOLI      YDQIIPGYDTDATNTLRLWSAQASSNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLRQEYFLVSS
PHSG_PASMU      YDQMIPGYANDSAATLRLWSADLADFNKGDYFAAVQDRTLSKNISVLYPDDSTWSGRELRLRQEYFLVSA
PYG_DROME       YDNPIPGYNNNHVNTLRLWSAKSPIDFNLKFQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFMCAA
PHSG_SYNY3      YDTPILGYKVSTANNLRLWKSEAAESFDFQYGAVQDKMSSENLTKVLYPNDEQIQGKELRLAQQYFFVSC
PHSG_HAEIN      YDQMIPGYQNNSAATLRLWSAHAGENRGEHLAALEEHSANKNLSRVLYPDDSTWNGRELRLRQEYFLVSA
PYGM_SHEEP      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_RABIT      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_BOVIN      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_HUMAN      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGL_BOVIN      YDTPVPGYLNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_MOUSE      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_MACFA      YDTPVPGYRNNVVNTMRLWSAKAPNDFNLKIQAVLDRNLAENIPRVLYPNDNFFEGKELRLKQEYFVVAA
PYGL_SHEEP      YDTPVPGYLNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGL_MOUSE      YDTPVPGYMNNTVNTMRLWSARAPNDFNLQIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGL_RAT        YDTPVPGYMNNTVNTMRLWSARAPNDFNLQIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGM_RAT        YDTPVPGYRNNVVNTMRLWSAKAPPYFNLKIQAVLDRNLAENISRVLYPNDKFFEGKELRLKQEYFVVAA
PYGL_HUMAN      YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_PONAB      YDTPVPGYKNNTVNTMRLWSAKAPNDFKLQIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_HUMAN      YDTPVPGYKNNTVNTMRLWSAKAPNDFKLQIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_MOUSE      YDTPVPGYKNNTVNTMRLWSAKAPNDFKLKIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_BOVIN      YDTPVPGYKNDTVNTMRLWSAKAPNDFKLHIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_RAT        YDTPVPGYKNNTVNTMRLWSAKAPNDFKLKIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PYGB_SHEEP      YDTPVPGYKNDTVNTMRLWSAKAPNDFKLHIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
PHS2_DICDI      YDYPIPGFKTYNTVAIRLWSSK-PSDERGDYLAIEEKEKSENITNVLYPNDNTMQGKELRLKQQYLFVSA
PHSG_CHLPN      YDIPIPGYGNDTVNSLRLWQAQSPRGFEFSYQAIEDIALIENISRVLYPNDSITEGQELRLKQEYFLVSA
PHSG_CHLMU      YDVPVPGFNNDTVNSLRLWQAQSRHGFEFSYRAIEDIALASNITRVLYPNDSISEGQELRLKQEYFLVSA
PHSG_CHLTR      YDVPVPGFNNDAVNSLRLWQAQSRHGFEFSYRAIEDIALAGNITRVLYPNDSISEGQELRLKQEYFLVSA
PHS1_DICDI      YDTPVPGYHTTNTNNIRLWSSDLDAFNGGNYLSVEAKQRSENITSVLYPNDNTYSGKELRLKQQYFFVAA
PHSG_YEAST      YDFPVPGFKTSNVNNLRLWQAR-PTTEFAKFNSVPQQQRAESITAVLYPNDNFAQGKELRLKQQYFWCAA
PHSM_ECOLI      WDLPVVGYRNGVAQPLRLWQADLTKFNDGDFLRAEQQGNAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
PHSH_ARATH      YDVPIPGYGTKNTISLRLWEAKARAEDEGEYELAAQHSRAQQICTVLYPGDATENGKLLRLKQQFFLCSA
PHSM_STRPN      YDIDVTGYETATKNRLRLFDLDSVDSSIIKDGINFDKTDIRNLTLFLYPDDSDRQGELLRIFQQYFMVSN
PHSH_VICFA      YDVPIPGYQTKNTISLRLWEAKACADDFDLFLFNDGQLEAQQICSVLYPGDATEGGKLLRLKQQYFLCSA
PHSH_SOLTU      YDVPIPGYRTKNTNSLRLWEAKASSEDDGQYDAAAQHSRAQQICAVLYPGDATENGKLLRLKQQFFLCSA
PHSH_WHEAT      YDVPIPGYKTKNAISLRLWDATATAEDDGQYESAAQHSRAQQICAVLYPGDATEEGKLLRLKQQYFLCSA
PHSL_VICFA      HDVPIPGYKTRSTINLRLWSTKAASEEGRHTEASEALANAEKICYILYPGDESIEGKTLRLKQQYTLCSA
PHSL1_SOLTU     YDVPIPGYKTRTTISLRLWSTQVPSADGEHTKACEAQANAEKICYILYPGDESEEGKILRLKQQYTLCSA
PHSL_IPOBA      YDVPIPGYKTRTTISLRLWSTKVPSEDFDLYKACEAQANAEKICYILYPGDESIEGKILRLKQQYTLCSA
PHSL2_SOLTU     ----------------------------------------------------------------------
PHSG_AQUAE      LDT------NVEENTP--WNREISSR--------------------LYVPDKD-----LRLRQQ---IVL
PHSG_MYCTU      GDNAVLRARIWVAQVGRLLDSDIPENEH----------DLRNVTDRLYGGDQEH-----RIKQE---ILA
PHSG_MYCBO      GDNAVLRARIWVAQVGRLLDSDIPENEH----------DLRNVTDRLYGGDQEH-----RIKQE---ILA
Y1631_METJA     ----------------------------------------------------------------------
Y078_NANEQ      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
PHSG_BACSU      SLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTL
PHSG_SHIFL      TIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWDDAFEVCCQVFSYTNHTLM
PHSG_ECOLI      TIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWDDAFEVCCQVFSYTNHTLM
PHSG_PASMU      SLQDIIYRHKRIHNTMENFADKVAIHLNDTHPALAIPELMVILIDQEGYEWKKAWDITRRVFSYTCHTLM
PYG_DROME       TLQDIIRRYKAVRNTFDHFPDKVAIQLNDTHPSLAIPELMRILVDEEHLTWEKAWDITVRSCAYTNHTVL
PHSG_SYNY3      SLQDMIRIHLSDNPTLENFHEHFAVQMNDTHPSIAVAELMRLLVDEHHYEWQRAWAITEATFGFTNHTLL
PHSG_HAEIN      SLQDILRRHKRTHNSLENLADKVAIHLNDTHPALAIPELMRILVDDEGFEWKKAWEMTRNIFSYTCHTLM
PYGM_SHEEP      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDQERLEWEKAWEVTVKTCAYTNHTVL
PYGM_RABIT      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
PYGM_BOVIN      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDQERLEWEKAWEVTVKTCAYTNHTVL
PYGM_HUMAN      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVL
PYGL_BOVIN      TLQDVIRRFKKFDSSFDAFPDQVAIQLNDTHPSLAIPELMRIFVDIEKLPWSKAWEITQKTFAYTNHTVL
PYGM_MOUSE      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERLDWDKAWDVTVKTCAYTNHTVL
PYGM_MACFA      TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVL
PYGL_SHEEP      TLQDVIRRFKKFDSSFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWEITQKTFAYTNHTVL
PYGL_MOUSE      TLQDVIRRFKA-SKFGSKDGDQVAIQLNDTHPALAIPELMRIFVDIEKLPWAKAWEITKKTFAYTNHTVL
PYGL_RAT        TLQDVIRRFKA-SKFGSKDGDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWEITKKTFAYTNHTVL
PYGM_RAT        TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELIRILVDLERLDWDKAWDVTVKTCAYTNHTVL
PYGL_HUMAN      TLQDIIRRFKKFGSTFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
PYGB_PONAB      TLQDIIRRFKSVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVL
PYGB_HUMAN      TLQDIIRRFKSVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVL
PYGB_MOUSE      TLQDIIRRFKSVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVL
PYGB_BOVIN      TLQDIIRRFKSVRTSFETFPDKVAIQLNDTHPALAIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVL
PYGB_RAT        TLQDIIRRFKSVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVL
PYGB_SHEEP      TLQDIIRRFKSVRTSFETFPDKVAIQLNDTHPALAIPELMRILVDVEKVDWGKAWEITKKTCAYTNHTVL
PHS2_DICDI      TIQDIISQFKETGKPFSEFHNFHAIQLNDTHPTLGIPELMRILIDEEKKSWDEAWDITTKTFSYTNHTVL
PHSG_CHLPN      TIQDIIRRYTKTHICLDNLADKVVVQLNDTHPALGIAEMMHILVDREELPWDKAWEMTTVIFNYTNHTIL
PHSG_CHLMU      TIQDILRRYTKTHLSLDKLSEKVSVQLNDTHPALGIAEMMHILVDREELDWDVAWDTTTKIFNYTNHTIL
PHSG_CHLTR      TIQDILRRYTKTHLSLDKLSEKVSVQLNDTHPALGIAEMMRLLVDREELDWDVAWDATTKIFNYTNHTIL
PHS1_DICDI      TLCDVIRRFKKSHQNWQDFPNKVAIQLNDTHPTIGVVELFRKLIDEEGLQWEEAWDIVTKTFAYTNHTIL
PHSG_YEAST      SLHDILRRFKKSKRPWTEFPDQVAIQLNDTHPTLAIVELQRVLVDLEKLDWHEAWDIVTKTFAYTNHTVM
PHSM_ECOLI      SVADILRRHHLAGRKLHELADYEVIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLM
PHSH_ARATH      SLQDIISRFRSTTEGSRKWSEFVAVQMNDTHPTLAIPELMRLLMDDNGLGWDEAWDVTSKTVAYTNHTVL
PHSM_STRPN      GAQLIIDEAIEKGSNLHDLADYAVVQINDTHPSMVIPELIRLLT-ARGIDLDEAISIVRSMTAYTNHTIL
PHSH_VICFA      SLQDIISRFKERRQGPWNWSEFVAVQLNDTHPTLSIPELMRLLMDDEGLGWDEAWAVTSKTVAYTNHTVL
PHSH_SOLTU      SLQDIIARFKKGSHQWSEFPKKVAIQLNDTHPTLTIPELMRLLMDDEGLGWDESWNITTRTIAYTNHTVL
PHSH_WHEAT      SLQDIIFRFKKADRVSGKWSEFVAVQMNDTHPTLAIPELMRLLMDVEGLGWDEAWAVTNKTVAYTNHTVL
PHSL_VICFA      SLQDIIARFRRSGASVNDFPEKVAVQMNDTHPTLCIPELMRILIDIKGLSWKDAWNITQRTVAYTNHTVL
PHSL1_SOLTU     SLQDIISRFERRSGDRIKWEEFVAVQMNDTHPTLCIPELMRILIDLKGLNWNEAWNITQRTVAYTNHTVL
PHSL_IPOBA      SLQDIIARFERRSGEYVKWEEFVAVQMNDTHPTLCIPELIRILIDLKGLSWKEAWNITQRTVAYTNHTVL
PHSL2_SOLTU     ----------------------------------------------------------------------
PHSG_AQUAE      GFGTVIL--------LEKLGDAGGFHINEDYPSVFLAEIFKLL--KKGLTWDKAIEEVRKISLFTTHTPL
PHSG_MYCTU      GIGG-VRAIRAYT-AVEKLTPPEVFHMNEGHAGFLGIERIRELVTDAGLDFDTALTVVRSSTVFTTHTPV
PHSG_MYCBO      GIGG-VRAIRAYT-AVEKLTPPEVFHMNEGHAGFLGIERIRELVTDAGLDFDTALTVVRSSTVFTTHTPV
Y1631_METJA     -------------------------HMNEPHPLPLVFKLI------EEYGLEYTREHTV----FTTHTPL
Y078_NANEQ      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
PHSG_BACSU      SEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWIENMAITAHGVVKMAHLAIVGSYSVNGV
PHSG_SHIFL      SEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDLLGRASIIDESRVRMAWLAVVVSHKVNGV
PHSG_ECOLI      SEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDLLGRASIIDESRVRMAWLAVVVSHKVNGV
PHSG_PASMU      SEALETWPVEMMAHILPRHLQMIFEINDYFLEYVRTYVSTDFIRRVSLIEEGKVRMGWLSVVGSNKVNGV
PYG_DROME       PEALERWPVSLLESILPRHLQIIYHINFLHMENVKKKFPDDLMRRMSMVEEDRINMAHLSIVGSHAVNGV
PHSG_SYNY3      PEALEKWSLPLFGEMLPRHLEIIYEINQRFLDQVRMKYPNDRLARLSIIDEKSVRMAYLATVGSHAINGV
PHSG_HAEIN      SEALETWPVEMMAKILPRHLQMIFEINDHFLEYVRTYVTNDFIRRVSLIEEGKVRMGWLSVVGSHKINGV
PYGM_SHEEP      PEALERWPVHLIETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGM_RABIT      PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGM_BOVIN      PEALERWPVHLIETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGM_HUMAN      PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGL_BOVIN      PEALERWPVELVEKLLPRHLQIIYEINQKHLDKIAALFPKDVLRRMSLIEEERINMAHLCIVGSHAVNGV
PYGM_MOUSE      PEALERWPVHLMETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGM_MACFA      PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAATFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGL_SHEEP      PEALERWPVELVENLLPRHLQIIYEINQKHLDKIAALFPKDVLRRMSLIEEEGVKMAHLCIVGSHAVNGV
PYGL_MOUSE      PEALERWPVELVEKLLPRHLEIIYEINQKHLDRIVALFPKDIMRRMSLIEEERINMAHLCIVGCHAVNGV
PYGL_RAT        PEALERWPVDLVEKLLPRHLQIIYEINQKHLDRIVALFPKDIMRRMSLIEEERINMAHLCIVGCHAVNGV
PYGM_RAT        PEALERWPVHLMETLLPRHLQIIYEINQRFLNRVAAAFPGDVLRRMSLVEEGAVKMAHLCIAGSHAVNGV
PYGL_HUMAN      PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVLRRMSLIEEERINMAHLCIVGSHAVNGV
PYGB_PONAB      PEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PYGB_HUMAN      PEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PYGB_MOUSE      PEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PYGB_BOVIN      PEALERWPVSMFEKLLPRHLDIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PYGB_RAT        PEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PYGB_SHEEP      PEALERWPVSMFEKLLPRHLDIIYAINQRHLDHVAALFPGDVLRRMSVIEEGRINMAHLCVIGSHAVNGV
PHS2_DICDI      PEALEKWSVSMVENVLPRHIMIIYEINERFLKLVDQKWPGDMSKRLSIIDESDIRMAFLAIVGSHTINGV
PHSG_CHLPN      PEALERWPLDLFSKLLPRHLEIIYEINSRWLEKVGSRYPKDKRRSLSIVEEKRINMANLAVVGSAKVNGV
PHSG_CHLMU      PEALERWSLDLFSKVLPRHLEIIYEINARWLKKVSQKYPGDDDKRLSIIEEGSINMANLAVIGTSKVNGV
PHSG_CHLTR      PEALERWSLDLFSKVLPRHLEIIYEINARWLAKVSQKYPGDNDKRLSIIEEGSVNMANLAVVGTNKVNGV
PHS1_DICDI      PEALEMWPVSLIEDLLPRHMQLIYGINHRFLIQVTQKWPGDIMRGLSIIQEGEVRMAHLAIVGSHCVNGV
PHSG_YEAST      QEALEKWPRRLFGHLLPRHLEIIYDINWFFLQDVAKKFPKDLLSRISIIEENQIRMAFLAIVGSHKVNGV
PHSM_ECOLI      PEALERWDVKLVKGLLPRHMQIINEINTRFLVEKTWPGDEKVWAKLAVVHDKQVHMANLCXXXXXXXXXX
PHSH_ARATH      PEALEKWSQSLMWKLLPRHMEIIEEIDKRFVQTIRDTRVEDKISSLSILDNNPVRMANLCVVSSHTVNGV
PHSM_STRPN      AEALEKWPLEFLQEVVPHLVPIIEELDRRVKAEYKDPAVQIIDESGR------VHMAHMDIHYGYSVNGV
PHSH_VICFA      PEALEKWSQPVMWKLLPRHMEIIEEIDRRFVASKTRLDLEDEVSNMRILDNNLVRMANLCVVSSHTVNGV
PHSH_SOLTU      PEALEKWSQAVMWKLLPRHMEIIEEIDKRFVATIMSERPENKMPSMRILDHNAVHMANLCVVSSHTVNGV
PHSH_WHEAT      PEALEKWSQAVMKKLLPRHMEIIEEIDKRFREMSTRKDMEGKIESMRVLDNNPVRMANLCVVAGHTVNGV
PHSL_VICFA      PEALEKWSMDLMEKLLPRHVEIIEMIDEELIRTIIAEY----------------RMANLCVVGGHAVNGV
PHSL1_SOLTU     PEALEKWSYELMQKLLPRHVEIIEAIDEELVHEIVLKY---------VIPPKKVRMANLCVVGGHAVNGV
PHSL_IPOBA      PEALEKWSYELMEKLLPRHIEIIEMIDEQLINEIVSEYGTDMLEK---IPPKMVRMANLCVVGGHAVNGV
PHSL2_SOLTU     -------------------------------------------------KPQVVHMANLCVVSGHAVNGV
PHSG_AQUAE      RVAVNTYPFHMIEE------QFL------FVKDVYGIDVKKVLELGTNPEDPSEGFNSMSLRLAKYVNAV
PHSG_MYCTU      PAGIDRFPLEMVQ---------------RYVNDQRGDGRSRLLPADRIVEDDPAKMAHMGLRLAQRANGV
PHSG_MYCBO      PAGIDRFPLEMVQ---------------RYVNDQRGDGRSRLLPADRIVEDDPAKMAHMGLRLAQRANGV
Y1631_METJA     PEGNETQDINLLKS-----MGFFGNVDVKLAEKLGGNPFNYTVCALRVCK---------------RANAV
Y078_NANEQ      -------------------------------------------------------------VGFDINCGV


                         .         .         +         .         .         .         .:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
PHSG_BACSU      AKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYA
PHSG_SHIFL      SELHSNLMVQSLFADFAKIFPGRFTNVTNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHC
PHSG_ECOLI      SELHSNLMVQSLFADFAKIFPGRFTNVTNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHC
PHSG_PASMU      AAIHSELMVTSTFADFARIYPERFTNVTNGITPRRWIGVANPELSALFDRYIGKEWRRDLSQLTLLKDKV
PYG_DROME       AAIHSQILKDSLFHDFYEMEPQKFQNKTNGITPRRWLLLCNPGLSDLIAEKIGDEWPVHLDQLVALKKWA
PHSG_SYNY3      AALHSQLVKETILKDFYELWPEKFSNKTNGVTPRRWMVLSNPRLSNLISSRIGDGWIKNLDELKQLEPFA
PHSG_HAEIN      AEIHSDLMVTSTFADFARIFPERFTNVTNGITPRRWLAVANPQLAALFDKYIGSEWRCDLSQIEKLKPFA
PYGM_SHEEP      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVMCNPGLAEVIAERIGEEYIADLDQLRKLLSYV
PYGM_RABIT      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
PYGM_BOVIN      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVMCNPGLAEIIAERIGEEYIADLDQLRKLLSYV
PYGM_HUMAN      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFV
PYGL_BOVIN      AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLNSFL
PYGM_MOUSE      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDYISDLDQLRKLLSYV
PYGM_MACFA      ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFV
PYGL_SHEEP      AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLNSFL
PYGL_MOUSE      AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFV
PYGL_RAT        AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFV
PYGM_RAT        ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEEYISDLDQLRKLLSYL
PYGL_HUMAN      AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
PYGB_PONAB      ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLV
PYGB_HUMAN      ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLV
PYGB_MOUSE      ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDLSQLKKLLSLV
PYGB_BOVIN      ARIHSEIVRQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAETIVERIGEGFLTDLSQLKKLLPLV
PYGB_RAT        ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDLSQLKKLLSLV
PYGB_SHEEP      ARIHSEIVRQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAETIVERIGEDFLTDLSQLKKLLPLV
PHS2_DICDI      AYLHSELVKHDVFPLFYEIWPNKFQNKTNGVTPRRWIQQSNPQLAELITRSLNSDWLVNLDIIKDLVHLA
PHSG_CHLPN      SSFHSQLIKDTLXXXXXXXXXXXXINVTNGVTPRRWIALCNPRLSKLLNETIGDRYIIDLSHLSLIRSFA
PHSG_CHLMU      SSFHSQLIKNTLFKDFVEFFPDKFINVTNGITPRRWLALSNKRLSALLNRSIGTDYLTNLTHLNKVISLA
PHSG_CHLTR      STFHSQLIKSTLFKDFVEFFPDKFINVTNGITPRRWLAXXXXXXXXXXXRTIGTEYLTNLTHLHKVIPLA
PHS1_DICDI      AAMHSELVKHKVFPDFFCLWPEKFQNKTNGVTPRRWIEQANPGLSAIFTKWLGTDWTTNLELVKGIKEHM
PHSG_YEAST      VELHSELIKTTIFKDFIKFYPSKFVNVTNGITPRRWLKQANPSLAKLISETLNEEYLLDMAKLTQLEKYV
PHSM_ECOLI      XXLHSDLVVKDLFPEYHQLWPNKFHNVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLEKFA
PHSH_ARATH      AQLHSDILKAELFADYVSIWPNKFQNKTNGITPRRWLRFCSPELSDIITKWLKTDWITDLDLLTGLRQFA
PHSM_STRPN      AALHTEILKNSELKAFYDLYPEKFNNKTNGITFRRWLMHANPRLSHYLDEILGDGWHHEADELEKLLSYE
PHSH_VICFA      AQLHSDILKSELFASYVSIWPTKFQNKTNGITPRRWINFCSPELSRIITKWLKTDWVTNLDLLTGLREFA
PHSH_SOLTU      AQLHSDILKAELFADYVSVWPTKFQNKTNGITPRRWIRFCSPELSHIITKWLKTDWVTNLELLANLREFA
PHSH_WHEAT      AELHSNILKQELFADYVSIWPNKFQNKTNGITPRRWLRFCNPELSEIVTKWLKTQWTSNLDLLTGLRKFA
PHSL_VICFA      AEIHSEIVKDDVFNAFYKLWPEKFQNKTNGVTPRRWIRFCNPDLSKIITQWIGTEWILNTEKLAELRKFA
PHSL1_SOLTU     AEIHSEIVKEEVFNDFYELWPEKFQNKTNGVTPRRWIRFCNPPLSAIITKWTGTEWVLKTEKLAELQKFA
PHSL_IPOBA      AEIHSDIVKEDVFNDFYQLWPEKFQNKTNGVTPRRWIRFCNPALSNIITKWIGTEWVLNTEKLAELRKFA
PHSL2_SOLTU     AEIHSEIVKDEVFNEFYKLWPEKFQNKTNGVTPRRWLSFCNPELSEIITKWTGSDWLVNTEKLAELRKFA
PHSG_AQUAE      SKRHQEV--SSKMWSFLFKEKENIDYVTNGVHFPTWIC---SDLRRLYEEYLGENFVEDHKSLWELIRDI
PHSG_MYCTU      SLLHGRVSRAMFNELWAGFDPDEIGSVTNGVHAPTW---AAPQWLQLGRELAGSDSLREPVVWQRL--HQ
PHSG_MYCBO      SLLHGRVSRAMFNELWAGFDPDEIGSVTNGVHAPTW---AAPQWLQLGRELAGSDSLREPVVWQRL--HQ
Y1631_METJA     SKKHKE------------------------VCDRMWSWVKDRCEIVAITNAQDKYYWQDPVIREAAKKYD
Y078_NANEQ      RLLRTNLTIDEIKDRLNLLVNEIFRNVPAGVGEGGKLKLSIDELNKVLDYGVGFGWEEDRNRIESYLDFA


                         *         .         .         .         .         +         .:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
PHSG_BACSU      TDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSG
PHSG_SHIFL      DFPMVNHAVHQAKLENKKRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPD
PHSG_ECOLI      DFPMVNHAVHQAKLENKKRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPD
PHSG_PASMU      QDPELKKSIAQIKYNNKVKLANYIKNELGVEVDPNALFDVQVKRIHEYKRQILNVLHIIARYNAMLENP-
PYG_DROME       KDPNFQRNVARVKQENKLKLAAILEKDYGVKINPSSMFDIQVKRIHEYKRQLLNCLHIITLYNRIKKDPT
PHSG_SYNY3      DLAGFRQDWCKVKREVKQDLARYIHTRTDLVVNPDSLFDVQVKRIHEYKRQHLNILHVIHLYLQIKNNP-
PHSG_HAEIN      QEKAFKEAVADIKFANKVKLAEYVKSELGVELDPHALFDVQVKRIHEYKRQMLNVLHIIARYNEMLTNP-
PYGM_SHEEP      DDESFIRDVAKVKQENKLKFSAYLEKEYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
PYGM_RABIT      DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIK--KE
PYGM_BOVIN      DDESFIRDVAKVKQENKLKFSAYLEKEYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
PYGM_HUMAN      DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKR-EP
PYGL_BOVIN      GDDIFLREISNVKQENKLKFSQFLEKEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVVTMYNRIKKDP-
PYGM_MOUSE      DDEAFIRDVAKVKQENKLKFSAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHIITLYNRIKR-EP
PYGM_MACFA      DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKR-EP
PYGL_SHEEP      GDDIFLREISNVKQENKLKFSQFLEKEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVVTMYNRIKKDP-
PYGL_MOUSE      SDDIFLREIAKVKQENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDP-
PYGL_RAT        GDDIFLREIAKVKQENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDP-
PYGM_RAT        DDQAFIRDVAKVKQENKLKFSAYLETEYKVHINPNSLFDVQVKRIHEYKRQLLNCLHIITLYNRIKR-EP
PYGL_HUMAN      GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDP-
PYGB_PONAB      NDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDP-
PYGB_HUMAN      SDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDP-
PYGB_MOUSE      DDEAFIRDVAKVKQENKLKFSAQLEKEYKVKINPASMFDVHVKRIHEYKRQLLNCLHIITLYNRIKKDP-
PYGB_BOVIN      GDEALIRDVAQVKQENKVKFSAFLEKQYGVKVNPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKKDPT
PYGB_RAT        DDEAFIRDVAKVKQENKLKFSAQLEKEYKVKINPCSMFDVHVKRIHEYKRQLLNCLHIITLYNRIKKDPT
PYGB_SHEEP      GDEALIRDVAQVKQENKVKFSAFLEKQYGVKVNPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKKDPT
PHS2_DICDI      DNSSFQKEWMEIKRNNKIRLAKYIEKRCDIQVNVDVLFDVQVKRFHEYKRQLLNVLSVINRYLDIKEGKK
PHSG_CHLPN      EDSGFRDHWKGVKLKNKQDLTSRIYNEVGEIVDPNSLFDCHIKRIHEYKRQLMNILRVIYVYNDLKENP-
PHSG_CHLMU      EDSGFREEWHKIKIQNKEDLSARIYKELGVSVNPQSIFDCHIKRIHEYKRQLMNILRVIYFYNEIRNG--
PHSG_CHLTR      EDSGFREEWRNIKIQNKEELAARIYKELGVTVNPQSIFDCHIKRIHEYKRQLMNILRVIYFYNEIRNG--
PHS1_DICDI      DNPELIAEWKYVKQGNKQRLAEFILKHCGIHVNPNALFDVHIKRIHEYKRQLLNILSVIYRYLSIKKPKD
PHSG_YEAST      EDKEFLKKWNQVKLNNKIRLVDLIKKENGVDIINDTLFDMQVKRIHEYKRQQLNVFGIIYRYLAMKNEEV
PHSM_ECOLI      DDAKFRQQYREIKQANKVRLAEFVKVRTGIEINPQAIFDIQIKRLHEYKRQHLNLLHILALYKEIRENPQ
PHSH_ARATH      DNEELQSEWASAKTANKKRLAQYIERVTGVSIDPTSLFDIQVKRIHEYKRQLMNILGVVYRFKKLKEMKP
PHSM_STRPN      DKAVVKEKLESIKAHNKRKLARHLKEHQGVEINPNSIFDIQIKRLHEYKRQQMNALYVIHKYLDIKAGNI
PHSH_VICFA      DNEDLQAEWLSAKRANKQRLAQYVLQVTGENIDPDSLFDIQVKRIHEYKRQLLNILGVIYRYKKLKEPEE
PHSH_SOLTU      DNSELHAEWESAKMANKQRLAQYILHVTGVSIDPNSLFDIQVKRIHEYKRQLLNILGVIYRYKKLKSPEE
PHSH_WHEAT      DDEKLHAEWXXXXXXXXXXXXXHVLDVTGVTIDPDSLFDIQIKRIHEYKRQLMNILGAVYRYKKLKEMSA
PHSL_VICFA      DNEDLQTQWREAKRNNKVKVAAFLRERTGYSVSPDSMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMNA
PHSL1_SOLTU     DNEDLQNEWREAKRSNKIKVVSFLKEKTGYSVVPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMTA
PHSL_IPOBA      DNEDLQIEWRAAKRSNKVKVASFLKERTGYSVSPNAMFDIQVKRIHEYKRQLLNILGIVYRYKQMKEMSA
PHSL2_SOLTU     DNEELQSEWRKAKGNNKMKIVSLIKEKTGYVVSPDAMFDVQIKRIHEYKRQLLNIFGIVYRYKKMKEEER
PHSG_AQUAE      PDEELWEY----HIRNKERLIEHIKDRAGLFLDSDVLTVGFARRMTGYKRPDLIFTDVERLK------KI
PHSG_MYCTU      VDPAIRSQLRSMLVEDVRARLRQSWLERG---ATDAAFDPNVRRVPTYKRLTLMLRRLEQLLLDEQQLIV
PHSG_MYCBO      VDPAIRSQLRSMLVEDVRARLRQSWLERG---ATDAAFDPNVRRVPTYKRLTLMLRRLEQLLLDEQQLIV
Y1631_METJA     ID-----MLRERKMELKEILFEEVADQTGKIFKKDRLTVVWARRFTAYKRPHIXXXXXXXXXXXXXXXRI
Y078_NANEQ      DSDAVSN---TAKQRGKDQLGTIGSGNHFLEIQVDQIYDEEIAKAFGIKNQVTVLIHVASDYLRLFEKKY


                         .         .         .         *         .         .         .:630
query           ASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
PHSG_BACSU      FSIY-PQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSE
PHSG_SHIFL      AK-WVPRVNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAADLSE
PHSG_ECOLI      AK-WVPRVNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAADLSE
PHSG_PASMU      EKDWVPRVFILXXXXXXXXXXXXQTINLINDVANIINHDERLQGRLKVVFIPNYSVSLAELIIPAADISE
PYG_DROME       A-NFTPRTIMIGGKAAPGYYVAKQIIKLICAVGNVVNNDPIVGDKLKVIFLENYRVTLAEKIMPAADLSE
PHSG_SYNY3      NLDVTPRTFIYGGKAAPGYFTAKLIIKLINSVADVVNNDPTIGDRLKVIFLPDYNVKFGQRVYPAADLSE
PHSG_HAEIN      EKDWQPRVFILXXXXXXXXXXXXQTIHLINDVANVINNDERLKGRLKVVFIPNYSVSLAQLIIPAADISE
PYGM_SHEEP      NKFFVPRTVMIGGKAAPGYHMAKMIIRLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
PYGM_RABIT      PNKFVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
PYGM_BOVIN      NKFFVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
PYGM_HUMAN      NKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSE
PYGL_BOVIN      KKLFVPRTVIIGGKAAPGYYMAKLIIKLITSVAEVVNNDPVVGSKLKLIFLENYRVSLAEKVIPATDLSE
PYGM_MOUSE      NRFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSE
PYGM_MACFA      NKFFVPRTVMIGGKAAPGHHMAKMIIRLITAIGDVVNHDPTVGDRLRVIFLENYRVSLSEKVIPAADLSE
PYGL_SHEEP      KKLFVPRTVIIGGKAAPGYYMAKLIIKLITSVAEVVNNDPMVGSKLKLIFLENYRVSLAEKVIPATDLSE
PYGL_MOUSE      KKFFVPRTVIIGGKAAPGYHMAKMIIKLITSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
PYGL_RAT        KKFFVPRTVIIGGKAAPGYHMAKMIIKLVTSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
PYGM_RAT        NRFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPAVGDRFRVIFLENYRVSLAEKVIPAADLSE
PYGL_HUMAN      KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
PYGB_PONAB      AKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQ
PYGB_HUMAN      AKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQ
PYGB_MOUSE      AKAFVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSQ
PYGB_BOVIN      QA-FVPRTVMIGGKAAPGYHMAKKIIKLVTSIGNIVNHDPIVGDRLKVIFLENYRVSLAEKVIPAADLSQ
PYGB_RAT        KT-FVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSQ
PYGB_SHEEP      QA-FVPRTVMIGGKAAPGYHMAKKIIKLVTSIGDIVNHDPIVGDRLKVIFLENYRVSLAEKVIPAADLSQ
PHS2_DICDI      VA---PRVVIFGGKAAPGYYMAKLIIKLINSVADVVNNDPKVGDLLKVVFIPNYCVSNAEIIIPASDISQ
PHSG_CHLPN      NQDVVPTTVIFSGKAAPGYVMAKLIIKLINSVADVVNQDSRVNDKLKVLFLPNYRVSMAEHIIPGTDLSE
PHSG_CHLMU      STEIVPTTVIFGGKAAPGYAMAKLIIKLINNVAHIVNNDPKAKDLLKVVFWPNYRVSLAEAIIPATDLSE
PHSG_CHLTR      SGEIVPTTVIFGGKAAPGYAMAKLIIKLINNVAAVVNNDPKVNDQLKVIFWPNYRVSLAEAIIPATDLSE
PHS1_DICDI      RAQVVPRVVIFAGKAAPGYVMAKRHIKLINSVAEVINRDKEVDQYLKVVFIANYNVSIAQVIVPASDINQ
PHSG_YEAST      AKKYPRKVSIFGGKSAPGYYMAKLIIKLINCVADIVNNDESIEHLLKVVFVADYNVSKAEIIIPASDLSE
PHSM_ECOLI      A-DRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISE
PHSH_ARATH      EERKKPRTVMIGGKAFATYTNAKRIVKLVNDVGDVVNSDPEVNEYLKVVFVPNYNVTVAEMLIPGSELSQ
PHSM_STRPN      PA--RPITIFFGGKAAPAYTIAQDIIHLILCMSEVIANDPAVAPHLQVVMVENYNVTAASFLIPACDISE
PHSH_VICFA      RKSTTARTVMIGGKAFATYTNAKRIVKLVDDVGSVVNSDPEVNSYLKVVFVPNYNVSVAEVLIPGSELSQ
PHSH_SOLTU      RKNTTPRTVMIGGKAFATYTNAKRIVKLVTDVGDVVNSDPDVNDYLKVVFVPNYNVSVAEMLIPGSELSQ
PHSH_WHEAT      AQKVTPRTVMVGGKAFATYTNAKRIVKLXXXXXXXXXXXXXXXKYLKVVFIPNYNVSVAEVLIPGSELSQ
PHSL_VICFA      AENFVPRVCIFGGKAFATYVQAKRIVKFITDVGATVNHDPEIGDLLKVIFVPDYNVSVAEMLIPASELSQ
PHSL1_SOLTU     ATNFVPRVCIFGGKAFATYVQAKRIVKFITDVGATINHDPEIGDLLKVVFVPDYNVSVAELLIPASDLSE
PHSL_IPOBA      RAKFVPRVCIFGGKAFATYVQAKRIAKFITDVGATINHDPEIGDLLKVIFVPDYNVSAAELLIPASGLSQ
PHSL2_SOLTU     KEKFVPRVCIFGGKAFATYVQAKRIVKFITDVGETVNHDPEIGDLLKVVFVPDYNVSVAEVLIPGSELSQ
PHSG_AQUAE      VNDSERPVQII--FAGKAHPADIEGKKIIQRIFNFAK-DPEFGGR--IAFVEDYDELLAHYMVRGVDVWL
PHSG_MYCTU      AGKSHP--------------ADDGGKALIQQVVRFADR-PQV--RHRIAFLPNYDMSMARLLYWGCDVWL
PHSG_MYCBO      AGKSHP--------------ADDGGKALIQQVVRFADR-PQF--RHRIAFLPNYDMSMARLLYWGCDVWL
Y1631_METJA     ------QVIWAGKPHPNDHNMIATFNWIVSKTRDMKG----------ATILTGYELKLSKMLKQGSDIWL
Y078_NANEQ      KYDVPDRELIY-----------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN
PHSG_BACSU      QISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQ
PHSG_SHIFL      QISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRRQG-YKPREYYE
PHSG_ECOLI      QISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRRQG-YKPREYYE
PHSG_PASMU      QISLAGTEASGTSNMKFALNGALTIGTLDGANVEILDNVGQDHIFIFGNTVEQVESLRRHG-YRPFDYYQ
PYG_DROME       QISTAGTEASGTGNMKFQLNGALTIGTLDGANVEMAEEMGLDNIFIFGMTVDEVEALKKKG-YNAYDYYN
PHSG_SYNY3      QISTAGKEASGTGNMKFSMNGALTIGTLDGANIEIREEVGAENFFLFGLTTPEVEKTLAEG-YQPWEYYN
PHSG_HAEIN      QISLAGTEASGTSNMKFALNGALTLGTLDGANVEILENVGEDNIFIFGNTVEQVEQLRREG-YRSFEYYQ
PYGM_SHEEP      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-ERLDQKGYNAQEYYD
PYGM_RABIT      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
PYGM_BOVIN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-ERLDQKGYNAQEYYD
PYGM_HUMAN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DKLDQRGYNAQEYYD
PYGL_BOVIN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIEDVAALDKKG-YEAKEYYE
PYGM_MOUSE      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-ERLDQRGYNAQEYYD
PYGM_MACFA      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DKLDQRGYNAQEYYD
PYGL_SHEEP      QISTAGTEASGTGNMKFMQNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVAALDKKG-YEAKEYYE
PYGL_MOUSE      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVAALDKKG-YEAKEYYE
PYGL_RAT        QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVAALDKKG-YEAKEYYE
PYGM_RAT        QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEDNFFIFGMRVEDV-ERLDQRGYNAQEYYD
PYGL_HUMAN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
PYGB_PONAB      QISTAGAEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLQVEDV-EALDRKGYNAREYYD
PYGB_HUMAN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAREYYD
PYGB_MOUSE      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDV-EALDQKGYNAREFYE
PYGB_BOVIN      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAHEYYD
PYGB_RAT        QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDV-EALDQKGYNAQEFYE
PYGB_SHEEP      QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAHEYYN
PHS2_DICDI      HISTAGTEASGTSNMKFSMNGGLIIGTLDGANIEIRDAIGHENMYIFGARSEEV----NKVKKIIHDKFT
PHSG_CHLPN      QISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKENMFIFGLLEEQIVQL--RREYCPQTICD
PHSG_CHLMU      QISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEHMFIFGLLEEEISALRN--EYYPQGICN
PHSG_CHLTR      QISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEHMFIFGLLEEEISEL--RKEYYPQGICN
PHS1_DICDI      QISTAGTEASGTSNMKFTMNGSLIIGTLDGANVEIAEEVGQENMFIFGLRTSEVEAAREKMTNKEVNIDP
PHSG_YEAST      HISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNVFLFGNLSENVEELRYNHQYHPQDLPS
PHSM_ECOLI      QISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKAILAKG-YDPVKWRK
PHSH_ARATH      HISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEVGEENFFLFGATADQVPRLRKEREDGLFKPDP
PHSM_STRPN      QISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELVGEENIYIFGEDSETVIDLYAKAAYKSSEFY-
PHSH_VICFA      HISTAGMEASGTSNMKFALNRVLIIGTLDGANVEIREEIGEENFFLFGATADEVPRLRKERENGLFKPDP
PHSH_SOLTU      HISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEIGEDNFFLFGATADEVPQLRKDRENGLFKPDP
PHSH_WHEAT      HISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIREEVGQDNFFLFGAKADQVAGLRKDRENGLFKPDP
PHSL_VICFA      HISTAGMEASGTSNMKFAMNGCLQIGTLDGANVEIREEVGADNFFLFGAKAREIVGLRKERARGKFVPDP
PHSL1_SOLTU     HISTAGMEASGTSNMKFAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKERADGKFVPDE
PHSL_IPOBA      HISTAGMEASGQSNMKFAMNGCILIGTLDGANVEIRQEVGEENFFLFGAEAHEIAGLRKERAEGKFVPDE
PHSL2_SOLTU     HISTAGMEASGTSNMKFSMNGCLLIGTLDGANVEIREEVGEDNFFLFGAQAHEIAGLRKERAEGKFVPDP
PHSG_AQUAE      NNPLPPLEACGTSGMKASMNGVLHLSILDGWWIE------------------------------------
PHSG_MYCTU      NNPLRPLEACGTSGMKSALNGGLNLSIRDG----------------------------------------
PHSG_MYCBO      NNPLRPLEACGTSGMKSALNGGLNLSIRDG----------------------------------------
Y1631_METJA     NTPKLNHEASGTSGMTASMNASIHMSTLDGWHVEWAKMYPDDSFTIDGVRDDDAY---------------
Y078_NANEQ      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           NHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLV
PHSG_BACSU      HDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIV
PHSG_SHIFL      KDEELHQVLTQIGSGVFPEDPGRYRDLVDSLINFGDHYQVLADYRSYVDCQDKVDELYELQEEWTAKAML
PHSG_ECOLI      KDEELHQVLTQIGSGVFPEDPGRYRDLVDSLINFGDHYQVLADYRSYVDCQDKVDELYELQEEWTAKAML
PHSG_PASMU      NDEELRKVVDQIISGRFSPTDANRYHQLLQSLQYHDYYQAFADFRSYVDMQQNVDAKYQDQNAWIDSTLQ
PYG_DROME       ANPEVKQVIDQIQGGFFPGNPNEFKNIAD-IXXXXXXXXXXXXXXXXXXXQDLVSKTYQNQAKWLEMSIN
PHSG_SYNY3      NNANLKAVVDLINSGFFSHGDALFRPLMDSLLG-QDPYLVFADFQAYVDCQNQVGEAYKDQENWARMAIL
PHSG_HAEIN      NDAQLRTVVDQIIEGKFPEDPQRYHQLLQGL-QYHDYYQAFADFRSYVETQKAVDEKYKQRDQWIESTIQ
PYGM_SHEEP      RIPELRHIIDQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
PYGM_RABIT      RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
PYGM_BOVIN      RIPELRHVIDQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYIKCQERVSALYKNPREWTRMVIR
PYGM_HUMAN      RIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIR
PYGL_BOVIN      ALPELKLAIDQIDKGFFSPKQPDLFKDLVNMLFYHDRFKVFADYEAYVKCQEKVSQLYMNPKAWNIMVLK
PYGM_MOUSE      RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYIKCQDKVSELYKNPREWTRMVIR
PYGM_MACFA      RIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIR
PYGL_SHEEP      ALPELKLAIDQIDKGFFSPKQPDLFKDLVNMLFYHDRFKVFADYEAYVKCQEKVSQLYMNPKAWNIMVLK
PYGL_MOUSE      ALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLK
PYGL_RAT        ALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLR
PYGM_RAT        RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMVMHHDRFKVFADYEEYIKCQDKVSELYKNPREWTRMVIR
PYGL_HUMAN      ALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
PYGB_PONAB      HLPELKQAVDQISSGFFPNCFKD----IVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIR
PYGB_HUMAN      HLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIR
PYGB_MOUSE      RLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMYHDRFKVFADYEAYIQCQAQVDRLYRNSKEWTKKVIR
PYGB_BOVIN      RLPELRQAVDQINGGFFSPREPDCFKDVVNMLLNHDRFKVFADYEAYVACQARVDQLYRNPKEWTKKVIR
PYGB_RAT        RLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMYHDRFKVFADYEAYIQCQAQVDHLYRNPKDWTKKVIR
PYGB_SHEEP      HLPELQQAVDQINSGFFSPREPDCFKDVVNMLLNHDRFKVFADYEAYVACQAQVDQLYRNPKEWTKKVIR
PHS2_DICDI      PDTRWARVLTAIKEDTF-GPHEQFQDIINSVSGGNDHYILSYDFGSYLDIQNSIDQDFKDRAKWAKKSIM
PHSG_CHLPN      KNPKIRQVLDLLEQGFFSNDKDLFKPIVHRLLHEGDPFFVLADLESYIAAHENVNKLFKEPDSWTKISIY
PHSG_CHLMU      ANPKIQEILDMVLQARLPE---EDKDLFNRLLNEGDPFFVLADLESYLDAHNRVARLFTQPEEWTKKSIY
PHSG_CHLTR      ANPTIQEILDMIAQAKF---SQEDKDLFNRLLNEGDPFFVLADLEAYINTQNRVASLFKQPEEWTKKSIY
PHS1_DICDI      RLQEV--FLNIELGTFGP--PDVFRPILDSLI-FSDFYLSIQDFPLYLDSQASVDELWKDQSAWVKKSII
PHSG_YEAST      S---LDSVLSYIESGQFPENPNEFKPLVDSIKYHGDYYLVSDDFESYLATHELVDQEFHNQREWLKKSVL
PHSM_ECOLI      KDKVLDAVLKELESGKYSDGDKHADQMLHSIGKQGDPYLVMADFAAYVEAQKQVDVLYRDQEAWTRAAIL
PHSH_ARATH      RFEEAKQFVKSGVFGSY-----DYGPLLDSLEGRGDYFLVGYDFPSYMDAQAKVDEAYKDRKGWLKMSIL
PHSM_STRPN      AREAIKPLVDFIVDAVLAAGNKERLERFYNELINKDWFMTLLDLEDYIKVKEQMLADYEDRDAWLDKVIV
PHSH_VICFA      RFEEAKKFIRSGVFGSY-----DYNPLLDSLEGNSDYFLVGYDFPSYMDAQEKVDEAYRDKKRWLKMSIL
PHSH_SOLTU      RFEEAKQFIRSGAFGTYDNPLLESLE-GNSGYGRGDYFLVGHDFPSYMDAQARVDEAYKDRKRWIKMSIL
PHSH_WHEAT      RFEEAKQFIRSGAFGTY-----DYTPLLDSLEGRGDYFLVGYDFPSYIDAQARVDEAYKDKKKWVKMSIL
PHSL_VICFA      RFEEVKKFVRSGVFGSYNYDELEGNEGFGRA----DYFLVGQDFPSYLECQEEVDKAYRDQKKWTRMSIL
PHSL1_SOLTU     RFEEVKEFVRSGAFGSYNYGSLEGNEGFGRA----DYFLVGKDFPSYIECQEKVDEAYRDQKRWTTMSIL
PHSL_IPOBA      RFEEVKEFIKRGVFGSNTYDELEGNEGFGR----GDYFLVGKDFPSYIECQEKVDEAYRDQKIWTRMSIL
PHSL2_SOLTU     RFEEVKAFIRTGVFGTYNYEELMGSLEGNEGYGRADYFLVGKDFPDYIECQDKVDEAYRDQKKWTKMSIL
PHSG_AQUAE      ----------------------------------------------------------------------
PHSG_MYCTU      ----------------------------------------------------------------------
PHSG_MYCBO      ----------------------------------------------------------------------
Y1631_METJA     ----------------------------------------------------------------------
Y078_NANEQ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NIAYGGMFSSDDTIKRYAEDIWNISPLKDExxxxxxx
PHSG_BACSU      NIAHSGYFSSDRTIREYAKDIWGIKPM----------
PHSG_SHIFL      NIANMGYFSSDRTIKEYADHIWHIDPVR---------
PHSG_ECOLI      NIANMGYFSSDRTIKEYADHIWHIDPVR---------
PHSG_PASMU      NIVNMSYFSSDRTILEYAEKIWKIKPVK---------
PYG_DROME       NIASSGKFSSDRTIAEYAREIWGVEP-----------
PHSG_SYNY3      NVARMGKFSSDRTIREYAEDIWAIKPV----------
PHSG_HAEIN      NIVNMGFFSSDRTIKEYAERIWKVEPVQ---------
PYGM_SHEEP      NIATSGKFSSDRTIAQYAREIWGVEPTR---------
PYGM_RABIT      NIATSGKFSSDRTIAQYAREIWGVEP-----------
PYGM_BOVIN      NIATSGKFSSDRTIAQYAREIWGVEPTR---------
PYGM_HUMAN      NIATSGKFSSDRTIAQYAREIWGVEP-----------
PYGL_BOVIN      NIAASGKFSSDRTIKEYARDIWNMEP-----------
PYGM_MOUSE      NIATSGKFSSDRTIAQYAREIWGVEP-----------
PYGM_MACFA      NIATSGKFSSDRTIAQYAREIWGVEP-----------
PYGL_SHEEP      NIAASGKFSSDRTIKEYARDIWNMEP-----------
PYGL_MOUSE      NIAASGKFSSDRTIKEYAKDIWNMEP-----------
PYGL_RAT        NIAASGKFSSDRTIREYAKDIWNMEP-----------
PYGM_RAT        NIATSGKFSSDRTIAQYAREIWGLEP-----------
PYGL_HUMAN      NIAASGKFSSDRTIKEYAQNIWNVEP-----------
PYGB_PONAB      NIACSGKFSSDRTITEYAREIWGVEP-----------
PYGB_HUMAN      NIACSGKFSSDRTITEYAREIWGVEP-----------
PYGB_MOUSE      NIACSGKFSSDRTITEYAREIWGVEP-----------
PYGB_BOVIN      NIACSGKFSSDRTITEYAHDIW---------------
PYGB_RAT        NIACSGKFSSDRTITEYAREIWGVEP-----------
PYGB_SHEEP      NIACSGKFSSDRTITEYARDIW---------------
PHS2_DICDI      ASVCCGKFSSDRTIKEYAQQIWGIEEWK---------
PHSG_CHLPN      NTAGMGFFSSDRAIQDYARDIWHV-------------
PHSG_CHLMU      NVGGIGFFSSDRSITDYASNIWNVS------------
PHSG_CHLTR      NVGGIGFFSSDRSIAEYASNIWNVS------------
PHS1_DICDI      NSASTYFFSSDRAMNEYAEQIWDIKPCEVE-------
PHSG_YEAST      SLANVGFFSSDRCIEEYSDTIWNVEPV----------
PHSM_ECOLI      NTARCGMFSSDRSIRDYQARIW---------------
PHSH_ARATH      STAGSGKFSSDRTIAQYAKEIWNI-------------
PHSM_STRPN      NISKAGFFSSDRTIAQYNEDIWHLN------------
PHSH_VICFA      STAGSGKFSSDRTIAQYAKEIWNI-------------
PHSH_SOLTU      STSGSGKFSSDRTISQYAKEIWNIA------------
PHSH_WHEAT      NTAGSGKFSSDRTIDQYAKEIWGIS------------
PHSL_VICFA      NTAGSSKFSSDRTIHEYAREIWNIEPVKLE-------
PHSL1_SOLTU     NTAGSYKFSSDRTIHEYAKDIWNIEAVE---------
PHSL_IPOBA      NTAGSYKFSSDRTIHEYAKDIWNIQPV----------
PHSL2_SOLTU     NTAGSFKFSSDRTIHQYARDIWRIEPVE---------
PHSG_AQUAE      -------------------------------------
PHSG_MYCTU      -------------------------------------
PHSG_MYCBO      -------------------------------------
Y1631_METJA     -------------------------------------
Y078_NANEQ      -------------------------------------